最新美国发明专利第2018-02-13期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US09890203B2	Process for preparing apolipoprotein A-I (Apo A-I) The present invention relates to processes of obtaining Apo A-1 from an Apo A-1 containing protein fraction (A), comprising suspending—the Apo A-1 containing protein fraction (A) in a buffer solution (B), removing impurities from the suspension while keeping the Apo A-1 proteins solubilized, followed by precipitating Apo A˜I from the suspension and collecting the Apo A-1 precipitate. Apo A-I obtained by such processes, reconstituted HDL obtained from such Apo A-1, and pharmaceutical compositions comprising such Apo A-I and/or reconstituted HDL also are provided.
US09890199B2	Staphylococcus aureus SpA5 mutant, composition comprising mutant and preparation method and use thereof Provided is staphylococcus protein A expressed by a mutational Staphylococcus aureus and its coding sequence, as well as a vector, host bacteria, composition or kit which contains the coding sequence of the mutational protein. Also provided is the use of the mutational protein and the composition thereof in the preparation of vaccines, therapeutic antibodies, diagnostic kits and the like, and for the prevention, treatment and detection of infections by Staphylococcus aureus. Also provided are methods for producing, fermenting and purifying the mutational protein.
US09890197B2	RHAMM binding peptides The present invention provides for peptides that bind to Receptor for Hyaluronic Acid Mediated Motility (RHAMM) molecules. More specifically, provided are peptides capable of specifically binding RHAMM molecules and capable of binding RHAMM with substantially high affinity. These novel RHAMM-binding peptides provide the basis for new imaging probes that can be used to identify cells expressing RHAMM, and for methods of imaging, prognosis, diagnosis and treatment of conditions associated with RHAMM expression.
US09890189B2	Gemcitabine prodrugs and uses thereof The present invention provides compounds according to formula I: and pharmaceutically acceptable salts thereof. For compounds of formula I, R1 and R2 are independently selected from the group consisting of H, —C(═O)—(CH2)2-aryl, and —C(═O)—(CH2)n—C(═O)—NH-aryl. The subscript n is from 2 to 6. R3 is selected from the group consisting of H and —C(═O)—O—R4; and R4 is selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, arylalkyl, substituted arylalkyl, cycloheteroalkyl, substituted cycloheteroalkyl, heteroalkyl and substituted heteroalkyl. Compounds are provided wherein at least one of R1 and R2 is other than H. Pharmaceutical compositions, methods for inhibiting the growth of cancer cells, and methods for the treatment of cancer are also provided.
US09890187B2	Prototype systems of theranostic biomarkers for in vivo molecular management of cancer The present invention relates to a theranostic system comprising a beacon and a compound selected from the group consisting of a quinazoline-based tyrosine kinase inhibitor and a natural product. The theranostic systems have use in the therapy and diagnosis of tyrosine kinase related malignancies.
US09890182B2	Selective 1,2-hydrosilylation of terminally unsaturated 1,3-dienes using iron catalysts The present invention is directed to a selective and efficient process for the hydrosilylation of compounds containing terminally unsaturated 1,3-dienes using iron-based hydrosilylation catalysts. The resulting 1,2-addition products are useful as precursors for various silicone materials or silane- or silyl/silicone-functionalized polyolefins.
US09890181B2	Silicon phthalocyanine complex, preparation method and medicinal application thereof The present invention relates to a silicon phthalocyanine complex, the preparation method and the medicinal application thereof. The present invention particularly relates to a silicon phthalocyanine complex of formula (I), the preparation method thereof and a pharmaceutical composition comprising the same, as well as the use thereof as a photosensitizer, in particular the use in the treatment of cancers, wherein each substituent in formula (I) is the same as defined in the description.
US09890179B2	Methods of preparing cytotoxic benzodiazepine derivatives The invention relates to novel methods for preparing indolinobenzodiazepine dimer compounds and their synthetic precursors.
US09890177B2	Nitrated hydrocarbons, derivatives, and processes for their manufacture Provided is a process for the formation of nitrated compounds by the nitration of hydrocarbon compounds with dilute nitric acid. Also provided are processes for preparing industrially useful downstream derivatives of the nitrated compounds, as well as novel nitrated compounds and derivatives, and methods of using the derivatives in various applications.
US09890176B2	Mannose derivatives for treating bacterial infections The present invention relates to compounds useful for the treatment or prevention of bacteria infections. These compounds have formula I: The invention also provides processes for making the compounds described herein. Furthermore, the present invention provides a composition comprising the compounds described herein, and a pharmaceutically acceptable carrier, adjuvant, or vehicle. The present invention also provides methods of treating or preventing bacteria infection in a subject, comprising administering to the subject an effective amount of the compound or the composition described herein.
US09890169B2	Triazolinone compounds as HNE inhibitors Triazolinone compounds of formula (I) defined herein exhibit human neutrophil elastase inhibitory properties and are useful for the therapy of diseases and conditions in which HNE is implicated.
US09890165B2	Tricyclic compound and JAK inhibitor Novel tricyclic compounds which have JAK inhibitory activities are useful for prevention, treatment or improvement of autoimmune diseases, inflammatory diseases and allergic diseases are provided.Novel tricyclic compound represented by the formula (I), the formula (II) or the formula (III) (wherein: each of A1, A2 and A3 is a cyclohexane-1,4-diyl group or the like; each of L1, L2 and L3 is a methylene group or the like; each of X1 and X3 is O or NH; each of R1 and R3 is a cyano C1-6 haloalkyl group or the like; and R2 is an aromatic heterocyclic group), a tautomer or pharmaceutically acceptable salt of the compound or a solvate thereof.
US09890164B2	Substituted-quinoxaline-type bridged-piperidine compounds as ORL-1 modulators Compounds of Formula (I): where R1, R2, R5, a, and b are disclosed herein, and pharmaceutically acceptable derivatives thereof (a “Substituted-Quinoxaline-Type Bridged-Piperidine Compound”), compositions comprising an effective amount of a Substituted-Quinoxaline-Type Bridged-Piperidine Compound, and methods to treat or prevent a condition, such as pain, comprising administering to an animal in need thereof an effective amount of a Substituted-Quinoxaline-Type Bridged-Piperidine Compound.
US09890161B2	Derivatives and methods of treating hepatitis B infections Provided herein are compounds useful for the treatment of HBV infection in a subject in need thereof, pharmaceutical compositions thereof, and methods of inhibiting, suppressing, or preventing HBV infection in the subject.
US09890159B2	Process for making duocarmycin prodrugs The present invention relates to a process comprising converting a compound of formula (I) into a compound of formula (II) by reaction with an organolithium reagent, which compound can be further converted into duocarmycin analogs consisting of a DNA-alkylating and a DNA-binding part, and still further into corresponding antibody-drug conjugates.
US09890155B2	Aza-oxo-indoles for the treatment and prophylaxis of respiratory syncytial virus infection The invention provides novel compounds having the general formula: wherein R1, R2, R3, R4, R5, W and X are as described herein, compositions including the compounds and methods of using the compounds.
US09890154B2	Imidazopyridine derivatives as modulators of TNF activity A series of substituted 3H-imidazo[4,5-c]pyridine derivatives of formula (I), being potent modulators of human TNFa activity, are accordingly of benefit in the treatment and/or prevention of various human ailments, including autoimmune and inflammatory disorders; neurological and neurodegenerative disorders; pain and nociceptive disorders; cardiovascular disorders; metabolic disorders; ocular disorders; and oncological disorders.
US09890151B2	3,5-dichloro,4-(3,4-(cyclo-)alkoxyphenyl)- 2-carbonyloxy)ethyl)pyridine derivatives as PDE-4 inhibitors The invention relates to novel 3,5-dichloro,4-(3,4-(cyclo-) alkoxyphenyl)-2-carbonyloxy)ethyl)pyridine compounds which are both inhibitors of the phosphodiesterase 4 (PDE4) enzyme and muscarinic M3 receptor antagonists, methods of preparing such compounds, compositions containing them and therapeutic use thereof.
US09890150B2	Fatty acid conjugates of quetiapine, process for making and using the same The presently described technology provides a novel class of prodrugs of quetiapine that can be synthesized by chemically conjugating fatty acids to quetiapine. Pharmaceutical compositions and methods of synthesizing conjugates of the present technology are also provided. Methods of treating patients with the compositions of the present technology are also provided.
US09890149B2	Isothiazole derivatives as CFTR modulators A compound having the structure of Formula II, or a stereoisomer, tautomer, or a pharmaceutically acceptable salt thereof: The compound is useful as CFTR modulator. Further, a method of using the compound and pharmaceutical composition comprising the compound are provided for treating diseases in lungs, pancreas, gastrointestinal system, sinuses, reproductive system, and the sweat glands.
US09890148B2	Aryl sulfonamides Compounds are provided that act as potent antagonists of the CCR9 receptor, and which have been further confirmed in animal testing for inflammation, one of the hallmark disease states for CCR9. The compounds are generally aryl sulfonamide derivatives and are useful in pharmaceutical compositions, methods for the treatment of CCR9-mediated diseases, and as controls in assays for the identification of CCR9 antagonists.
US09890146B2	Compound having selective EP2 agonist activity A compound represented by general formula (I) wherein all symbols are as defined in the specification, a salt or N-oxide of the compound, or a solvate or prodrug of the compound or the salt or N-oxide has a selective EP2 agonist activity and is highly safe, and is therefore useful as a drug, especially as a therapeutic agent for EP2 receptor-related diseases including immune diseases, allergic diseases, neuronal death, dysmenorrhea, premature birth, miscarriage, baldness, ocular diseases, erectile dysfunction, arthritis, lung injury, pulmonary fibrosis, pulmonary emphysema, bronchitis, chronic obstructive pulmonary disease, bone diseases, cartilage injury and others.
US09890145B2	Heterocyclic compound The present invention provides a heterocyclic compound having an IRAK-4 inhibitory action, which is useful for the prophylaxis or treatment of inflammatory disease, autoimmune disease, osteoarticular degenerative disease, neoplastic disease and the like, and a medicament containing thereof. The present invention relates to a compound represented by the formula (I): wherein each symbol is as defined in the specification, or a salt thereof.
US09890143B2	Retinoic acid receptor antagonists as chaperone-mediated authophagy modulators and uses thereof Compounds, compositions and methods are provided for selectively activating chaperone-mediated autophagy (CMA), protecting cells from oxidative stress, proteotoxicity and lipotoxicity, and/or antagonizing activity of retinoic acid receptor alpha (RARα) in subjects in need thereof.
US09890137B2	2-halo-5-alkynyl-pyridyl nicotinic ligands Disclosed are heterocyclic compounds that are ligands for nicotinic acetylcholine receptors. The compounds are useful for treating a mammal suffering from any one of a range of therapeutic indications, including Alzheimer's disease, Parkinson's disease, dyskinesias, Tourette's syndrome, schizophrenia, attention deficit disorder, anxiety, pain, depression, obsessive compulsive disorder, chemical substance abuse, alcoholism, memory deficit, pseudodementia, Ganser's syndrome, migraine pain, bulimia, obesity, premenstrual syndrome or late luteal phase syndrome, tobacco abuse, post-traumatic syndrome, social phobia, chronic fatigue syndrome, premature ejaculation, erectile difficulty, anorexia nervosa, disorders of sleep, autism, mutism, trichotillomania, and hypothermia.
US09890135B1	Processes and intermediates for the preparations of isomer free prostaglandins Novel processes for the preparation of a compound of Formula I-2 substantially free of the 5,6-trans isomer: wherein R2, R3 and R4 are as defined in the specification are provided. Novel intermediates for the preparations of isomer free Prostaglandins and derivatives thereof are also provided.
US09890130B2	Phenolic epoxy compounds Disclosed herein are compositions and methods of making phenolic compounds, and resins comprising these phenolic compounds. The compounds include multifunctional epoxies, amino glycidyl derivatives, and multi-functional amines prepared from hydroxymethyl derivatives of phenols and bisphenols. In one embodiment, a compound is of formula I wherein R1 is H or Z; each R2, R3, and R4, independently, are —N(Z)2, —N(CH2—O—Z)2, —N(CH2CH2—O—Z)2, —N(CH2OH)2, —N(CH2NH2)2, —O—Z, —CH2—O—Z, —CH2CH2—O—Z, —CH2OH, —CH2NH2, —O—C—(CH3)3, or —O-(alkylene)-CH3; and Z is
US09890128B2	Process for making substituted quinazoline compounds The present invention is directed to a process for making Substituted Quinazoline Compounds of formula (I): which are useful for the treatment and prophylaxis of HCMV infection. The present invention is also directed to compounds that are useful as synthetic intermediates for making the compounds of formula (I).
US09890124B2	Benzazepine sulfonamide compounds This invention relates to novel benzazepine sulfonamide compounds of the formula wherein R4 or R5 is —SO2—NR7R8 and R1 to R8 and Y are as defined in the description and in the claims, as well as pharmaceutically acceptable salts thereof. These compounds are TLR agonists and may therefore be useful as medicaments for the treatment of diseases such as cancer, autoimmune diseases, inflammation, sepsis, allergy, asthma, graft rejection, graft-versus-host disease, immunodeficiencies, and infectious diseases.
US09890115B2	Urea finishing method Disclosed is a method for urea finishing. A urea solution is subjected to crystallization and, other than in conventional processes, the urea crystals are shaped by exerting mechanical force onto them. Thus, the conventional prilling or granulation finishing steps can be avoided, and so are the corresponding emissions of ammonia and/or dust. The crystallization comprises a flash crystallization. The invention also pertains to the urea particles obtainable by the process, to a urea plant, and to a method of modifying an existing urea plant.
US09890114B2	Urea synthesis method There is provided a urea synthesis method having excellent reliability and productivity with the amount of oxygen used as a corrosion-resistant agent minimized without using special duplex stainless steel. In a urea synthesis apparatus having a synthesis tower, a stripper, and a condenser, general-purpose austenitic-ferritic duplex stainless steel with Cr content: 21 to 26 wt %, Ni content: 4.5 to 7.5 wt %, Mo content: 2.5 to 3.5 wt %, N content: 0.08 to 0.30 wt %, C content: 0.03 wt % or less, Si content: 1.0 wt % or less, Mn content: 2.0 wt % or less, P content: 0.04 wt % or less, and S content: 0.03 wt % is used as a urea synthesis apparatus material in at least some of parts where the urea synthesis apparatus comes into contact with a fluid having corrosiveness, and oxygen feed concentration with respect to carbon dioxide is 100 to 2,000 ppm.
US09890113B2	Method for continuous production of adiponitrile A process for the continuous preparation of adiponitrile by hydrocyanation of 3-pentenenitrile is described, wherein a) 3-pentenenitrile is hydrocyanated to give a reaction output comprising adiponitrile, b) in a work-up 1, a mixture comprising cis-2-methyl-2-butenenitrile and cis-2-pentenenitrile is separated off as overhead product from the reaction output from the reactor R1 in a first distillation apparatus, c) the mixture comprising cis-2-methyl-2-butenenitrile and cis-2-pentenenitrile from step b) is continuously isomerized in the presence of aluminum oxide as catalyst in a reactor R2 to give a product mixture comprising 3-pentenenitrile, d) cis-2-methyl-2-butenenitrile is separated off as overhead product from the reaction output from the reactor R2 in a distillation apparatus in a work-up 2 and discharged.
US09890111B2	Crystal structure of bifunctional transglycosylase PBP1b from E. coli and inhibitors thereof The crystal structure at 2.16 Å resolution of the full-length bacterial bifunctional transglycosylase penicillin-binding protein 1b (PBP1b) from Escherichia coli, in complex with its inhibitor moenomycin, is provided. The atomic coordinates of the complex as well as the moenomycin binding site are provided. Three dimensional structures of amino acid residues involved in moenomycin binding and transglycosylation activity are identified. Binding site for peptidoglycan synthesis inhibitors comprising inhibitor-binding site comprises amino acid residues from at least one of transglycosylase (TG), UvrB domain 2 homolog (UB2H) and transmembrane (TM) domains of PBP1b are identified at an atomic level of resolution. Methods for rational drug design based on the atomic coordinates are provided. Methods for screening for antibiotics based on anisotropic binding assay and transglycosylase inhibitor assays are provided. Novel antibiotics based on the screening assays of the invention are disclosed.
US09890106B2	Anti-cancer lead molecule Derivatives of plumbagin can be selectively cytotoxic to breast cancer cells. Derivative ‘A’ (Acetyl Plumbagin) has emerged as a lead molecule for testing against estrogen positive breast cancer and has shown low hepatotoxicity as well as overall lower toxicity in nude mice model. The toxicity of derivative ‘A’ was determined to be even lower than vehicle control (ALT and AST markers). The possible mechanism of action identified based on the microarray experiments and pathway mapping shows that derivative ‘A’ could be acting by altering the cholesterol-related mechanisms. The low toxicity profile of derivative ‘A’ highlights its possible role'as future anti-cancer drug and/or as an adjuvant drug to reduce the toxicity of highly toxic chemotherapeutic'drugs.
US09890105B2	Method for producing methylmethacrylate The present invention relates to a process for producing methyl methacrylate, comprising the following steps: A) producing methacrolein and B) reacting the methacrolein obtained in step A) in an oxidative esterification reaction to give methyl methacrylate, characterized in that the two steps A) and B) take place in a liquid phase at a pressure of from 2 to 100 bar, and step B) is carried out in the presence of a heterogeneous noble-metal-containing catalyst comprising metals and/or comprising metal oxides.
US09890099B2	Neutralization of acidic catalysts in the production of phenol An improved method for the production of phenol. The method comprises (a) synthesizing phenol through a process that utilizes an acidic catalyst; (b) neutralizing the acidic catalyst after substantial completion of step (a) by addition thereto of a neutralization composition, wherein the neutralization composition contains an ethyleneamine derivative.
US09890098B2	Process for the production of synthesis gas Process for the production of a synthesis gas for use in the production of chemical compounds from a hydrocarbon feed stock containing higher hydrocarbons comprising the steps of: (a) in a pre-reforming stage pre-reforming the feed stock with steam to a pre-reformed gas containing methane, hydrogen, carbon monoxide and carbon dioxide; and (b) cooling the pre-reformed gas to below its dewpoint and removing condensed water; and (c) reducing the amount of carbon dioxide the in the pre-reformed gas from step (b) to obtain a module of (H2−CO2)/(CO+CO2) of between 1.0 and 3.8 in the pre-reformed gas.
US09890097B2	Method of obtaining a combination of Z and E stereoisomers of 1-chloro-3,3,3-trifluoropropene Disclosed are the combinations containing Z and E stereoisomers of hydrofluoroolefins where the more toxic isomer is less than about 30% weight of the combination (vs the sum of Z+E), to minimize the toxicity impact in the applications they will be used for such as cooling and heat fluids, foams blowing agents or solvents. Also disclosed are means to obtain combinations containing Z and E stereoisomers of hydrofluoroolefins.
US09890094B2	High meso-surface area and high acid site density pentasil zeolite for use in xylene conversion A process for the production of para-xylene is presented. The process includes the isomerization of C8 aromatics to para-xylene utilizing a new catalyst. The new catalyst and designated as UZM-54 is represented by the empirical composition in the as synthesized and anhydrous basis expressed by the empirical formula of: Mmn+R1 r1p1+R2 r2p2+Al1-xExSiyOz where M is an alkali, alkaline earth, or rare earth metal such as sodium and/or potassium, R1 and R2 are organoammonium cation and E is a framework element such as gallium, iron, boron, or indium. UZM-54 are characterized by unique x-ray diffraction patterns, high meso surface area, low Si/Al ratios.
US09890092B1	Explosives mimic for testing, training, and monitoring Additive Manufacturing (AM) is used to make mimics for explosives. The process uses mixtures of explosives and matrices commonly used in AM. The explosives are formulated into a mixture with the matrix and printed using AM techniques and equipment. The explosive concentrations are kept less than 10% by wt. of the mixture to conform to requirements of shipping and handling.
US09890091B2	Persistent vortex generating high regression rate solid fuel grain for a hybrid rocket engine and method for manufacturing same An additively manufactured solid fuel grain for a hybrid rocket engine having a cylindrical shape, defining a center combustion port and comprising a stack of fused layers of polymeric material suitable for hybrid rocket fuel. Each layer is formed as a plurality of fused abutting concentric beads of solidified material arrayed around the center port. An oxidizer is introduced into the solid fuel grain through the center port, with combustion occurring along the exposed surface area of the solid fuel grain center port wall. Each concentric bead possesses a surface pattern that increases the combustion surface area and when stacked forms a rifling pattern of undulations that induces oxidizer-fuel gas axial flow to improve combustion efficiency. The port wall surface pattern persists during the rocket engine's operation as the fuel phase changes from solid to gas and is ablated.
US09890088B2	Preceramic polymer for ceramic including metal boride Disclosed is a method of fabricating a preceramic polymer for making a ceramic material including a metal boride. The method includes providing a starting preceramic polymer that includes a silicon-containing backbone chain and first and second reactive side groups extending off of the silicon-containing backbone chain, reacting a boron-containing material with the first reactive side group to bond a boron moiety to the silicon-containing backbone chain, and reacting a metal-containing material with the second reactive side group to bond a metal moiety to the silicon-containing backbone chain such that the preceramic polymer includes the boron moiety and the metal moiety extending as side groups off of the silicon-containing backbone chain. Also disclosed is a preceramic polymer composition and a metal-boride-containing ceramic article fabricated from the preceramic polymer.
US09890083B2	Extruded gypsum-based materials An extrudable gypsum-based material is formed from a mixture that includes gypsum in the range of about 40 to 90% by dry weight percent, a secondary material in the range of about 0.1 to 50% by dry weight percent, a reinforcement fiber in the range of about 1 to 20% by dry weight percent, a rheology modifying agent in the range of about 0.5 to 10% by dry weight percent, a retarder in the range of about 0.1 to 8% by dry weight percent, a water in the range of 10 to 50% of a total wet material weight.
US09890070B2	Manufacturing process to reform glass tubes The present disclosure provides an apparatus and method for modifying the shape of a hollow structure. The method may comprise steps of providing a hollow structure having a cross-section with first and second diameters defining a first aspect ratio; heating at least a part of the hollow structure to at least its glass transition temperature, forming a malleable hollow structure; maintaining a positive pressure inside the malleable hollow structure to form a pressurized hollow structure; and pressing against a first side and an opposed second side of a heated part of the pressurized hollow structure, forming a hollow tabular structure having first and second opposed generally flat faces and a second aspect ratio greater than the first aspect ratio.
US09890069B2	Glass manufacturing apparatus and methods Low-carbon monolithic refractories are provided. Methods of manufacturing glass employing low-carbon monolithic refractories are also provided. Methods and apparatuses for glass manufacture for reducing the formation of carbon dioxide blisters during glass manufacture are also provided.
US09890065B2	Apparatus for treating a fluid Apparatus for treating a fluid, which comprises at least one pair of electrode layers power supplied to different polarities, delimiting between them a passage chamber for a first fluid flow containing ionized particles and exerting hydraulic pressure on at least one surface of such electrode layers. Each electrode layer comprises a metal conduction layer electrically connected to a power supply and at least one layer of graphite having a wet surface directed towards the passage chamber and a dry surface compressed, by the hydraulic pressure exerted by the first fluid contained in the passage chamber, directly in adherence against the metal conduction layer, in order to distribute the current of the power supply from the metal conduction layer to the layer of graphite.
US09890064B2	Method for imparting filtering capability in electrolytic cell for wastewater treatment An electrolytic cell, system, and method for the energy efficient electrochemical treatment of wastewater comprising organic and/or inorganic pollutants are disclosed. The system comprises an electrolytic cell comprising a solid polymer, proton exchange membrane electrolyte operating without catholyte or other supporting electrolyte. The electrolytic cell also comprises a filter layer incorporated between the anode fluid delivery layer and the anode flow field plate for removing various contaminants including particulates and/or suspended solids from the wastewater stream. The cell design and operating conditions chosen provide for significantly greater operating efficiency.
US09890062B2	Electrolytic enrichment method for heavy water An electrolytic enrichment method for heavy water includes enriching heavy water by electrolysis using an alkaline water electrolysis cell including an anode chamber that holds an anode, a cathode chamber that holds a cathode, and a diaphragm. In the method, an electrolyte prepared by adding high-concentration alkaline water to raw material water containing heavy water is circularly supplied to the anode chamber and the cathode chamber from a circulation tank; an anode-side gas-liquid separator and an anode-side water-seal device are connected to the anode chamber, and a cathode-side gas-liquid separator and a cathode-side water-seal device are connected to the cathode chamber; and electrolysis is continued while the alkali concentration in the electrolyte supplied to both electrolysis chambers is maintained at a constant concentration by circularly supplying, to the circulation tank, the electrolyte from which the gas generated from the anode-side gas-liquid separator and the cathode-side gas-liquid separator is separated.
US09890058B2	Dissolved air flotation desludging in liquid treatment A method and apparatus of minimizing the loss of liquid in a dissolved air flotation desludging process, is disclosed. The method and apparatus creates an ambient airflow over the top of the dissolved air flotation tank directed towards a weir at one end of the dissolved air flotation tank whereby sludge floating on top of the liquid is accelerated over the weir at a higher rate than the liquid, thereby conserving the amount of liquid lost over the weir.
US09890055B2	Method for producing hematite for ironmaking A method of producing (high-purity) hematite for ironmaking includes adding an oxidant and sulfuric acid to nickel oxide ore and then leaching nickel. The method further includes forming a neutralized residue having a sulfur grade exceeding 1.0% by weight by adding a neutralizing agent to leach slurry and being subjected to solid-liquid separation. The neutralizing agent functions to form plaster by reaction with a free sulfuric acid of surplus acid contained in the leach slurry. The leach slurry is a mixture of a leachate and a leach residue obtained after leaching the nickel. The method then includes heating the neutralized residue at a heating temperature of 600° C. or more and 1400° C. or less to form hematite having a sulfur grade of 1.0% or less by weight.
US09890053B2	Processes for preparing lithium carbonate There are provided methods for preparing lithium carbonate. For example, such methods can comprise reacting an aqueous composition comprising lithium hydroxide with CO2 by sparging the CO2 the said composition, thereby obtaining a precipitate comprising the lithium carbonate. The methods can also comprise inserting at least a portion of the precipitate into a clarifier and obtaining a supernatant comprising lithium bicarbonate and a solid comprising the lithium carbonate, separating the solid from the supernatant; and heating the supernatant at a desired temperature so as to at least partially convert the lithium bicarbonate into lithium carbonate.
US09890050B2	Molecular sieve material, its synthesis and use A molecular sieve material, EMM-17, has in its as-calcined form an X-ray diffraction pattern including the following peaks in Table 11: TABLE 11 Relative Intensity d-spacing (Å)[100 × I/I(ο)] % 17.4-16.41-10 12.6-12.11-20 11.8-11.460-100 11.2-10.85-30 10.7-10.330-80 8.62-8.3810-40 6.09-5.961-20 5.71-5.611-20 4.23-4.171-20 4.09-4.031-10 3.952-3.90110-40 3.857-3.8095-30 3.751-3.7051-20 3.727-3.6821-20 3.689-3.6441-10 3.547-3.506 1-20.
US09890049B2	Molecular sieve SSZ-106, its synthesis and use Disclosed herein is a new crystalline molecular sieve designated SSZ-106, its synthesis in the presence of a structure directing agent comprising 2,3-bis(N-methylpyrrolidin-1-ylmethyl)bicyclo[2.2.1]heptane dication, and its use as an adsorbent and a catalyst.
US09890040B2	Stress compensation for piezoelectric optical MEMS devices An apparatus includes a lens material forming a lens. The apparatus also includes a piezoelectric capacitor over the lens material, where the piezoelectric capacitor is configured to change a shape of the lens material in response to a voltage across the piezoelectric capacitor to thereby change a focus of the lens. The apparatus further includes at least one stress compensation ring over a portion of the lens material and over at least a portion of the piezoelectric capacitor. The at least one stress compensation ring is configured to at least partially reduce bending of the lens material caused by stress on or in the lens material.
US09890038B2	Monolithically integrated multi-sensor device on a semiconductor substrate and method therefor A monolithically integrated multi-sensor (MIMS) is disclosed. A MIMs integrated circuit comprises a plurality of sensors. For example, the integrated circuit can comprise three or more sensors where each sensor measures a different parameter. The three or more sensors can share one or more layers to form each sensor structure. In one embodiment, the three or more sensors can comprise MEMs sensor structures. Examples of the sensors that can be formed on a MIMs integrated circuit are an inertial sensor, a pressure sensor, a tactile sensor, a humidity sensor, a temperature sensor, a microphone, a force sensor, a load sensor, a magnetic sensor, a flow sensor, a light sensor, an electric field sensor, an electrical impedance sensor, a galvanic skin response sensor, a chemical sensor, a gas sensor, a liquid sensor, a solids sensor, and a biological sensor.
US09890034B2	Cavity type pressure sensor device A semiconductor sensor device is assembled using a lead frame having a flag surrounded by lead fingers. A pressure sensor die is mounted on the flag and electrically connected to the leads. Prior to encapsulation, a pre-formed block of gel material is placed over the sensor region on the die. Encapsulation is performed and mold compound covers the pressure sensor die and the bond wires. Mold compound covering the gel block may be removed. Additionally, a trench may be formed around an upper portion of the gel block so that the lateral sides of the gel block are at least partially exposed.
US09890033B2	Silicon-on-sapphire device with minimal thermal strain preload and enhanced stability at high temperature A silicon-on-sapphire chip with minimal thermal strain preload is provided. The chip includes a sapphire substrate having a first-sapphire surface and an opposing second-sapphire surface; and a silicon layer overlaying the first-sapphire surface. The silicon layer is formed by: creating a plurality of buried cavities in a plane within tens of microns from a first-silicon surface of a silicon wafer; laser fusing the first-silicon surface to the first-sapphire surface at room temperature to attach the silicon wafer to a sapphire wafer; and cleaving the silicon wafer along the plane including the plurality of buried cavities. A silicon-wafer layer is formed from the silicon material between the first-silicon surface and the plane of the plurality of buried cavities. The silicon-wafer layer and the sapphire wafer form a silicon-on-sapphire wafer. The silicon-on-sapphire chip is formed by dicing the silicon-on-sapphire wafer.
US09890028B2	Multiple inlet dispensing apparatus and system for preparing beverages A liquid dispensing apparatus and system for controlling the delivery of liquid additives is disclosed. In one aspect, liquid additives are delivered to a beverage preparation system through a multiple inlet pump for preparing a finished beverage. In another aspect, additives from liquid additive containers are delivered to a beverage preparation system through a multiple inlet and pumping section pump for preparing a finished beverage. Other additives are communicated through the beverage dispensing system for maintaining and cleaning the system and the multiple inlet pump for ensuring the hygienical integrity of the system throughout its use.
US09890025B2	Mechanical tipping assembly for mobile drive unit of inventory system A mobile drive unit for an inventory system includes a base suspended from a frame by a pivot assembly, such as a first link and a second link. The base supports a platform configured to engage an inventory holder of the inventory system. Movement of the base causes the platform to tip, such as away from a direction of a reaction force acting on the base due to acceleration or deceleration of the mobile drive unit.
US09890024B2	Leveling system for lift device A leveling assembly for a lift device includes a carrier arm, an axle, a first actuator, and a second actuator. The carrier arm includes a base that defines a first interface configured to pivotally couple the carrier arm to a chassis of the lift device to facilitate a pitch adjustment of the leveling assembly, a projection that defines a second interface, and a transition that extends angularly between the base and the projection such that the projection is elevated relative to the base. The axle defines a third interface positioned to engage with the second interface to pivotally couple the axle to the carrier arm to facilitate a roll adjustment of the leveling assembly. The first actuator is pivotally coupled to a first lateral end of the axle. The second actuator is pivotally coupled to an opposing second lateral end of the axle.
US09890021B2	Winch control arrangement comprising a retaining device for a cable and method for operating such an arrangement Disclosed is a winch control arrangement, including a retaining device for a cable, a rotatable drum having a rotational axis, and a substantially circular, centric storage part with a storage surface containing at least two windings of cable. The distance of the storage surface to the rotational axis is substantially constant. An eccentric holding part with a holding surface contains at least two cable windings. The distance of the holding surface to the rotational axis varies around the circumference of the holding part. A cable guide lies at a perpendicular distance from the rotational axis and the drum itself, and is movable substantially parallel to the rotational axis between a first position allowing cable winding on the centric storage part and a second position allowing cable winding on the eccentric part. The cable guide is connected to automatic movement unit for moving the cable guide between the two positions.
US09890020B2	Crane, in particular derrick crane The present disclosure relates to a crane having a travelable undercarriage and a superstructure which is rotatably supported thereon, to which a boom is luffably connected in an articulated manner, on the one hand, and a counterweight arrangement is telescopically supported, on the other hand. In accordance with the present disclosure, the counterweight arrangement comprises a U-shaped frame in which a likewise U-shaped counterweight frame is telescopically guided. The counterweight plates forming the counterweight are separated into two stacks which are each longitudinally displaceably guided on a side member.
US09890018B2	Oil collector for guide rails An oil collector for a guide rail, its use and a method for collecting lubricating oil from a guide rail are disclosed. The oil collector includes a receiving element for receiving the lubricating oil flowing along the guide rail, the receiving element including a portion formed to be set against the guide rail. The oil collector is wherein the receiving element includes a block of absorbent material absorbing the lubricating oil. The oil collector can further include a releasable fastening member for pressing the block of absorbent material against the guide rail thereby securing the block of absorbent material in place.
US09890016B2	Position recovery via dummy landing patterns An elevator system (10) includes an elevator hoistway (12) having a plurality of landings (14), an elevator car (16) configured to move within the elevator hoistway (12), and a position determining system (40) having a plurality of landing position indicators (48) and a plurality of dummy position indicators (50). At least one of the landing position indicators (48) is mounted proximate to each of the plurality of landings (14). Each dummy position indicator (50) is mounted within the elevator hoistway (12) at a predetermined vertical position between various of the plurality of landing position indicators (48). The position determining system (40) additionally includes a sensor (42) configured to determine when the elevator car is adjacent one of the plurality of landing position indicators (48) or one of the plurality of dummy position indicators (50). The plurality of landing position indicators (48) and the plurality of dummy position indicators (50) are positioned to form a sequence of unique patterns. The position determining system is more cost effective and timesaving than the absolute position reference systems.
US09890012B1	Cord storage and deployment apparatus A cord storage and retrieval apparatus that is operable to be engaged with a midpoint area of undesired slack of a cord so as to wind and store a portion of the cord wherein the ends of the cord remain available or operably coupled to an object. The cord storage and retrieval apparatus includes a lower portion and an upper portion that are rotatably coupled. A channel and sidewall openings are formed within the lower portion so as to facilitate engagement of a cord. A shaft with a slot is operably coupled to the upper portion and extends downward therefrom so as to rotatably engage an aperture formed within the channel. A ceiling structure, couplings, keepers, and connectors are included in some embodiments to facilitate separation movement, rotational resistance control and/or locking functionality. The shaft is further configured to receive a topside locking member from a second unit for stacking purposes.
US09890009B1	Bag dispenser A dispenser for dispensing bags from a roll includes a base, a bag separator, and a swing arm pivotably mounted on the base that includes a roll retaining portion shaped and arranged for being received in an axial opening of the roll. The swing arm is pivotable with respect to the base about a pivot axis in a braking direction in which the roll retaining portion travels toward the base. A spring is operatively connected between the swing arm and the base to bias the swing arm in the braking direction whereby, when the roll retaining portion is received in the axial opening, the roll retaining portion engages the roll and urges the roll into braking engagement with the base.
US09890007B2	Device and method for manipulating a fibrous web The invention relates to a device and a method for manipulating a fibrous web (10). The device comprises at least one blower (21A, 21B) provided with a flow-preventing element (24A, 24B) which is arranged to produce at least one blow (26A, 26B) substantially in the direction of the fibrous web (10), and a friction element (28) against which the fibrous web (10) is arranged to be pressed at least partially from the effect of said blow (26A, 26B) and flow-preventing element (24A, 24B) to apply a friction force resisting the motion of the fibrous web (10) to the fibrous web (10). According to the invention, the blow (26A, 26B) is directed substantially away from the friction element (28) and the friction element (28) comprises a surface profile which is arranged such that, from the effect of said at least one blow (26A, 26B), a continuous vacuum is created on the surface of the fibrous web (10) on the side of the friction element (28). Due to its intensified friction effect, the device according to the invention is applicable especially for board and, by means of it, it is possible to form e.g. an air cutting device in the tail-threading section of a board machine.
US09890006B2	Loop amount absorption apparatus of slitter line An absorption apparatus 1 that is an example of a loop amount absorption apparatus of a slitter line to which the present invention is applied is disposed in a region of a loop pit 3 provided in the slitter line 2. The absorption apparatus 1 includes a negative pressure roll 9 that grips and conveys strips and an up-down moving device 10 that enables the negative pressure roll 9 to move up and down. By gripping and conveying the strips 14 by the negative pressure roll 9, two loops 15 of the strips are formed. The negative pressure roll 9 includes a rotating shaft 16, an inner cylinder 17, an intermediate cylinder 18, and a non-woven fabric laminated outer layer 19.
US09890002B2	Plant and method for making packages A plant for making packages includes at least a machine to work packaging material and an automatic feed apparatus to feed the packaging material to the machine in a direction of automatic feed; a manual feeding and loading station of the packaging material, adjacent and parallel to the automatic feed apparatus, the machine being mobile in a direction of movement transverse to the direction of automatic feed and selectively positionable in a first position aligned to the automatic feed apparatus and in a second position aligned to the manual feeding and loading station; and a guide system to guide the machine between the first position and the second position and vice versa.
US09889998B2	Recording apparatus with movable feed roller A recording apparatus includes a recording unit which performs recording on a recording medium, a tray which stores the recording medium, a tray storage portion which stores the tray, a feed roller which feeds the recording medium out from the tray, and a roller support member which supports the feed roller and causes the feed roller to be lifted and lowered in relation to the tray by changing posture, in which a cam shaft capable of rotating is provided in the tray storage portion, in which the cam shaft is provided with a first engaging portion which engages with the tray and a second engaging portion which engages with the roller support member, and in which the roller support member is configured to change posture due to the tray causing the cam shaft to rotate.
US09889997B2	Denester with adjustable inclined magazine The invention relates to denester for use with a tray sealer. The denester includes a magazine for accommodating at least one stack of trays. The magazine includes a first vertical guide and a second guide, the second guide capable of being inclined at an inclination relative to the first guide. The inclination of the second guide is adjustable to accommodate destacking of the trays in the stack of trays.
US09889995B1	Noncontact support platform with blockage detection A noncontact support platform includes a plurality of pressure nozzles on an outer surface of a PV stage of the noncontact support platform. The pressure nozzles connected to a pressure source for creating an outflow of fluid through the pressure nozzles. A plurality of vacuum nozzles are interspersed with the pressure nozzles on the outer surface and are connected to a vacuum manifold via one or a plurality of hoses to create an inflow of the fluid through the vacuum nozzles. At least one flowmeter is configured to generate a signal that is indicative of a measured inflow via at least one hose of the hoses. A controller is configured to analyze the signal to determine whether the measured inflow is indicative of blockage of a vacuum nozzle and to generate a response when blockage is indicated.
US09889994B1	Conveyor scraper adjustment mechanism A mechanism for mounting and adjusting a conveyor belt scraper comprises a conveyor belt assembly capable of receiving and disposing of material on a surface thereof and a structural element wherein the structural element comprises a securing member. The mechanism further comprises a belt scraper comprising a slide plate capable of slidably receiving the securing member. A release mating bracket is provided which is capable of being reversibly drawn towards a fixed mating bracket wherein at least one of the fixed mating bracket or release mating bracket comprises a recess. An orientable mandrel is received between the fixed mating bracket and the release mating bracket. A scraper assembly is attached to the orientable mandrel.
US09889992B1	Conveyor belt slat A conveyor belt includes a plurality of spaced rods and a plurality of slats. Each of the plurality of slats includes a base portion for carrying an item. The base portion has a perpendicular leading edge of the base portion relative to a direction of conveyance travel of the conveyor belt and a perpendicular trailing edge of the base portion relative to the direction of conveyance travel of the conveyor belt. At least one of the leading edge and the trailing edge is coupled to one of the plurality of rods.
US09889991B2	Transporter and transport method According to one embodiment, a transporter includes a first conveyor and a second conveyor. The first conveyor receives an object that is carried by an arm device and conveys the object in a first direction. The second conveyor is configured to receive and convey the object from the first conveyor and is movable in a second direction that crosses the first direction.
US09889989B2	Storage and distribution device and method A storage and distribution device and method based on an arrangement whereby the largest sides of boxed products are in contact with one another are disclosed. The device includes a storage device, a blind door and a restocking manipulator. The blind door is disposed at the front of the storage device, and the restocking manipulator is disposed at the rear of the storage device. The storage device includes a plurality of storage units. Each of the storage units includes a matrix storage rack provided with a plurality of storage passages in a matrix arrangement. Each of the storage passages includes two baffle plates having brushes and a bottom plate. A discharge control device is disposed at the front of a discharge end of each storage passage. A spiral spring driver is further disposed on each storage passage. The driver is driven by a spiral spring energy-storage device to move stored items towards the discharge end of the passage. The restocking manipulator automatically restocks according to instructions from a computer. The system of the present invention is highly automatic, and has large storage capacity and short feeding time, thereby substantially increasing space utilization rate and operating efficiency.
US09889982B2	Aerosol actuators, devices, and methods of making and using the same Aerosol actuation mechanisms include improvements allowing a user to extend the reach of an aerosol application device, apply an aerosol in a windy environment, improve coverage of the aerosol product, or facilitate improved ability to ensure coverage for an aerosol product.
US09889977B2	Child-resistant closure A child-resistant container has a container body having an externally threaded neck (36) and a first pair of engagement features. A cap closes the container body in a closed condition and is removable from the closed condition. The cap comprising the unitary combination of an inner sidewall and an outer sidewall. The inner sidewall has an internal thread for engaging the neck external thread. An outer sidewall for gripping by a user has first and second pairs. The second pair of segments are hinged to the inner sidewall for depressably flexing from relaxed condition to a flexed condition and bear a second pair of engagement features. In the installed condition of the cap and relaxed condition of the second pair of segments, the first pair of engagement features and second pair of engagement features are positioned to collide to block an unscrewing rotation of the cap. An upper web joins the inner sidewall and the outer sidewall first pair of segments. A pair of respective hinges between the second pair of segments and the inner sidewall merge with the inner sidewall at a location recessed from an upper end of the inner sidewall.
US09889973B2	Storage container and refrigerator having the same A storage container having a sensor unit and a refrigerator having the same. The storage container includes a container body; a container cover coupled to the container body; a sensor module disposed at least at one of the container body or the container cover; and a coupling member provided as to accommodate at least a portion of the sensor module, and detachably coupled to at least one of the container body or the container cover. The sensor unit is detachably coupled to the storage container, and thus a replacement of the sensor unit may be easily performed.
US09889972B2	Bottle crown system A bottle crown engagement system includes a cap structure sized and shaped to releasably receive a bottle crown. The bottle crown engagement system also includes a magnetically attractable clamping member configured to magnetically interact with the cap structure to releasably affix the cap structure to an attachment surface between the cap structure and the magnetically attractable clamping member.
US09889971B2	Stopper device for the neck of a container, container provided with such a device, method for stopping such a container, and method for production of such a device The invention relates to a stopper device with an external cap made from plastic and an internal insert for fixing the device around the neck of the container. The sleeve of the cap forms a head, into which the insert may be introduced and permanently fixed and a skirt extending axially from the insert. According to the invention, contamination on the neck of the container may be limited and the appearance improved. Particularly at the base of the neck, the skirt essentially forms a frustum converging towards the axis of the sleeve on extending from the head, before the installation of the device around the neck, the frustum forming, at the end opposite the head, an internal surface to come into contact against the container neck under the influence of an elastic deformation of the sleeve as a result of the installation of the device around the neck.
US09889970B1	Novelty gift container The novelty gift container is a container that is adapted for use in containing and transporting objects. The novelty gift container is decorated with a plurality of motivational symbols and a plurality of instructional messages that, in concert with the object contained within the novelty gift container, are intended to improve the psychological state of a person receiving the novelty gift container. The novelty gift container comprises a container, a plurality of motivational symbols, and a plurality of instructional messages.
US09889967B2	Strippable hybrid tray system for electronic devices A component tray system, the system including a tray having one or more pockets, each pocket adapted to receive at least one component, and a removable, thermoformed sheet adapted to cooperate with said tray to reduce at least the depth of said on or more pockets. In some embodiments, the tray has a top surface and a bottom surface, pockets being defined on either or both of the top and bottom surfaces. In some embodiments, the thermoformed sheet is adapted to cooperate with the top surface or the bottom surface.
US09889963B2	Refillable dispensing container for stacked moist wipes A container of stacked moist wipes includes a dispenser housing. The housing defines top and bottom walls, first and second side walls, and first and second end walls. The walls collectively define an interior space, and the first end wall can be removed to provide access to the interior space via a refill orifice. The top wall includes a dispensing orifice through which wipes are extracted. A refill direction is generally perpendicular to a dispensing direction. In particular embodiments, the dispensing orifice is covered by a lid assembly. In certain embodiment, the first end wall includes a removable cap that has no permanent connection to the top wall, bottom wall, first side wall, or second side wall. In certain embodiments, the top wall, the bottom wall, the first side wall, the second side wall, and a permanent layer of the second end wall are integrally molded with each other.
US09889957B2	Drug packaging device A drug packaging device is provided in which both sheets are easily connectable to each other with a simple construction. A working plate having a first portion for temporarily fixing an end portion of a sheet remaining at a drug filling unit side, and a second portion for temporarily fixing an end portion of a new sheet are provided. The end portions of the respective packaging sheets which are temporarily fixed at the first portion and the second portion are connectable to each other.
US09889954B2	Method and packaging plant for placing product packages into shipment containers The invention relates to a method and to a packaging plant which allows for a high degree of automatization of the packaging of individual product packages into shipment containers of different sizes and which is at the same time highly reliable and according to this method, each one of the product packages is assigned a conveyance tracking clock information, including information about the type of product package, its respective conveyance track, its conveyance speed, and its predetermined position and orientation within the shipment container for the specific shipment order.
US09889953B2	Dosing heads for direct fill dry powder systems configured for on/off controlled flow Dosing heads for apparatus for dispensing a defined amount of dry powder concurrently to a plurality of spaced apart dose receiving containers include a plurality of spaced apart elongate channels having a channel length with an upper end defining an entry orifice and a lower end defining an exit port. In use, the dosing heads are aligned with a dry powder bed residing above and in communication with the dosing head and at least one vibration source in communication with the dosing head channels configured to controllably apply a vibration flow signal. When the vibration flow signal is applied to the dosing head channels, dry powder from the dry powder bed flows through the elongate channels and out the exit port and when the flow signal is removed, dry powder does not flow through the dosing head elongate channels.
US09889951B1	Spacecraft east-west radiator assembly A heat transfer assembly (HTA) includes an equipment panel having a first longitudinal length and a first radiator panel that is coupled to one of an east end and a west end of the equipment panel. The first radiator panel is longer in the longitudinal direction than the equipment panel and has least one longitudinal heat pipe. The HTA also includes at least one flexible heat pipe having a first rigid tube coupled to the equipment panel, a second rigid tube thermally coupled to the first longitudinal heat pipe, and a flexible tube coupled between the first and second rigid tubes. The equipment panel is configured to retain an equipment module in thermal contact with the first rigid tube.
US09889950B2	Spacecraft with aerodynamic control A spacecraft operating in a low earth orbit having an altitude in the range of 160 to 800 km has a main body that includes heat dissipating electrical equipment and an earth-facing payload. Control surfaces on the spacecraft are articulated so as to: provide three-axis attitude control to the spacecraft main body using aerodynamic drag effects, such that the earth-facing payload is maintained in a selected orientation with respect to the earth; and control one or both of orbit altitude and period by articulating the control surfaces so as to regulate an amount of aerodynamic drag. The control surfaces include a first control surface disposed, in an on-orbit configuration, on a boom, the boom being mechanically coupled with the main body, and with one or both of a solar array electrically coupled with the electrical equipment and a thermal radiating array thermally coupled with the electrical equipment.
US09889943B2	Assembly for an aircraft, comprising an engine attachment body equipped with at least one shackle support fitting that passes into the box section of the attachment pylon In order to allow better introduction of forces into the box section of an aircraft engine attachment pylon, the subject matter herein discloses a pylon including a primary structure forming a box section on the outside of which a body of the engine attachment is arranged, the latter also being equipped with shackles that are articulated on the body and can be articulated on the engine. According to the disclosure herein, the body has, at at least one of its ends, a one-piece fitting including a first joining portion on which one of the shackles can be articulated, and also a second joining portion that is fixed to the box section and passes into the latter.
US09889936B2	Curved seating layout A forward concave trapezoidal seating system and methods are presented. Trapezoidal seats comprise a front side smaller than a rear side. The trapezoidal seats are aligned in a forward arc from a straight seat to a most-angled seat. A straight side of the straight seat is configured to substantially align with a center line of an aircraft fuselage. A most-angled side of the most-angled seat is angled inboard relative to the straight side, and the most-angled seat is outboard of the straight seat. A side unit is coupled to the most-angled side and supports the trapezoidal seats.
US09889935B2	Aircraft galley cart bay door An aircraft galley cart bay door includes a door main structure having an inwardly facing peripheral inner edge with an inner surface, and a surface seal on the inner surface of the inwardly facing peripheral inner edge of the inner wall. A substantial majority of the main structure of the door is formed from a high strength molded carbon fiber composite material. The door main structure may optionally define a recess, and insulation material can be disposed in the recess defined by the main structure of the door.
US09889934B2	Digital crew assist A wearable device that is wearable by a user and connectable with one or more aircraft related systems, a device system comprising a plurality of such wearable devices, and an aircraft comprising such a device system. The wearable device that is connectable to one or more aircraft related systems comprises a system interface via which the wearable device is connectable to one or more aircraft related systems, and a control unit configured to communicate with at least one of the one or more aircraft related systems via the system interface.
US09889928B2	Lift, propulsion and stabilising system for vertical take-off and landing aircraft The lift, propulsion and stabilizing system for vertical takeoff and landing aircraft of the invention consists of applying during vertical flight on, below or in the interior of the fixed-wing aircraft one or more rotors or large fans each one with two or more horizontal blades, said rotors are activated by means of turboshafts, turbofans or turboprops with a mechanical, hydraulic, pneumatic or electrical transmission, and the respective motors. Using lifting and/or stabilizing and/or controlling fans and/or oscillating fins and/or air blasts. Placing the horizontal lifters near at least one end of the longitudinal axis and of the transverse axis of the aircraft. Generally said stabilizing elements form 90° with one another and with the central application point of the rotor or application of that which results from the lift forces.
US09889927B2	Variable hub-to-hub phasing rotor system An aircraft includes a first rotor assembly, a second rotor assembly, and a rotor phase angle control system. The system includes a phase adjustor operably associated with the first rotor assembly and the second rotor assembly. The method includes sensing vibrations exerted on the aircraft and offsetting a phase angle of the first rotor assembly and the second rotor assembly to minimize the vibrations.
US09889925B2	Single blade propeller with variable pitch An improved performance propeller employs a single propeller blade having an axis of rotation and a centripetal force about the axis. A pitch control unit is mounted opposite the single propeller blade and has a compensating centripetal force with respect to the single propeller blade about the axis.
US09889924B2	Multi-directional control using upper surface blowing systems Multi-directional control using upper surface blowing systems is described herein. One disclosed example method includes a flow director of an aircraft, where the flow director is to cause an exhaust stream of an upper surface blowing system to attach to a fuselage of the aircraft, and a controller to control the flow director to affect one or more of a pitch, a yaw or a roll of the aircraft by varying a degree of the attachment of the exhaust stream to the fuselage.
US09889922B2	Flap support A flap support structure for an aircraft wing having a trailing edge flap, the flap support structure comprising: a flap support beam including an aerodynamic fairing; and a drive unit including a universal support structure which rotatably receives a drive shaft connected to a drive arm for moving the trailing edge flap, wherein the universal support structure also forms part of the flap support beam and supports the aerodynamic fairing.
US09889921B2	Aircraft including support for a fairing An aircraft comprising a fuselage; a main wing provided on a fuselage lower side and including a center wing and an outer wing; and a fairing covering at least a lower surface of the center wing, and a seal interposed between an end edge in a right-left direction of the fairing and an outer wing lower surface. In the aircraft, a most outboard fitting located on a most outboard side out of fittings respectively provided at a plurality of positions in the right-left direction of the fairing, and an outer wing fitting provided on the outer wing are pin-coupled via a pin or pins extending along a front-rear direction. The outer wing fitting is coupled to the outer wing at a position on an inboard side with respect to the end edge and other than a position of a joining structure for joining the center wing and the outer wing.
US09889919B2	System for securing an aircraft door Systems and methods for securing an emergency exit door on an armrest of a seat are provided. A system includes a latch connected to an armrest of a seat of a vehicle. The latch is moveable relative to the armrest between a stowed position and a deployed position. The latch is structured and arranged to engage an edge of a door that is associated with an exit of the vehicle to hold the door on the armrest.
US09889918B2	Trimmable rudder A trimmable rudder system for a marine vessel such as a planing power boat, the system including a pair of rudder assemblies, each of which includes a rudder blade movably coupled to the hull by way of a ball-and-socket joint. Each rudder assembly includes a rudder shaft that extends from the rudder blade through the ball-and-socket joint and can be rotated for rotating the rudder blade to steer the power boat. Each rudder shaft may be operably coupled to a pair of actuators configured to control trim and camber positions of the rudder blade so that the pair of rudder blades can collectively achieve a desired hull trim change, including listing control and planing control of the power boat. Steering position, trim position, and camber position of the rudder blades may be simultaneously changed.
US09889917B1	Curve and tilt passive cambering keel and steering fin mastless wingsail A flexible steering fin and passive cambering keel for sailboats having fundamental simplicity yet enhanced performance and superior operation in terms of design and components. The steering fin is a relatively short and elongated flexible blade with its leading edge fixed beneath the hull. A rod passing through the hull functions as a simple lever controlling the trailing edge of the blade, which provides both tilt and curvature for unique handling and ease of use. A separate flexible keel provides the function of tilting the keel as it is cambered, for greater lift. A unique pivoting resilient steering assembly is incorporated, along with a rotational circular hull section, frame and cam assembly to control the keel.
US09889915B2	Systems, apparatuses, and methods to control output power of groups of engines A control system to optimize response time of a plurality of engines of a machine is provided. The control system includes a controller configured to determine a first engine group and a second engine group based on data regarding response time characteristics of the plurality of engines, control the first engine group to increase output power of the machine when the output power of the machine is below a predetermined power output threshold, and control the second engine group to increase output power of the machine responsive to the output power of the machine reaching the predetermined power output threshold. A response time of the first engine group is faster than a response time of the second engine group when the output power of the machine is below the predetermined power output threshold.
US09889913B1	Marine power steering system A power steering system for a marine steering includes a hydraulic cylinder, an actuator block that is mounted on an outer end of a ram of the cylinder, and valving. In one embodiment, the valving is located in the hydraulic cylinder and includes at least one flow limiting valve that, through an initial portion of a stroke thereof, limits fluid flow rates through the valve to a generally constant, relatively low level. This limits the rate of extension or retraction of the ram out of or into the barrel and prevents valve chatter. In another embodiment the valving includes ball-type check valves that are located within the actuator block and that are actuated by a rocker arm assembly in the actuator block.
US09889911B1	Back pack cinch A back pack for an underwater breathing gas tank is provided. The back pack includes a tank mounting structure having a front surface facing away from an underwater breathing gas tank when an underwater breathing gas tank is operably mounted to the tank mounting structure. The tank mounting structure defines a recess. The front surface defines an opening of the recess. The tank mounting structure defines a bottom surface of the recess opposite the opening in the front surface. The back pack includes a strap and a buckle. The buckle has a latched state for securing the strap in a fixed position for securing an underwater breathing gas tank to the tank mounting structure. The buckle, when in a latched state, is positioned at least partially within the recess.
US09889902B2	Vehicle A vehicle includes a suspension device including a right cover member that is provided at least partially between a left surface of a right brake disc and a ground contact point of a left tire and in a position located closer to the right brake disc than the ground contact point of the left tire when a body frame is in the upright state and when the body frame leans to the left, and a left cover member that is located between a right surface of a left brake disc and a ground contact point of a right tire and in a position located closer to the left brake disc than a ground contact point of the right tire when the body frame is in the upright state and when the body frame leans to the right.
US09889900B2	Screen moving device in saddle-ride-type vehicle Vertical movement of support members disposed on both left and right sides of a screen are guided by a pair of left and right fixed rail brackets. A manipulation lever manually operable so as to vertically move the screen and connected to at least one of the pair of support members includes a lever main portion which is rotatably supported on at least one of the pair of rail brackets and is connected to one of the support members, and a grip which is connected to the lever main portion. The grip is connected to the lever main portion such that the grip is operable between a projecting position where the grip projects from the lever main portion and a storage position where the grip is folded toward a lever main portion side.
US09889899B2	Safety device for alerting motor vehicle drivers of proximity of a bicyclist Disclosed is a safety device designed to alert motor vehicle drivers about the proximity of a bicyclist. The device includes a flexible antenna or rod that readily and preferably mounts in a substantially horizontal orientation to the handlebars of a bicycle. A bright red light or LED at the end of the antenna emits light in a rearward direction and thereby provides a second point of reference to motor vehicle drivers when used in conjunction with a traditional frame-mounted reward facing light. With two points of reference, motor vehicle drivers are able to determine with increased accuracy the proximity of the bicyclist. The antenna is extendable up to about twenty-four to thirty-six inches beyond a lateral edge of a bicycle. The device warns motor vehicle drivers of the proximity of a bicyclist and creates a safety buffer zone for the bicyclist.
US09889890B1	Vehicle hood system A vehicle includes a hood that is rotatably secured to a vehicle body. The hood has an upper panel, a lower panel, and a reinforcement member disposed therebetween. The reinforcement member has a baseplate and a tab. The baseplate is secured to an internal surface of the lower panel. The tab has a proximal end that is secured to the baseplate and a distal end that extends away from the baseplate and is secured to an internal surface of the upper panel.
US09889889B2	Structure for reinforcing shock absorber housing A structure for reinforcing a shock absorber housing includes a shock absorber housing connecting a shock absorber mounting panel and a front side member. A front fender apron inner panel connects the shock absorber mounting panel and the front side member. The front fender apron inner panel is coupled to an outer surface of the shock absorber housing and overlapped with a portion of the shock absorber housing to form a wheel house with the shock absorber housing. An extension panel is connected from a side of the overlapped portion of the shock absorber housing and the front fender apron inner panel to a sub-frame mounting portion of the front side member.
US09889888B2	Side body structure of vehicle A vehicle side body structure is provided, which includes a hinge pillar having inner and outer hinge pillar members forming, in a vehicle side part, a closed section space extending in vehicle vertical directions, a side sill having a member forming, on a rear side of the hinge pillar, a closed section space extending in vehicle longitudinal directions, and a closed section space component forming a closed section space extending continuously in the longitudinal directions along an outer surface of the inner hinge pillar member and connecting to the closed section space of the side sill on the rear side. The inner hinge pillar member is formed with a bend-facilitating portion adjacently disposed on the front side of a front end of the closed section space component, extending vertically continuously or intermittently, and protruding outwardly due to a stress concentration by a frontal impact load applied to the hinge pillar.
US09889883B2	Continuously variable transmission system A continuously variable transmission (CVT) system, which turns the rear wheels of a lawn mower or similar vehicle at different speeds in a coordinated method with the front steering wheels in order to achieve the best turning radius (including a tight or zero turn radius, if desired) under most conditions. The system comprises two stages: the first stage comprising a Fixed Center Distance CVT pulley system, and the second stage comprising dual CVTs (e.g., left and right) that input into dual gear reducers (left and right), which are mechanically connected to the rear wheels. The second stage dual CVTs (left and right) are synchronized with the steering wheel, thus achieving different rear wheel speeds and/or directions based on the steering wheel position.
US09889871B1	Ring apparatus and method for lifting an item for holding windable material An apparatus and method for lifting a spool of windable material including a barrel and two flanges whose rims engage the floor utilizes a ring having a diameter which is greater than the height of the flanges of the spool desired to be lifted. A strut spans at least a portion of the ring interior, and a carriage assembly which is cooperable with the spool barrel at one end thereof is mounted upon the strut for movement between first and second locations therealong so that by positioning the apparatus alongside one flange of the spool while the carriage assembly is positioned in its first location along the strut, placing the carriage assembly in cooperating relationship with the barrel of the spool, and then effecting the movement of the carriage assembly along the length of the strut to the second location therealong, the one flange of the spool is lifted from the floor.
US09889867B2	Railroad switch machine A railroad switch machine includes a pair of switch blades, an electric motor mechanically coupled to the pair of switch blades, a pair of input terminals connected to a DC power supply for receiving a power signal and a regulator to adapt the power signal between the input terminals into a motor current applied to the electric motor. The regulator includes a plurality of switches connected between the pair of input terminals and two phases of the electric motor. The switches are transistors and the regulator also includes a controller adapted to drive each transistor with a respective command signal to adjust a value and a direction of an intensity of the motor current.
US09889855B2	Method for determining a relative gradient of a roadway A method for determining an incline in a road that is some distance ahead of a motor vehicle relative to the section of road that is currently being driven on by the motor vehicle, wherein images of the road that is ahead of the motor vehicle are recorded by a camera, road path lines are identified ahead of the motor vehicle in the recorded images and the relative incline is calculated with reference to the differences in the courses of the road path lines at different distances.
US09889853B2	Vehicular control system The system is provided with a controller that controls the acceleration and deceleration of the vehicle according to the operation quantity of an accelerator pedal, and a state detector that determines whether a wheel is in a slippery state. The controller sets a deceleration region corresponding to a relatively small amount of operation and an acceleration region corresponding to a relatively large operation quantity regarding the operation quantity, and controls such that, in at least partially, the deceleration of the vehicle is increased as the operation quantity decreases, while in at least a part of the acceleration region, the acceleration of the vehicle is increased as the operation quantity increases. When the state detector detects a slippery state, the controller decreases the maximum deceleration that can be produced in the deceleration region.
US09889852B2	Vehicle powertrain synchronization based on predicted driver actions An approach is provided in which a powertrain synchronizer analyzes condition data that corresponds to impending conditions external to a vehicle. The powertrain synchronizer predicts a driver's future action in response analyzing the condition data and adjusts the vehicle's powertrain subsystem based upon the predicted driver action.
US09889848B2	Apparatus and method for controlling lane keeping of vehicle A lane keeping assistance system (LKAS) is a system that detects a lane through a sensor and prevents a vehicle from deviating from the lane by changing positional information of the detected lane to a torque value. Disclosed are an apparatus and a method for controlling lane keeping of a vehicle that start or cancel a lane keeping function based on driving state of the vehicle.
US09889845B2	Straddled vehicle A straddled vehicle includes a front wheel, a rear wheel, an engine which generates a driving force and rotates the rear wheel with the driving force, a front wheel brake and a rear wheel brake which lowers the rotation speed of at least the rear wheel, a first detector which acquires and outputs a pitch rate, a second detector which detects and outputs information concerning rotation of the front wheel, and an ECU including a front wheel lift determination circuit which monitors respective outputs from the first detector and the second detector to determine whether a front wheel lift exists based on at least one of the pitch rate and information concerning rotation of the front wheel. When the front wheel lift exists, the ECU controls the driving source or the braking device so that the driving force is lowered or the rotation speed of the rear wheel is lowered.
US09889844B2	Flying car extended vehicle control method Systems and methods to adjust the operation of various vehicle control systems to improve performance based on detection of a condition in which the vehicle is in an unloaded or reduced normal force state. In one embodiment, the system includes a vehicle control system, a sensor module, and a controller. The controller is configured to receive sensor values from the sensor module. The controller is further configured to determine vehicle motion characteristics based on the sensor values. The controller is further configured to determine that an unloaded state exists when the values of the vehicle motion characteristics exceed threshold values. The controller is further configured to activate countermeasures when the controller determines that the unloaded state exists.
US09889843B2	Apparatus and method for preventing shut down in limphome driving An apparatus and method for preventing a shut down in limphome driving are provided. The apparatus includes an engine clutch and a hybrid control unit (HCU) that is configured to operate a vehicle by dualizing a driving of the vehicle into a normal driving control and a limphome driving control. When the driving of the vehicle is in the limphome driving control, the HCU is configured to reduce a vehicle speed and perform a control right shift based on a status of the engine clutch. In addition, an engine control unit (ECU) is configured to compare a current engine revolution per minute (RPM) with a targeted engine RPM based on the control right shift to operate the engine to adjust the engine RPM to reach the targeted engine RPM.
US09889840B2	Vehicle and method for improving fuel-efficiency during temporary stop A method for improving fuel-efficiency during a temporary stop may include dividing, by an engine control apparatus, a neutral control condition into a neutral control entry and a neutral control release during a D-stage temporary stop, determining, a neutral control entry D-stage target RPM at a time of the neutral control entry, and a neutral control release D-stage target RPM at a time of the neutral control release, and RPM shifting the neutral control entry D-stage target RPM to a speed gradient conforming to a transmission clutch release time of a transmission control apparatus at a time of a neutral control after the neutral control entry and RPM shifting the neutral control release D-stage target RPM to a speed gradient conforming to a clutch coupling time of a transmission by the transmission control apparatus at a time of a neutral control after the neutral control release.
US09889837B2	Brake booster assembly A brake booster assembly is provided. The assembly includes a rack including a plurality of rack teeth extending therefrom and moveable and extending along a first axis. A sensor is coupled with the rack for sensing force and axial displacement of the rack and outputting a signal proportional to the sensed force and the sensed displacement. A planetary gear subassembly is disposed about a second axis transverse to the first axis and is coupled with the rack for moving the rack along the first axis in response to rotation of the planetary gear subassembly about the second axis. A pair of motors are coupled to the planetary gear subassembly for rotating the planetary gear subassembly and moving the rack along the first axis. A controller is electrically connected to the sensor and to the motors for controlling rotation of the planetary gear subassembly in response to the signal from the sensor.
US09889834B2	Hydraulic brake assist vacuum maintenance system and method A hydraulic brake assist vacuum maintenance system includes a vacuum source, a vacuum booster/master cylinder interfacing with the vacuum source, a brake pedal interfacing with the vacuum booster/master cylinder, a brake control unit interfacing with the vacuum booster/master cylinder, wheel brakes interfacing with the brake control unit and a hydraulic brake assist interfacing with the brake control unit and adapted to hydraulically operate the wheel brakes upon reduction or cessation of vacuum pressure from the vacuum source to the vacuum booster/master cylinder.
US09889832B2	Master cylinder apparatus A master cylinder apparatus includes: an input piston that can be moved forward by operating a brake operating member; a pressure piston provided in front of the input piston to be capable of moving relative to the input piston; and a stroke velocity ratio modification device capable of modifying a stroke velocity ratio, which is a ratio between a stroke velocity of the pressure piston and a stroke velocity of the input piston, in at least two stages within a range not greater than a predetermined value larger than 1.
US09889831B2	Braking control device for vehicle A vehicle brake control device generates rear wheel braking torque by an electric motor by pressing a friction member against a rotating member rotating together with the rear wheel, reduces rear wheel braking torque by controlling the electric motor based on a target energization amount calculated from a slip state quantity of the rear wheel, and rapidly stops electric motor rotation motion based on an adjusted target energization amount calculated from the target energization amount and a slip state quantity of a front wheel.
US09889828B2	Deceleration end location storage system, drive assist system, drive assist method, and computer program There are provided a deceleration end location storage system that can appropriately store a deceleration end location at which a vehicle ends deceleration in decelerating action even for a road on which the content of the decelerating action tends to vary because of a disturbance such as a road with a large amount of traffic, and a drive assist system, a drive assist method, and a computer program that can provide appropriate drive assistance for a vehicle on the basis of stored deceleration end locations. In the case where a vehicle performs decelerating action, a deceleration end location at which the vehicle ends deceleration in the decelerating action is specified. A variation range that matches the road type of a road on which the deceleration end location is provided is set. In the case where learning data stored in a learning DB 32 already include learning data for a different deceleration end location provided within the variation range set from the present deceleration end location, such deceleration end locations are stored as learning data for the same deceleration end location.
US09889824B2	Electronic interface control system for a pneumatic vehicle safety lift system An electronic interface control system for a pneumatic vehicle safety lift system has a computer that receives sensor inputs, presents outputs, and receives commands from a user. The computer has its power from an automobile and operates an air compressor for air hoses. The computer operates a pneumatic jack upon an automobile. The computer reads sensors related to jack position and triggers indicators to the user so the jack raises the vehicle after a footplate rests below it in a safe manner. The system lifts a vehicle stuck or undergoing repair. The computer checks that a certain number of jacks, preferably one, activate at once. The computer checks by inquiring of the sensors and switches deployed upon a vehicle and within a carrying case. The carrying case has a safety strut for the jack and a torque gun for a user.
US09889820B2	Car theft tracking system and method The current specification discloses a method, system and devices for detecting a theft of a car. A use of the car and a current location of the car are detected. A car identifier and location information indicative of a location of the car is sent to a network server over a wireless connection. A token device is determined that is associated with the car identifier and a location request is sent from the network server to the token device. Location information indicative of a current location of the token device is derived and the received location of the car is compared with the derived location of the token device. If a position mismatch between the location of the car and the location of the token device is detected, a warning message is sent to a pre-determined device.
US09889818B2	Information processing method and information processing system The present disclosure provides an information processing method and an information processing system. The information processing method is used for controlling a vehicle door, which includes: detecting an action of a vehicle door controlled by an user and feedbacking the action to a processing module through a detecting module; transmitting a control command to a control module according to the detected action through the processing module; and performing the control command to select at least one vehicle door from all vehicle doors and operate the selected vehicle door through the control module. In the technique scheme of the present disclosure, the processing module transmits the control command to the control module according to the detected action; the control module performs the control command to select at least one vehicle door from all vehicle doors and operate the selected vehicle door, thereby increasing the convenience of operating the vehicle door.
US09889815B2	Protective device for occupants of a motor vehicle in the case of a side impact A protective device is provided to reduce an occurrence of injury in the case of a far-side side impact of a vehicle. The protective device has an airbag attached to a side of a seat closer to the center of the vehicle. The air bag has a first airbag element attached to the seat back to extend in the region of the thorax and a second airbag element attached to the seat frame to protect the pelvis in the case of the far side impact.
US09889814B2	Airbag An airbag, especially for a vehicle occupant restraint system, in the inflated condition includes a front side (112) forming the occupant impact surface and an opposite rear side (114), wherein the cover portions (102a, 102b, 102c) forming the front side (112) and the rear side (114) are interconnected at their longitudinal edges (110). Along a center line (M) of the respective side extending in the longitudinal direction of the airbag (100) the front side (112) is longer than the rear side (114) so that in the inflated condition the airbag (100) takes a curved shape. The front side (112) and, resp., the rear side (114) includes at least one connecting line (108) substantially extending transversely to the center line (M) at which two cover portions (102a, 102c) are interconnected, wherein at least one of the cover portions (102a) in the cut includes a boundary contour (104) concavely or convexly extending transversely to the center line (M).
US09889811B2	Forwardly and rearwardly folding roll-over protection structure A foldable roll-over protection structure is provided for use on a vehicle movable in a generally fore-and-aft direction. The foldable roll-over protection structure includes a frame comprising a base section and an upper section. The base section is connectable to the vehicle. The upper section is swingable relative to the base section between a forward position in which the upper section projects forwardly from the base section, a rearward position in which the upper section projects rearwardly from the base section, and an upright position positioned between the forward and rearward positions. A hinge assembly swingably interconnects the sections of the frame. The hinge assembly is configured to releasably secure the upper section in each of the positions of the upper section.
US09889810B2	Utility vehicle A utility vehicle includes a chassis, and a ROPS provided on the chassis. The ROPS surrounds a cabin space of the vehicle. A center of gravity of the vehicle is located at a position of ⅓ or lower of the vehicle height, and an outline of the ROPS is formed in a curved shape when seen in the right and left direction or in the front and rear direction of the vehicle. Since the outline of the ROPS is formed in a curved shape, in the case of rollover of a vehicle body, the ROPS can easily roll on the ground surface. The combination of the configuration of the ROPS and the gravitational force exerted on the low position of the center of gravity, which is ⅓ or lower of the vehicle height, the vehicle body can be easily set up from the rolled over situation.
US09889807B2	Vehicle and system for supplying electrical power to a vehicle electrical load A system of a vehicle may include an electrical load, a generator, and first and second conduits. The electrical load of the vehicle may include a high energy device that utilizes above 270 volts during operations of the vehicle. The generator may be coupled to an engine of the vehicle and configured to generate electrical power at a voltage above 270 volts for the electrical load of the high energy device during operations of the vehicle. The first and second conduits may be arranged along each other to house respective first and second conductors that are electrically disposed between the electrical load and the generator.
US09889806B2	Light weight bus bars, methods of manufacture thereof and articles comprising the same Disclosed herein is a bus bar comprising a bar manufactured from a material that has a density of less than or equal to 2.70 grams per cubic centimeter; where the bar comprises a plurality of holes for facilitating contact between the bus bar and a grounding attachment. Disclosed herein too is a method comprising affixing one or more grounding attachments to a bus bar, where the bus bar comprises a bar manufactured from a material that has a density of less than or equal to 2.70 grams per cubic centimeter; where the bar comprises a plurality of holes for facilitating contact between the bus bar and a grounding attachment; and affixing the bus bar to the frame of an automobile.
US09889801B2	Vehicle lighting assembly A vehicle lighting assembly is provided herein. The vehicle lighting assembly includes a lens and a housing attached to the lens. One or more indicia defined by recessed portions are disposed on a component of the housing. A photoluminescent structure is disposed within and substantially filling the recessed portion and is configured to luminesce in response to receiving an excitation light emitted by a light source. A protective layer is disposed over the photoluminescent structure.
US09889800B1	Car CD slot mount for personal electronic device A car CD slot mount includes an installing unit having a front side, a rear side, first and second inserts extend outwardly from the front side in a staggered manner to define an acute angle greater than 5 degrees. The installing unit further has upper and lower sides defining upper and lower regions respectively, wherein the upper region has a bottom surface formed with a sliding channel while the lower region has a bottom surface formed with a coupling channel. A fixing unit includes a fixing element and a location adjustment element having a sliding block disposed slidably in the sliding channel and extends upward at partially from the rear side in such a manner to link up with the fixing element, which holds a personal electronic device stably therein. A bendable support bar is coupled detachably to the coupling channel of the installing unit.
US09889796B2	Driving support device An alarm controller generates an alarm output instruction when an own vehicle state determination unit determines that an own vehicle intends to cross the opposite lane at an intersection, and the object state determination unit determines that an oncoming vehicle or a person exists or moves in a direction in which the own vehicle crosses the opposite lane at into the intersection. A shift position detector detects a shift lever position. When the shift position detector detects that a shift lever is in a parking position or a reverse position, the alarm controller does not generate the alarm output instruction.
US09889795B1	System for controlling multiple warning devices mounted on a vehicle to provide warning signals A system is provided having a controller for controlling operation of warning devices mounted on a vehicle for providing warning signals directed external of the vehicle. The controller receives one or more vehicle event signals, each indicative of occurrence of a different vehicle event. The controller responsive to receiving each vehicle event signal overrides operation of one or more of the warning devices from a normal operating mode into an override operating mode in accordance with the vehicle event associated with the vehicle event signal being received. In an override operating mode, warning device(s) may provide visual signals to supplement pre-existing vehicular light indicators of vehicle events, while other warning device(s) may be disabled to avoid confusion with such vehicular light indicators. To facilitate ease of connection, each warning device couples to the controller at an output port for receiving power and ground, and control signals from the controller.
US09889790B2	Imaging system with adaptive high beam control An imaging system is provided herein. An image sensor is configured to acquire one or more images of a scene external and forward of a controlled vehicle and to generate image data corresponding to the acquired images. A controller is communicatively connected to the image sensor and is configured to receive and analyze the image data. The controller detects an object of interest in the image data and generates an ON signal or an OFF signal based on the detection of the object of interest in the image data, or lack thereof. A high beam control of the vehicle is turned ON based on the ON signal or turned OFF based on the OFF signal. The controller modifies a future response time at which the OFF signal is generated based on an external overriding of the ON signal or the OFF signal.
US09889784B1	Hauling device A hauling device configured to retain debris in a main bucket having a frame and adapted to be towed by a motorized vehicle is further configured to enable hoisting and dumping the frame of the main bucket via a lifting mechanism. An auxiliary bucket is provided that has a frame detachably affixed and clear of the main bucket.
US09889779B2	Seat frame In a seat cushion frame which comprises side frames fixed to each of the two ends of a pan frame in the width direction, the rigidity of mounting the side frames to the pan frame is increased. In this seat cushion frame having a configuration in which side frames are fixed to both ends of the pan frame in the width direction, the side frame is fixed to the pan frame with a flange formed by bending the top part inwards in the width direction, and a recess recessed inwards in the width direction is formed in the portion of the flange that is fixed to the pan frame.
US09889777B2	Off-road wheeled side-by-side vehicle A vehicle includes a frame, front and rear wheels, a motor, and a driver seat. A passenger seat disposed side-by-side with the driver seat has a seat base that is pivotable about a horizontal pivot axis between a seating position where it extends horizontally and a storage position. A retaining surface having a seating position groove and a storage position groove is fixed with respect to one of the seat base and the frame. A retaining member fixed with respect to another of the seat base and the frame is complementary to the grooves. The retaining member is received in the storage position groove when the seat base is in the storage position, thereby retaining the seat base in the storage position. The retaining member is received in the seating position groove when the seat base is in the seating position, thereby retaining the seat base in the seating position.
US09889774B2	Release mechanism for seat recliner assembly A seat adjustment mechanism may include a recliner mechanism, a recliner handle, a hub and an unlock lever. The recliner mechanism is operable in an unlocked state permitting relative rotation between a seatback and a seat bottom and a locked state preventing relative rotation between the seatback and the seat bottom. The recliner handle is rotatable between locked and unlocked positions to move the recliner mechanism between the locked and unlocked states. The hub may transmit motion of the recliner handle to the recliner mechanism as the recliner handle moves between the unlocked and locked positions. The unlock lever may move the recliner mechanism between the locked and unlocked states. Rotation of the recliner handle may cause corresponding rotation of the hub and the unlock lever. However, the unlock lever may move the recliner mechanism into the unlocked state without causing corresponding rotation of the hub and the recliner handle.
US09889773B2	Anthropomorphic upper seatback A vehicle seating assembly includes a seatback frame. An articulating upper thoracic region is operably coupled with the seatback frame and includes a cross-vehicle support, a torso vertical support, and a suspension support. The articulating upper thoracic region is pivotally coupled with a mid-portion of the seatback frame between stowed and deployed positions. A back panel is operably coupled to a rear side of the seatback frame. A front close-out panel is disposed between a rear portion of the articulating upper thoracic region and the back panel. A peripheral gap is disposed between the front close-out panel and the articulating upper thoracic region.
US09889769B2	Seating arrangement for a passenger vehicle A vehicle seating assembly includes a front seat and a rear seat, each having a backrest and a squab. The front and rear seats are arranged in a staggered duplex overlapping relationship. A portion of a front edge of the rear seat squab overlaps a portion of a rear edge of the front seat squab. An inboard edge of the rear seat squab overlaps a portion of an inboard edge of the front seat squab. A longitudinal distance measured from a front edge of the front seat squab to a rear edge of the rear seat squab is less than the sum of the longitudinal lengths of the front and rear seat squabs. A transverse distance measured from an outboard edge of the front seat squab to an outboard edge of the rear seat squab is less than the sum of the widths of the front and rear seat squabs.
US09889765B2	Fuel cell system A fuel cell system that includes a fuel cell and a secondary battery, each acting as a power supply source. A first converter a second converter is provided between the fuel cell and the secondary battery and first and second loads. A first inverter is provided between the first and second converters and the first load and a second inverter is provided between the first and second converters and the second load. A first controller controls an output of the fuel cell by controlling the first converter, and a second controller is configured separately from the first controller. If one of the first controller and the second controller receives the failure information sent from the other, the first controller or the second controller that has received the failure information stops operation of the control target thereof.
US09889763B2	External power supply of fuel cell mounted vehicle and control method therefor There is provided a control method of an external power supply system configured to supply power to the outside from a fuel cell and a secondary battery mounted on a vehicle. When a failure is detected in a sensor that measures an electric power supplied to the outside from an electric power line to which the fuel cell and the secondary battery are connectable, (a) if a decrease in a state of charge of the secondary battery is detected, external power supply is performed by increasing a generated power of the fuel cell so as to stop the decrease in the state of charge, and (b) if an increase in a state of charge of the secondary battery is detected, external power supply is performed by decreasing the generated power of the fuel cell so as to stop the increase in the state of charge.
US09889762B2	Control system for charging vehicle battery in response to an unstable state An object is to avoid the situation in which the power cannot be turned off. A control system is provided in which the first and second control units are connected. At least one of the first and second control units include: a stop control section for, if a condition for ending a predetermined operation mode is satisfied in that operation mode, performing stop control for having the control system in a low-power-consumption state while communicating with the other control unit; and a mode control section for having a mode undefined state in which the operation mode is instable at restoration from a reset state and for allowing, if a predetermined transition condition for allowing transition into the operation mode is satisfied in the mode undefined state, transition into the operation mode whose transition condition has been satisfied.
US09889759B1	Market-adaptive detection of plug-in electric vehicle charging using whole house energy metering data The invention provides improved methods for detecting the presence of a plug-in electric vehicle (PEV) at a location based on interval measurements from whole house electrical meters. This methodology is applicable to multiple detection algorithms and has been validated using actual PEV customer data.
US09889757B2	Mobile machine, wireless power transmission system, and wireless power transmission method According to one embodiment, a mobile machine includes a mobile body and a plurality of power transmission resonators. The mobile body is capable of being tilted in a particular direction such that a distance between a particular part opposed to a travel surface and the travel surface is reduced. The plurality of power transmission resonators are arranged at portions of the particular part of the mobile body, heights of the portions with reference to the travel surface being approximately identical with each other in a state of the mobile body being tilted.
US09889751B2	Battery management apparatus and method The present invention provides a battery management apparatus and method which connect a plurality of batteries having different energy densities to each other and control power supplied through the plurality of batteries to control the driving of the driving body.
US09889744B2	Vehicle traction control apparatus In the case where a virtual vehicle speed selection means selects one of a first virtual vehicle speed and a second virtual vehicle speed so as to perform switching from the other one to said one of the first virtual vehicle speed and the second virtual vehicle speed, the rotation speed of an electric motor is decelerated to a threshold value with which travel of the vehicle stabilizes and the deceleration of the electric motor is stopped when the rotation speed of the electric motor becomes lower than the threshold value, and then traction of the vehicle is controlled based on the selected virtual vehicle speed.
US09889739B2	Universal combination meters Universal combination meters, methods for customizing a universal combination meter, and electronic dashboards are disclosed. A universal combination meter may include a processing device and a non-transitory, processor-readable storage medium. The non-transitory, processor-readable storage medium may include one or more programming instructions that, when executed, cause the processing device to monitor one or more data transmissions between a manufacturing computer and a vehicle, determine at least one of a model and a body type of the vehicle from information in the data transmissions, retrieve at least one of an image, vehicle-specific features, and vehicle-specific information from a repository, and load the at least one of the image, the vehicle-specific features, and the vehicle-specific information for displaying. The at least one of the image, vehicle-specific features, and vehicle-specific information correspond to the at least one of the model and the body type of the vehicle.
US09889738B1	Prime mover RPM limiting control A method for controlling the operation of a vehicle prime mover based on the engagement status of one or more safety restraints of the vehicle. In various implementations the method comprises monitoring, via a RPM controller of the vehicle, an operational status of vehicle, monitoring, via the RPM controller, the engagement status at least one passenger safety restraint of the vehicle, and limiting, via the RPM controller, a rotational speed, e.g., revolutions per minute (RPM) of one or more prime mover of the vehicle when the vehicle is in a On operational status and the at least one safety restraint is in a disengaged status.
US09889736B2	Exhaust structure for compact vehicle An exhaust pipe extends rearward of a vehicle body from an engine located forward of the rear wheels and is supported on the vehicle body frame. An exhaust muffler is coupled to a rear end of the exhaust pipe that is arranged between a pair of right and left rear wheels. A catalytic converter (catalytic device) is installed in the middle of the exhaust pipe and the exhaust pipe is deviated to one side in a horizontal direction of the vehicle body with respect to the engine and the exhaust muffler in order to position the catalytic convertor between the vehicle body frame and the rear wheels.
US09889735B2	Active grill shutter actuation system A grille shutter actuation system for a vehicle includes a grille shutter, a linear actuator having a cylinder with first and second orifices and a piston. The piston is connected to the grille shutter for moving same. Fluid is pumped into one of the orifices through first or second hoses for moving the piston. A bi-directional motor is connected to the pump, and a controller controls a direction of rotation of a motor shaft in response to an input. A control module provides the input to the controller which determines whether fluid is pumped into the first or second orifice dependent upon the direction of rotation of the shaft. The input is determined by the control module based on information from the controller and/or a sensor associated with the grille shutter. The pump and motor may be remotely mounted within an engine compartment, for example, a distance from the linear actuator(s).
US09889734B2	Power transmission system and vehicle comprising the same A power transmission system for a vehicle includes: an engine; input shafts, each of the input shafts being provided with a shift driving gear thereon; output shafts, each of the output shafts being provided with a shift driven gear configured to mesh with a corresponding shift driving gear; a generator gear fixed on one of the output shafts; a reverse output gear configured to rotate together with or to disengage from a shift driving gear; an output idler gear configured to engage with one of the output shafts so as to rotate together with the output shaft or disengage from the output shaft so as to rotate with the output shaft at different speeds; a motor power shaft configured to rotate together with the generator gear; and a first motor generator configured to rotate together with the motor power shaft. A vehicle including the power transmission system is also provided.
US09889729B2	Hybrid door for automobile A hybrid door for an automobile, which can reduce the weight of an automobile while maintaining high strength and dent includes an outside panel configured to have a sandwich structure in which a resin layer is integrated between at least one pair of thin steel plates and disposed outside an automobile interior, and an inside panel bonded to the outside panel and disposed within the automobile interior.
US09889727B2	Attachable canopy for riding lawnmower An attachable canopy for a riding lawnmower for providing a shading mechanism for a user seated on such a lawnmower includes a harness formed from a wrap around elongated strap that has a first end that is connectable to a second end, a frame which includes two elongated rods whose proximal ends are connected to opposite sides of the harness, and a canopy which is connected to the distal ends of the rods. The harness is adjustable so as to be attachable to either the seat or seat back of a riding lawnmower. In this regard, the rods which form the frame may selectively swivel at least ninety degrees so as to remain in a perpendicular orientation relative to the seat with the canopy held over the seat regardless of which structure the harness is attached to.
US09889723B2	Active pressure relief valve for automatic air extractor A passenger vehicle comprises a passenger compartment with an interior space. An HVAC system conditions fresh air from outside the vehicle, wherein the HVAC system includes a main blower for delivering conditioned air to the interior space. An air extractor valve is fluidically coupled between the interior space and the outside, wherein the air extractor valve opens in response to a higher pressure in the interior space than an outside pressure. The air extractor valve substantially blocks air flow from the outside to the interior space. A supplemental blower is integrated with the air extractor valve for directing an exhaust flow from the interior to the outside, wherein the supplemental blower is activated as a function of the main blower. Alternatively, the supplemental blower is activated in response to a door being opened, enhancing the ability of the extractor to reduce door closing effort.
US09889720B2	Air-conditioning apparatus for vehicle An air-conditioning apparatus for a vehicle includes an air-conditioning duct that includes an air supply path through which air to be supplied into an interior of the vehicle passes, a first tank to which a cool medium and a warm medium for adjusting the temperature of a first intermediate medium are supplied, a first heat exchanger that is provided in the air-conditioning duct and through which the first intermediate medium circulates from the first tank, and a controller that controls the first intermediate medium to a temperature needed to set the interior to a desired temperature.
US09889719B2	Apparatus and method for improving air quality in vehicle An apparatus and a method for improving air quality in a vehicle are provided. The method for improving air quality in a vehicle, includes: acquiring state information about the vehicle and/or environmental information of the vehicle; determining whether ventilation of the vehicle is to be performed according to the state information and/or the environmental information; deriving a time period for ventilation of the vehicle according to the state information and/or the environmental information if it is determined that the ventilation of the vehicle is to be performed; and performing the ventilation of the vehicle in open mode automatically for the derived time period so as to improve the air quality in the vehicle. The apparatus and the method can improve the air quality in the vehicle before a user enters the vehicle, and thus provides the user with more comfort.
US09889707B2	Tire comprising cables for reinforcing the carcass having low perviousness, and textile threads associated with the carcass reinforcement A tire having a radial carcass reinforcement, composed of at least one layer of metal reinforcing elements, the said tire comprising a crown reinforcement, itself topped radially by a tread, the said tread being joined to two beads via two sidewalls. The metal reinforcing elements of at least one layer of the carcass reinforcement are cords exhibiting, in the “permeability” test, a flow rate of less than 20 cm3/min and at least one layer of the carcass reinforcement is provided, on at least one face, with textile threads exhibiting, in the “permeability” test, a flow rate of between 1 and 3 cm3/min.
US09889706B2	Pneumatic tire with rectangle-sheet-shaped carcass ply pieces A pneumatic tire is provided with a carcass configured from at least one carcass ply. The carcass ply is formed by arranging, in the tire circumferential direction, rectangular sheet-shaped ply pieces, each having a radial direction length larger than a tire circumferential direction length. In each of the ply pieces, carcass cords are arranged parallel to each other in the longitudinal direction, and adjacent ply pieces at least partially overlap with each other in the tire circumferential direction, and in each of the ply pieces, the distance (Pe) between the carcass cords in at least one side edge portion in the circumferential direction of the ply piece, is larger than the distance (Pc) between the carcass cords in a central portion of the ply piece.
US09889704B2	Foldable tire, method and use A collapsible tire for a passenger vehicle, comprising at least one carcass reinforcement optionally associated with an inextensible crown reinforcement, itself radially on the inside of a tread, two beads and two sidewalls, said beads comprising at least one inextensible circumferential reinforcing element called a bead wire, said bead wire defining, when free of any stress, a mean line forming a substantially circular closed curve in a circumferential plane, wherein the invention is characterized in that the bead wire of each bead is flexible, wherein after the tire has been collapsed, the mean line of the bead wire simultaneously defines a first curvature, and a second curvature, the first and second curvatures being connected together by a third connecting curvature, the projection of said first, second and third curvatures of the collapsed tire onto an axial plane defining the two-dimensional envelope by way of a total perimeter P of less than or equal to [3×(2H+A)], H being the height of the sidewall and A the width of the tire, and a collapsing method for the tire.
US09889702B2	Writing tool for mounting on a finger and writing tool finger holder The part for mounting on the finger is provided so as to be integral with a linking member; by means of building-in, folding, inserting and removing, and winding, the holder is made deformable to a carried condition when not in use; a necessary shortest dimension of the writing tool in the written condition is divided into at least two sections, i.e., an axis body 1 and a cap 2; and then, the axis body 1 and the cap 2 are overlapped with each other by means of folding or storing to thereby shorten the writing tool in a retained condition, and the writing tool in the written condition is reversibly movable in a predetermined range to thereby make an angle of the writing tool adjustable.
US09889701B2	Writing implement A writing implement in which a joint connecting an ink supply section and a ballpoint pen tip together is configured from three members. The three members configuring the joint are a substantially cylindrical center member, a substantially cylindrical surrounding member formed at the outer periphery of the center member, and an interposing member that is molded by a soft member molded so as to cover the outer periphery of the center member and the surrounding member. An annular gap section is provided between the center member and the surrounding member. The leading end of the ink supply section is fitted into the gap section. The joint is formed by two color molding. The center member and the surrounding member are molded by primary molding, and the interposing member is integrally molded onto the center member and the surrounding member by secondary molding.
US09889700B2	Modular fountain pens useable with inks of varying viscosities Modular fountain pens useable with inks of varying viscosities that utilize a nib with exterior grooves for conveying ink, which removably fits into a coupler that places the nib in fluid communication with a reservoir by way of a central ink tube. The coupler removably secures into a housing, which is closed on its opposite end by a rotating end cap designed to engage the ink reservoir so as to allow the pen user to adjust the internal volume of the reservoir. The pen allows for quick assembly and disassembly, which allows the pen to be easily cleaned between uses to accommodate fluid inks that may leave heavy residues and also allows for the appearance of the pen to be changed according to user tastes. The use of a quick-removing nib allows for a double-tipped nib to be used, with different writing tips, and easy swapping by the pen user between writing tips.
US09889699B2	Unisometric reflection display, information holder using unisometric reflection display A unisometric reflection display having a light transmissivity includes reflectors included in a reflector holding layer of a thin film form. The reflectors incline at a fixed direction and a fixed angle to a plane of the reflector holding layer. Light incident from a first direction is reflected on a front surface of a reflector to be inhibited from transmitting through the reflector holding layer. Light incident from a second direction to a reflector is reflected on a front surface of the reflector and a rear surface of another reflector adjacent the reflector at a front surface side, or reflected this way a plurality of times to transmit through the reflector holding layer.
US09889698B2	Secure laminate with security feature on the edge A laminate structure along with one or more security features is disclosed. The laminate structure may correspond to an identification document, such as an identification card, and may include a core layer with one or more security elements established thereon. As light is emitted into the core layer, the light impacts one or more of the security elements and is re-radiated back out of the core layer, thereby providing an indication that the laminate structure includes the security elements and is, therefore, authentic.
US09889693B2	Inkjet recording method and inkjet recording apparatus An inkjet recording method using an active light-curable inkjet ink according to the present invention is characterized in that: the inkjet ink contains at least a gelling agent, a photopolymerizable compound and a photopolymerization initiator; the gelling temperature T1 (° C.) of the active light-curable inkjet ink, the temperature T2 (° C.) of the ink at the time when the active light-curable inkjet ink landed on a recording medium, and the temperature T3 (° C.) of the ink at the time when the active light-curable inkjet ink is irradiated with active light satisfy the relationship T1 (° C.)>T2 (° C.)>T3 (° C.); and the solubility of the gelling agent in the photopolymerizable compound at T3 (° C.) is less than 0.1% by mass. This inkjet recording method is capable of suppressing blooming, while at least maintaining the leveling properties and the pinning properties of an inkjet ink.
US09889691B1	Egg carton printer system and method of use A printer system comprising a printer having a printhead operatively installed therein, the printer including a housing having opposing thumb screws extending outwardly therefrom, and a mount comprising a printer bracket having opposite printer bracket side members each terminating in a distally extending side member leg configured for attachment to the rail, the printer bracket side members each further having a mounting slot formed therein with a vertical slot portion and at least one horizontal slot portion and a rail bracket having a rail bracket top member with opposite substantially downwardly extending rail bracket side members terminating in outwardly extending side member legs configured for attachment to the rail, whereby the printer is received within the mount and selectively positioned therein as by engaging the thumb screws within the mounting slots so as to position the printhead as desired beneath the rail bracket top member.
US09889689B2	Printing apparatus and printing method A printing apparatus includes a carriage on which a print head is mounted and that discharges an ink from the print head while moving the carriage along a predetermined direction and further includes a space width adjustment unit that causes a width of a space above the carriage within the printing apparatus to be larger in an acceleration region in which the carriage is accelerated from a stopped state than in a constant velocity region in which the carriage is moved at a constant velocity after the acceleration region. The space width adjustment unit causes the width of the space above the carriage in the constant velocity region to be smaller than or equal to a paper gap that is a distance between the carriage and a print medium which is below the carriage and which receives the ink discharged from the print head.
US09889682B2	Apparatus and method for positioning a substrate on a support body An apparatus is provided for positioning a substrate on a support body. The apparatus comprises the support body for supporting the substrate, at least one registration element, wherein said at least one registration element is positioned and arranged for registering the substrate in a preselected position on the support body when brought into a registering state. The apparatus further comprises a registration actuator movably arranged with respect to the support body for selectively arranging a registration element into the registering state.
US09889680B2	Liquid discharge apparatus, method of applying treatment liquid to medium, and image forming method A liquid discharge apparatus includes a device to apply a treatment liquid to a medium; a drying device to dry the treatment liquid applied to the medium; a device to apply a liquid containing a colorant to the medium on which the treatment liquid has been applied; and a control device. The control device controls a supply amount of the treatment liquid to an amount such that a surface hardness of the medium is 0.07 GPa or more as measured by nano indentation after the drying device dries a surface of the medium.
US09889676B2	Printing device Provided is a printing device that has a thermal head that transfers overcoat ink provided on an ink sheet onto the surface of printing paper based on pattern data. The pattern data is data in which a first pattern and a second pattern are arranged alternately in a primary scanning direction and a secondary scanning direction. The first pattern includes a rectangular block of high tonal value pixels, a frame-like group of low tonal value pixels surrounding the rectangular block, and a group of high tonal pixels surrounding the group of low tonal value pixels. The second pattern includes a rectangular block of low tonal value pixels, a group of high tonal value pixels surrounding the rectangular block, and a frame-like group of low tonal pixels surrounding the group of high tonal value pixels.
US09889674B2	Ink, ink cartridge, and image recording method An ink of this invention contains a self-dispersible pigment having a phosphonic acid group bonded directly or through another atomic group to the surface of the self-dispersible pigment, polyurethane resin particles, a monovalent inorganic salt, and water.
US09889673B2	Liquid discharge apparatus and liquid discharge head A liquid discharge apparatus has a liquid discharge head having a recording element board that includes a plurality of discharge orifices configured to discharge liquid, a plurality of pressure chambers internally provided with a recording element configured to generate energy used to discharge liquid, the plurality of pressure chambers each communicating with the plurality of discharge orifices via discharge channels, a liquid supply channel configured to supply liquid to the plurality of pressure chambers, and a liquid recovery channel configured to recover liquid from the plurality of pressure chambers, and a tank configured to store liquid supplied to the liquid discharge head. The plurality of pressure chambers communicate between the liquid supply channel and the liquid recovery channel so that liquid flows through the plurality of pressure chambers, and the specific permittivity εr of the liquid stored in the tank satisfies the relationship of εr≦65.
US09889671B2	Liquid container, liquid container unit, and liquid supply apparatus Provided is a technique capable of reducing the possibility that liquid reaches a visual check face. A liquid container includes a liquid retaining portion that can retain liquid and has an injection port forming face in which a liquid injection port is arranged, a visual check face that intersects the injection port forming face and through which a liquid surface in the liquid containing portion can be visually checked from the outside, and a container guiding path that guides the liquid existing in the injection port forming face in a direction different from a direction toward the visual check face.
US09889667B2	Maintenance device used in liquid discharge head, liquid discharge device, and liquid discharge apparatus A maintenance device used in a liquid discharge head includes a first cap to seal a nozzle face of the liquid discharge head, a second cap disposed outside the first cap, and a humidity conditioner disposed outside the first cap and inside the second cap. The second cap seals the first cap and at least a contact portion between the nozzle face of the liquid discharge head and the first cap. The humidity conditioner adjusts humidity in a space between the first cap and the second cap.
US09889662B2	Liquid droplet discharging head and image forming apparatus, including displacing film that applies self-displacement to apply pressure to liquid inside chamber A liquid droplet discharging head includes discharging orifices to discharge a liquid droplet, pressure generating chambers to apply a pressure to liquid inside the liquid droplet discharging head, a common liquid supplying chamber to accommodate the liquid to the pressure generating chambers, individual supplying paths to communicate the pressure generating chambers with the common liquid supplying chamber, a displacing film for discharging to conduct self displacement to individually apply a pressure to the liquid inside the pressure generating chambers to discharge the liquid from the discharging orifices, a liquid supplying chamber displacing film to conduct self displacement according to a pressure change of the liquid in the common liquid supplying chamber, and individual supplying holes existing at each border between the individual supplying paths and the common liquid supplying chamber and facing the liquid supplying chamber displacing film via the liquid in the common liquid supplying chamber.
US09889659B2	Printhead with a memristor In an example, a printhead includes a memristor, in which the memristor may include a first electrode, a second electrode positioned in a crossed relationship with the first electrode to form a junction, and a switching element positioned at the junction between the first electrode and the second electrode, in which the switching layer includes a via formed in the switching element to reduce an area of the switching element.
US09889658B2	Bonded member, liquid discharge head, liquid discharge device, and liquid discharge apparatus A bonded member includes at least two members. The at least two members include a first member and a second member bonded to each other. The first member has a bonded face bonded to the second member. The bonded face has a recessed portion at an outer periphery of the bonded face, to retain an adhesive. The recessed portion is open at the bonded face and an outer peripheral face of the first member. In a plan view from a direction vertical to the bonded face, an outer edge of a bottom face of the recessed portion is disposed at an inner position in an in-plane direction of the bonded face than an outer edge of the outer peripheral face of the first member.
US09889656B2	Channel substrate, method of producing channel substrate, liquid discharge head, ink cartridge, and liquid discharge apparatus A channel substrate includes a plurality of individual channels and a plurality of linear machining marks. The plurality of individual channels is arrayed in row. The plurality of linear machining marks is substantially parallel to a direction in which the plurality of individual channels is arrayed in row.
US09889655B2	Liquid ejecting head and method of manufacturing liquid ejecting head A liquid ejecting head and a method of manufacturing the liquid ejecting head are provided. The liquid ejecting head has a pressure chamber forming substrate that includes a plurality of piezoelectric elements and that is connected to a first surface of a sealing plate, a driver IC that outputs signals that drive the piezoelectric elements and that is provided on a second surface of the sealing plate that is on the opposite side to the first surface, and a power supply wire that supplies electrical power to the piezoelectric elements, that is formed in the second surface of the sealing plate, and that has at least one portion thereof embedded in the sealing plate and a surface thereof exposed on the second surface side.
US09889654B2	Liquid ejection head, liquid ejection unit, and liquid ejection device A liquid ejection head includes structures arrayed in a predetermined direction, each structure including a nozzle to eject liquid, a pressure chamber in communication with the nozzle, and an ejection drive unit to increase pressure of the liquid in the pressure chamber. The ejection drive unit includes a diaphragm to form a wall of the pressure chamber, and an electromechanical transducer element including an electromechanical transducer film, the diaphragm being convex toward the pressure chamber. When an amount of curvature of the diaphragm for the pressure chamber is defined by a radius of curvature, a difference between minimum and maximum radii of curvature of the diaphragm for 20 channels of the pressure chambers is equal to or less than 1500 μm, the 20 channels being counted from one of the pressure chambers at each of end portions of the structures in the predetermined direction.
US09889652B2	Piezoelectric device, inkjet head, inkjet printer, and method of manufacturing piezoelectric device An actuator as a piezoelectric device has a bonding layer including titanium, a lower electrode including platinum, a piezoelectric thin film, and an upper electrode formed in this order on a substrate. Ti particles precipitate from the bonding layer onto the lower electrode. Pt that forms the lower electrode has a crystal grain size of 75 nm to 150 nm.
US09889647B2	Interdigitated primitives Printing devices and methods are described. An array of ink nozzles can be arranged in a number of primitives, wherein a first primitive of the number of primitives is interdigitated with a second primitive.
US09889643B2	Recording device and recording method A printer includes a base platform that has a support surface on which a medium is mounted, and a liquid ejecting unit, which is capable of moving relatively in a direction that runs along the support surface, and which performs a recording operation on the medium from a recording head that moves along the support surface in a direction that intersects the direction. The base platform includes a first power source device, and first control substrate that controls operation of the base platform on the basis of the first power source device, and the liquid ejecting unit includes a second power source device, and a second control substrate that controls operation of the liquid ejecting unit on the basis of the second power source device.
US09889639B2	Method of forming a cured mineral fibre product A method of forming a cured mineral fiber product which includes at least a top layer having mineral fibers and a base layer having mineral fibers. The method includes the steps of providing the top layer web including uncured mineral wool, providing the base layer web including cured mineral wool, joining the uncured top layer web and the cured base layer web to form an assembled laminate, and curing the top layer web in a curing oven by transporting the assembled laminate into a curing oven having an upper conveyor and a lower conveyor for curing the assembled laminate, the assembled laminate being positioned between the upper and lower conveyors. The uncured top layer web is compressed by at least 50% as it enters into the curing oven.
US09889638B2	Electrical heating-joining device and method An electrical heating bonding device 1 bonds a member M1 to be bonded, which is made of a metal, and a member M2 to be bonded, which is made of a resin. The electrical heating bonding device 1 includes: an upper electrode 11 and a lower electrode 12 which sandwich the member M1 to be bonded, and are electrically conductive with the member M1 to be bonded; a pressurizing unit 20 which applies pressure to a bonding surface between the member M1 to be bonded and the member M2 to be bonded; a temperature sensor 30 which detects a temperature of the member M1 to be bonded; and a control unit 40 which controls the pressurizing unit 20 to apply the pressure to the bonding surface, after the temperature detected by the temperature sensor 30 reaches a predetermined set temperature Ts.
US09889636B2	Anti-slip floor mat with transparent top surface This invention provides an anti-slip floor mat with transparent top surface mainly includes a top surface, a PU self-skinning layer and an anti-slip layer stacked together in that order. The top surface is made of a transparent material. The PU self-skinning layer comprises foaming polyurethane and mainly formed by foaming an isocyanate with a polyether polyols intermixture, and the mass ratio of the isocyanate to the polyether polyols intermixture is 100:20˜50. A plurality of through holes passing through said anti-slip layer are defined in the anti-slip layer. A surface of said PU self-skinning layer adjacent to said anti-slip layer further comprises a plurality of rivets, said rivets pass through said through holes and extend to a surface of said anti-slip layer away from said PU self-skinning layer.
US09889632B2	Metal laminate with metallurgical bonds and reduced density metal core layer and method for making the same A stiff, lightweight metal laminate includes a first continuous metal layer, a second continuous metal layer, and a reduced density metal core layer disposed between the first and second continuous metal layers. The reduced density metal core layer comprises a core metal and has an average density that is less than the density of the core metal. Planar metallurgical bonds secure the first and second continuous metal layers to the reduced density metal core layer. The metal laminate may be manufactured by press rolling the reduced density metal core layer sandwiched between the two continuous metal layers, after removing or overcoating the native oxide layer on each layer surface that contacts another layer in the metal laminate.
US09889628B2	Low specific gravity and high stiffness sandwich type steel sheet and method for manufacturing the same Disclosed is a sandwich type steel sheet having low specific gravity and high stiffness which may be applied to an exterior plate of a vehicle and the like, which require excellent strength, dent resistance and the like. Further, a method of manufacturing the sandwich type steel sheet having a low specific gravity and high stiffness is also disclosed. Particularly, the sandwich type steel sheet includes an upper steel sheet positioned at an upper portion; a lower steel sheet positioned at a lower portion; a polymer layer containing an amount of about 50 to 60 wt % of a polyamide 6 resin, an amount of about 25 to 45 wt % of a polyolefin resin, based on a total weight of the polymer layer. Therefore, the thickness of the steel sheets may be reduced by about 20% from the conventional steep sheet, and strength, dent resistance and the like may be enhanced. In addition, clunking, a slight noise of opening and closing doors, and the like, which are caused by a thin steel sheet and discomfort of a passenger by heavy rainy sound may be eliminated.
US09889624B2	Anisotropic thermal conduit An anisotropic thermal conduit having an outer cylindrical tube; and an anisotropic thermal material disposed with the outer cylindrical tube.
US09889623B2	Automated inflation device Various embodiments of the present invention generally relate to an automated inflation device configured for inflating an inflatable structure, which can then be used—for example—as a protective packaging material. As described in detail herein, various embodiments of the inflation device are configured to be mounted on a wall for convenient installation and use. According to certain embodiments, the inflation device is configured to automatically inflate multiple inflatable chambers in the inflatable structure using an efficient inflation-at-a-distance method. Moreover, various embodiments are provided with one or more user input controls and/or remote sensors to enable a user to conveniently request inflation of a particular number of inflatable chambers or a particular length of the inflatable structure.
US09889622B2	Pressing apparatus A pressing apparatus is disclosed. The pressing apparatus includes: a static pressing plate; a movable pressing plate opposing the static pressing plate and including a plurality of movable press-blocks; a pressure sensor provided in each respective movable press-blocks; a plurality of drive units provided corresponding to the plurality of movable press-blocks, each drive unit being connected with one movable press-block for driving the corresponding movable press-block; a control unit electrically connected with each drive unit and each pressure sensor, the control unit being configured to compare the detected pressure value from each pressure sensor with a predefined pressure value, and adjust the pressure value between the corresponding movable press-block and the static pressing plate by means of the corresponding drive unit based on the comparison result.
US09889620B2	Devices and methods for the production of microfibers and nanofibers Described herein are apparatuses and methods of creating fibers, such as microfibers and nanofibers, that include additives that modify one or more properties of the produced fibers. The methods discussed herein employ centrifugal forces to transform material into fibers. Apparatuses that may be used to create fibers are also described. Fiber producing devices with features that enhance fiber production and adaptability to different types of fiber are described.
US09889618B2	Method and system for producing a tyre tread with lugs A method of producing a tire tread with lugs; the tread having a tread base, and a number of lugs projecting upwards from the tread base; and the method including the steps of: preparing a green-rubber blank tread thinner at the sides and thicker at the center to define a raised center portion; applying green-rubber blocks to the areas of the blank tread where the lugs are to be formed, which blocks rest centrally against the raised center portion; and curing the blank tread, together with the blocks, in a curing mold negatively reproducing the pattern of the tread.
US09889617B2	Apparatus and method for retreading tires The present invention relates to an apparatus (10) and a method for retreading a tire (16) having a worn surface (12). The worn surface (12) is made of a thermoplastic elastomer. The apparatus (10) includes a heater (34) and a 3D printer (18). The heater (34) is adapted to heat up the worn surface (12) to a desired temperature. The 3D printer (18) is adapted to lay one or more layers of the thermoplastic elastomer onto the heated worn surface (12). The or each layer of thermoplastic elastomer is capable of adhering to the heated worn surface (12) or previously laid layer without requiring an adhesive medium or agent.
US09889615B2	Stacked integrated component media insert for an ophthalmic device This invention discloses methods and apparatus for providing a media insert with an energy source to an ophthalmic lens. The energy source is capable of powering a component included within the ophthalmic lens. In some embodiments, an ophthalmic lens is cast molded from a silicone hydrogel and the component includes an electro-optical lens portion.
US09889614B2	Method of making light redirecting fabric A flexible sheet-form optical system, referenced to as a light redirecting fabric, which has a fabric-like behavior and light redirecting properties. The light redirecting fabric comprises a soft and flexible sheet of optically transmissive material, such as plasticized polyvinyl chloride. A surface of the flexible sheet includes a plurality of parallel slits having spaced-apart walls configured to reflect light by means of a total internal reflection. At least a portion of daylight incident onto the sheet is internally redirected at bend angles greater than the angle of incidence. Disclosed also are a method and apparatus for making the light redirecting fabric. The method includes steps of mechanical slitting of the flexible sheet with a blade, elastic stretch-elongation of the sheet along a direction perpendicular to the slits, and making at least a portion of the sheet elongation irreversible.
US09889612B2	Automated resin and fiber deposition for resin infusion A composite structure is fabricated by laying up at least one ply of fiber reinforcement and at least one layer of resin on a tool. The resin film layer is formed by laying strips of resin film. The fiber reinforcement is infused with resin from the resin layer.
US09889607B2	Three-dimensional printer with integrated coloring system A three-dimensional printer effects color changes in an extrudate using a color-application unit applying a colorant to the interior of a filament before it is melted within an extruder. Specifically, the color-application unit may receive a filament (or portions thereof) having an exposed interior surface, where color applicators are actuated to apply one or more colors to the interior surface of the filament in order to modify the extruded color. The filament may then be coupled, collapsed, or otherwise closed about the interior surface, e.g., by a mechanical coupler, to substantially enclose the interior surface of the filament, which is then fed to the extruder for fabricating a colored object in a three-dimensional fabrication process. By enclosing the colored surface within the filament before melting for extrusion, transition effects of a color change can be mitigated and transition time for a substantially complete change in color can be significantly reduced.
US09889604B2	Device for the production of a three-dimensional object A device for producing a three-dimensional object from hardenable material has a construction space (20) for constructing the object (50), a temperature control unit for controlling the temperature of the construction space (20), and a preparation unit (11) for preparing the hardenable material in such a way that the material is in the fluid phase. A pressure generation unit (10) applies pressure to the fluid phase in the preparation unit. A discharge unit (12) is provided for discharging the hardenable material through an outlet (12b) in the form of drops in the direction of the construction space (20). In order to optimize the energy required to control the temperature that promotes bonding of the material on the object (50), the temperature-controlled construction space (20) is surrounded by a construction space frame (18) in which at least the outlet of the discharge unit (12), the preparation unit (11), and the object support (13) for producing the object are accommodated.
US09889598B2	Adhesive thread system A system for forming a waterproof seam between to sewn materials. The seam is formed using an adhesive coated thread. A thin strip of adhesive is placed between the two materials at the seam line. As the coated thread is sewn into the seam heat and pressure are simultaneously applied, melting the adhesive coating thereby filling the needle punctures. The melted adhesive coating will also flow into the areas between the needle punctures and between the materials. The heat and pressure applied to the coated thread will also melt the adhesive strip, causing additional adhesive to flow into the needle punctures and the areas between needle punctures.
US09889597B2	Imprint lithography An imprint lithography apparatus is disclosed that includes a support structure configured to hold an imprint template. The apparatus further includes an actuator located between the support structure and a side of the imprint template, when the imprint template is held by the support structure, configured to apply a force to the imprint template and a force sensor between the support structure and a side of the imprint template, when the imprint template is held by the support structure.
US09889595B2	Blow molding device A blow molding device includes a blow molding mold to which a preform is fitted, a blow nozzle that is fitted to a mouth tubular portion of the preform, and a pressurized liquid supply unit configured to supply a pressurized liquid to the blow nozzle, the preform being to be molded into a shape conforming to a cavity of the mold by filling the liquid into the preform through the blow nozzle. The blow nozzle includes a central hole and a plurality of peripheral holes having an inner diameter smaller than an inner diameter of the central hole and arranged to surround the central hole. The liquid is filled into the preform through the central hole and the plurality of peripheral holes.
US09889585B2	Glass encapsulation structure and injection molding device A glass encapsulation structure and an injection molding device are provided. The encapsulation structure includes: a guide piece; and an encapsulation component, wherein the guide piece is fixed to a side surface of a glass through the encapsulation component, wherein the guide piece includes a strip part, a bump and a positioning hole, wherein the strip part has a first surface, and a second surface opposite to the first surface and facing an interior of a vehicle body when the guide piece is mounted onto the vehicle body, the bump is located on and perpendicular to the first surface, the positioning hole is formed in the bump, an axis of the positioning hole is perpendicular to the side surface of the glass, and the positioning hole matches a positioning pin in an injection molding device in an injection molding process. A yield of encapsulation structures may be improved.
US09889583B2	Grain bin sensor cable forming apparatus A method and apparatus for forming a grain bin sensor cable including a plurality of mold members defining a mold cavity. A pre-formed cable with wires disposed therein is placed into the mold cavity, heated, and formed into a post-formed cable. The post-formed cable includes a recessed portion and a pair of end caps. Apertures are created within the recessed portion so as to expose a portion of the wires. The end caps are generally cone-shaped and include vertical walls. The post-formed cable is removed from the mold cavity and a sensor package is coupled to the wires exposed in the recessed portion and captured between the vertical walls of the end caps. A housing is coupled about the sensor package.
US09889581B2	Tool temperature control A tool element assembly (10) is provided in which ambient air is drawn into a fluid chamber (24) and heated via a heating element (28) in order to provide a low pressure, efficient, heating system.
US09889580B2	Turning device for turning a first mould part for manufacturing a wind turbine blade part relative to a second mould part A turning device, for manufacturing wind turbine blades and turning moulds relative to each other, having a base, a rotational part movable relative to the base on an rotational axis, a first linear actuator with first and second ends, the first end attaching to the base, and the second end attaching to the rotational part at a first anchor point on a first turning axis, and a second linear actuator having first and second ends, the first end attaching to the base, and the second end attaching to the rotational part at a second anchor point on a second turning axis. The first turning axis is a first distance from the rotation axis and is moved on a first arc on the rotation axis, and the second turning axis is a second, different distance from the rotation axis and is moved along a second arc on the rotation axis.
US09889575B2	Wire saw for cutting pipe A wire saw for cutting pipe is provided including a saddle forming a saddle surface for abutting against a cylindrical pipe, an elongate guide fixed to the saddle, a bow having a first and second end, a bridge portion joining the first and second ends, and an open end having a length L from the first end to the second end which is greater than a diameter D of the pipe, a wire loop movable along a track formed within the bow, and a cooling system for actively cooling the wire loop. The elongate guide has an axis approximately perpendicular to an axis of the pipe when the pipe is abutting against the saddle. An exposed portion of the wire loop extends across the open end. The bow is moveable on the elongate guide toward and away from the pipe when the pipe is abutting against the saddle.
US09889571B2	Razor cartridge with a lubrication member having a printed support structure A razor cartridge including a guard at a front portion of the cartridge, a cap at a back portion of the cartridge, at least one blade positioned between the guard and the cap, a top surface and an opposing bottom surface, and a lubricating member positioned in the cartridge at the top surface. The lubricating member has an exterior surface with a visible surface and a non-visible surface. A printed support structure is provided on the exterior surface of the lubricating member. The printed support structure covers a portion of the exterior surface to provide structural integrity for the lubricating member.
US09889568B2	Compact robotic wrist A surgical tool includes a tool shaft, and end effector and a wrist that couples the end effector to the tool shaft. The tool includes a drive mechanism configured to effect movement of one or both of the wrist and the end effector in yaw and pitch via independent actuation of four independent cable ends of two or more independent cables that extend between the drive mechanism and the wrist.
US09889556B2	Link structure A link structure includes a first link, a second link having an end that is connected to an end of the first link, a third link having an end that is connected to the end of the first link, and provided on a portion of the second link, a first rotary shaft partially provided in the first link, a first actuator configured to rotate the first link about the first rotary shaft; a second rotary shaft partially provided in the second link, the second rotary shaft being different from the first rotary shaft, and a second actuator configured to rotate the second link about the second rotary shaft, the first and second actuators being provided in the first link.
US09889554B2	Apparatus for human arm supporting exoskeleton An arm supporting exoskeleton comprises a shoulder base coupled to an arm link mechanism. The arm link mechanism comprises a proximal link and a distal link configured to rotate relative to each other about a rotating joint; at least one arm-coupler adapted to couple a user's arm to the distal link; a tensile force generator coupled to the proximal link and the distal link, and providing a torque to flex the distal link relative to the proximal link; and a protrusion located substantially at the rotating joint. When the distal link extends past a toggle angle, the protrusion constrains the tensile force generator, and the torque provided by the tensile force generator remains substantially small. When the protrusion does not constrain the tensile force generator, the torque tends to flex the distal link relative to the proximal link, thereby reducing human shoulder forces and torques required to raise the user's arm.
US09889551B2	Apparatus for coupling and decoupling button and loop connections of a garment An apparatus for coupling and decoupling button and loop connections of a garment. The apparatus includes a longitudinally extending body member having a handle member extending from a first end and a pair of prongs extending from an oppositely disposed second end. One prong has a hook on its distal end and the other prong has an expanded end member on its distal end. The prongs are generally parallel with one another forming a gap therebetween such that upon insertion of the prongs into a loop, the prongs cooperate to open the loop and position the loop relative to a button such that rotation of the apparatus about an axis of rotation defined through the prongs proximate the hook and the expanded end causes the loop to be moved relative to the button, thereby coupling or decoupling the loop and the button.
US09889548B2	Adaptive transmission mechanism A method to control a power tool includes the following steps: ascertaining a first rotational speed of the transmission in a first gear; ascertaining a first rotational speed of the motor when the transmission has been put into a first gear; ascertaining the selection of a first gear on the basis of the ratio of the rotational speed of the transmission and the rotational speed of the motor on the basis of a look-up table; selecting the no-load state; ascertaining the selected no-load state on the basis of the ratio of the rotational speed of the transmission and the rotational speed of the motor on the basis of a look-up table; adapting the rotational speed of the motor to a second gear on the basis of a ratio of the rotational speed of the transmission and the rotational speed of the motor on the basis of a look-up table; and selecting a second gear.
US09889542B2	Methods of forming polycrystalline compacts Methods for forming cutting elements, methods for forming polycrystalline compacts, and related polycrystalline compacts are disclosed. Grains of a hard material are subjected to a high-pressure, high-temperature process to form a polycrystalline compact. Inclusion of at least one relatively quick spike in system pressure or temperature during an otherwise plateaued temperature or pressure stage accommodates formation of inter-granular bonds between the grains. The brevity of the peak stage may avoid undesirable grain growth. Embodiments of the methods may also include at least one of oscillating at least one system condition (e.g., pressure, temperature) and subjecting the grains to ultrasonic or mechanical vibrations. A resulting polycrystalline compact may include a high density of inter-granularly bonded hard material with a minimized amount of catalyst material, and may provide improved thermal stability, wear resistance, toughness, and behavior during use of a cutting element incorporating the polycrystalline compact.
US09889541B2	Polycrystalline diamond compacts and related methods Embodiments of the invention relate to polycrystalline diamond compacts (“PDCs”) and methods of fabricating polycrystalline diamond tables and PDCs in a manner that facilitates removal of metal-solvent catalyst used in the manufacture of polycrystalline diamond tables of such PDCs.
US09889538B2	Method and apparatus for water jet cutting To control cutting process with cutting quality to obtain product without any uncut portion on a corner portion, and to respond to a change in cutting speed. Water jet cutting performed by: inputting a cutting program, set cutting speed, cutting parameters; calculating cutting speed matching the cutting quality; calculating cutting shape from the cutting program and dividing the cutting shape into a linear portion and a corner portion; calculating a corner cutting speed for the corner portion on the basis of a shape of the corner portion within range from the calculation cutting speed to the set cutting speed, set cutting speed equal to or higher than the calculation cutting speed; set cutting speed and the corner cutting speed to the linear portion and the corner portion, respectively, in the cutting program; moving the nozzle relative to the workpiece on the basis of the cutting program assigned with cutting speeds.
US09889536B2	Angle grinder control systems An angle grinder control system including an angle grinder control assembly. The angle grinder control assembly includes an outer-shell, a tightening-rod, an inner-shell, a control-rod, a return-spring, a trigger, and a control-rod-pin. The outer-shell includes a first-half-body-section and a second-half-body-section, where the inner-shell includes a primary-half-body-section and a secondary-half-body-section. The angle grinder control system provides a user an alternate means for controlling an angle-grinder-on/off-switch such that the angle grinder control system provides for safe use of an angle grinder in relation to the user. Embodiments of an angle grinder control system may include vents to promote cooling of the angle grinder. Additional embodiments many include a handle to aid the user in controlling and manipulating the angle grinder.
US09889532B2	Double disc surface grinding machine and grinding method A double disc surface grinding machine (10) includes work holding section (65) for holding an inner circumferential surface of an annular work (W) at a plurality of locations. The work holding section (65) includes a plurality of holding members (66) extending radially as viewed from a rotation shaft (46). Each holding member (66) is movable outward and inward radially of the rotation shaft (46), and is contactable to the inner circumferential surface of the work (W). The position adjustment section (76) connects the rotation shaft (46) and the work holding section (65) with each other, and adjusts a position of the work holding section (65) in the radial direction of the rotation shaft (46). While the inner circumferential surface of the work (W) is held by the work holding section (65), the rotation shaft (46), the position adjustment section (76), the work holding section (65) and the work (W) are rotated integrally with each other around the rotation shaft (46). Part of the rotating work (W) is sandwiched by a pair of grinding wheels (16a), (16b) to grind two main surfaces of the work (W).
US09889527B2	Methods and apparatus to provide a protective barrier to fuel tank coupling apparatus Methods and apparatus to provide a protective barrier to fuel tank coupling apparatus are described. An example method includes coupling a barrier to an outer surface of the fuel tank, where the barrier includes a support surface and a wall protruding from the support surface to define a cavity; providing a weld pad within the cavity such that a first side of the weld pad engages the support surface; disposing a valve within the cavity of the barrier after the barrier is coupled to the outer surface such that a flange portion of the valve engages the weld pad and at least a portion of the valve is positioned in the fuel tank; and heating the weld pad and the flange portion of the valve to a temperature greater than a melting temperature of a material of the flange portion and the weld pad.
US09889524B2	Polarization-adjusted beam operation for materials processing Systems and techniques for optimizing the operation of a beam emitter during material processing maintain an optimal polarization of the beam with respect to the material throughout processing—e.g., even as the beam path varies or the nature or thickness of the material changes.
US09889523B2	Method and device for processing a workpiece using laser radiation A method is provided for processing a workpiece using laser radiation, particularly for the purpose of laser ablation. At least one laser beam is provided, which is affected using at least one changeable beam forming device. The laser beam subsequently impinges upon at least one processing area of the workpiece. Using the beam forming device, at least one specified adjustable beam profile is impressed upon the laser beam at the location of the processing area configured.
US09889522B2	Laser processing system The laser processing head of the present disclosure includes a collimation lens, a focus lens, a first parallel plate, a first drive unit, a second parallel plate, and a second drive unit. The collimation lens collimates a laser beam having a first optical axis, and the focus lens condenses the collimated laser beam. The first parallel plate shifts the optical axis of the condensed laser beam to a second optical axis. The first drive unit rotates the first parallel plate around a first rotation axis. The second parallel plate shifts the optical axis of the laser beam shifted to the second optical axis, to a third optical axis. The second drive unit rotates the second parallel plate around a second rotation axis. The direction of the first rotation axis and the direction of the second rotation axis are identical.
US09889520B2	Method and apparatus for determining the voltage at the electrodes of a spot welding gun A method and an apparatus for determining the temporal curve of the voltage (ue(t)) at the electrodes (3) of a spot welding gun (1) during a spot welding process as an indicator of the welding quality, wherein the electrodes (3) are fastened to gun arms (2) that can be moved relative to each other are provided. The apparatus includes a device (9) for measuring a measuring voltage (um(t)) between the electrodes (3), that measuring device (9) being connected to measuring leads (6) extending along the gun arms (2), and further includes a compensating coil (7) for measuring a compensating voltage (uk(t)) for compensating measuring errors within measuring leads. In order to determine the temporal curve of the voltage (ue(t)) at the electrodes (3) of the spot welding gun (1) during a spot welding process as precisely as possible, the device (9) for measuring the measuring voltage (um(t)) and the device (10) for measuring the compensating voltage (uk(t)) are designed as separate units for separate detection and are connected to a device (11) for processing the detected values.
US09889518B2	Consumable electrode gas shield arc welding torch and power feed tip A consumable electrode gas shield arc welding torch (20) includes a torch body (21), a tip body (22) mounted to a front end of the torch body, a tip holder (23) mounted to a front end of the tip body, a spring (26) provided in the tip body (22) in contact with the front end of the torch body (21), a pressing shaft (27) provided in the tip body (22) in contact with a front end of the spring 26) and a power feed tip (28) pressed by the pressing shaft (27) and the tip holder (23). The tip (28) includes a side surface having a projection contacting with a base end (23a) of the holder (23), with a space (29) defined between an inner surface of the holder (23) and a front end (28a) of the tip (28) when the front end (28a) of the tip (28) is inserted into the holder (23).
US09889517B2	Method for selection of weld control algorithms A system and method for generating a weld are provided. The system receives a selection of a magnitude of a voltage. The system selects a first weld control algorithm when the magnitude of the voltage is in a first range of values. The system may also select a second weld control algorithm when the magnitude of the voltage is in a second range of values. The system may generate welding output power based on the first and second weld control algorithms.
US09889514B2	Spark erosion tool and electrode for a spark erosion tool A spark erosion tool includes an electrode arranged on a tool longitudinal axis and an electrode holder aligned along and arranged on the axis and connected to the electrode. The electrode holder includes a moving device for moving the electrode relative to the electrode holder and includes a press for applying pressure transversely to the axis in the area of an imaginary hose extending in the axis. The electrode holder has a cross section corresponding essentially to the electrode. An electrode for a spark erosion tool with a cylinder surface or a spherical surface includes a groove connected to a bore. A deflecting bore can be produced in a drill string part using the spark erosion tool. The deflecting bore is curved and connects two straight flushing bores.
US09889513B2	Method for dressing a honing tool and method for honing a toothed wheel A method for dressing a honing tool using a dressing tool which during the dressing operation rolls at an axial intersection angle with the honing tool. The teeth thereof which move into engagement with the teeth of the dressing tool each have an upper face which is to be dressed and tooth flanks which are also to be dressed.
US09889512B2	Peripheral clamping mini-blade for a superficial roughing down and mounting adapter device The present invention refers to a mini-blade (1) which body (2) has an inner edge (4) in which there is, at least, one transversal tab (6) that constitutes a retention means of the mini-blade (1) in an adapter device (20); between the inner (4) and the external (3) edges, the body (2) has the sufficient extension to form clamping portions (7)(8) that allow the application of clamping peripheral tabs (30). The invention also refers to an adapter device (20) that, for the mounting of a rotary work structure (40) of pneumatic roughing down, includes clamping sets (20) composed of ending supports (21)(22) and intermediary separator supports (23), all of which have clamping transversal peripheral tabs (30) that form jaws capable of clamping the clamping positions (7)(8) of the mini-blade (1). The different supports (21)(22)(23) that form the clamping sets (20) are arranged attached one to another, in train, with the mini-blades (1) interspersed in their jaws, in such a way that the toothed external edge (3) of these last ones protrudes from the clamping set (20).
US09889511B2	Cutting insert, cutting tool, and method of producing machined product using the same A cutting insert comprises a first surface sequentially including a first and second inclined surface. The first inclined surface is inclined toward the second surface, going inward from the edge at a first inclined angle on a basis of a perpendicular plane perpendicular to a central axis extending between the first surface and a second surface. The second inclined surface, located more inward than the first inclined surface, is inclined toward the second surface at a second inclined angle different from the first inclined angle on the basis of the perpendicular plane. An intersecting part of the first inclined surface and the second inclined surface includes a first part located at a highest position in a region of the intersecting part along the second side surface. A cutting tool with the cutting insert, and a method of producing a machined product using the cutting tool are provided.
US09889510B2	Variable rake fatigue enhancing orbital drilling cutter Within examples, systems and methods for forming a hole through at least one layer of a material are provided. An example cutting tool for forming such a hole may include a body, and a first portion of the body having a first diameter and a first radial rake angle. The cutting tool also includes a second portion of the body adjacent the first portion, the second portion having a second diameter and a second radial rake angle, wherein the second diameter is different than the first diameter, and wherein the second radial rake angle is different than the first radial rake angle.
US09889507B2	Pre-stressing damping system A tool holder having a tool receptacle for chucking a tool shaft by frictional engagement, in which the tool receptacle comprises a plurality of annular clamping surfaces spaced apart from one another, which are intended for retaining the tool shaft by nonpositive engagement and are embodied on the inner circumference of a tube part, and the tube part has a recess in the material for varying its clamping action; the recess in the material is embodied by a plurality of annular channels extending in the circumferential direction, which are each separated from the tool receptacle by a resilient wall portion, which on its side facing away from the channel embodies the respective clamping surface.
US09889505B2	Mounting device for cutting tool, tool body and cutting tool A cutting insert mounting system adapted for a cutting tool in which, by using a tightening screw, a cutting insert is detachably mounted on an insert mounting seat. A central axis of a screw hole of the insert mounting seat is inclined with respect to a normal direction of a bottom wall surface of the insert mounting seat. When the cutting insert is placed on the insert mounting seat, on a virtual plane defined to expand the bottom wall surface, a central axis of the screw hole is shifted from the central axis of a through hole of the cutting insert to the side of one of two side wall surfaces of the insert mounting seat. On the virtual plane, an axis shift direction of the central axis of the screw hole and an inclination direction of the central axis of the screw hole are different.
US09889501B2	Method for producing a turbocharger housing A method produces a casting, in particular a housing of a turbocharger, wherein at least one mold part for forming the casting has a respective parting plane which is arranged at a predetermined angle with respect to the longitudinal axis of the casting, and wherein at least one core element is provided.
US09889496B2	Method for manufacturing metal fitting, method for manufacturing spark plug, and method for manufacturing sensor A method of manufacturing a metal fitting having a tool engagement portion engageable with a tool. The manufacturing method includes a cold forging process, wherein the cold forging process includes: a step (a) of forming a body portion having a first maximum length and a butt portion being continuous to the body portion and having a second maximum length larger than the first maximum length; and a step (b) of drawing at least a part of the butt portion in the axis direction, thereby forming the tool engagement portion.
US09889494B2	Press forming method for a semi-solid metal material and press forming system for a semi-solid metal material Provided is a press forming method for a semi-solid metal material, including: manufacturing a semi-solid metal material in a container having an upward opening by injecting molten metal into the container, and cooling the molten metal while stirring the molten metal; inverting the container and storing the semi-solid metal material in a temporary storage space; discharging a liquid phase part from the semi-solid metal material through the inverting; and pressing the semi-solid metal material by feeding the semi-solid metal material, from which the liquid phase part is discharged, into dies of a pressing machine.
US09889488B2	Peening device and peening method A peening device is provided with: peening impact pins that impact on a surface to be worked; a device main body that uses vibration to move the peening impact pins back and forth with respect to the surface to be worked; servo motors (22x, 22y) that adjust the inclination of the device main body with respect to the surface to be worked; laser displacement gauges (20A, 20B, 20C, 20D) that detect the device angle; and a vibration sensor (18) that detects the vibration state of the device main body. Furthermore, a control device (40) for the peening device controls the servo motors (22x, 22y) such that the vibration state detected by the vibration sensor (18) is a predetermined vibration state. Thus, the peening device carries out excellent peening by conforming to the surface to be worked, the shape of which changes from moment to moment because of the peening.
US09889487B2	Method for stent shaping An apparatus for crimping a radially expandable stent includes a pressure vessel, shaping balloon, and mandrel. The mandrel is configured to slidingly receive a stent thereon, and to be slidingly advanced into the pressure vessel. The shaping balloon is inflated to radially compress the stent onto the form of the mandrel; such compression need not be uniform. Pressurization of the shaping balloon facilitates the expansion of the balloon to achieve compression of the stent, with depressurization of the shaping balloon causing the balloon to return to an unexpanded state.
US09889484B2	Rub rail repair tool and method A rub rail repair tool includes a tool engaging element disposed on one longitudinal side of a flange. A working element is disposed on the other longitudinal side of the flange. The working element is shaped to define a maximum diameter dimension and a minimum diameter dimension. The maximum diameter dimension is substantially equal to a distance between an undamaged rub rail affixed to a lateral edge of a truck bed frame. At least one tool engaging feature is formed in the tool engaging element. The tool engaging feature enables coupling of a torque arm to the tool engaging element to enable rotation thereof about a longitudinal axis thereof by applying force to the torque arm.
US09889483B1	Paintless vehicle dent repair tool A paintless vehicle dent repair tool for repairing dents, such as dents caused by hail damage, in the top of a vehicle. The repair tool includes an elongated, annular shaped, tool body. The tool body includes a concave, wedge-shaped end portion for engaging and removing glue from a dent and a hollow opposite end portion. The hollow opposite end portion is used for holding a removable spray bottle of alcohol. A spray of alcohol is used for helping release dried glue from a raised dent on a vehicle.
US09889478B2	Consumable descaling cartridges for a refrigerator appliance A method of descaling a water dispensing system included in a refrigerator appliance with a water dispenser is disclosed. The method of descaling includes the step of removing a water filter cartridge from a filter port of the refrigerator appliance wherein the filter port is in fluid communication with the water dispenser. The method also includes the step of inserting a descaling cartridge containing descaling fluid into the filter port of the refrigerator appliance. The method further includes the step of advancing the descaling fluid from the descaling cartridge through the water dispenser.
US09889470B2	Processes for coating the interior surfaces of nonmetal pipes Methods and systems for providing cleaning and providing barrier coatings to interior wall surfaces of small diameter nonmetal and composite piping systems in buildings, swimming pools, underground pipes, in-slab piping systems, piping under driveways and various liquid transmission lines. An entire piping system can be cleaned in one single pass by dry particulates forced by air throughout the building piping system by an external generator, and the entire piping system can be coated in one single pass by a machine connected exterior to the piping system. Small pipes can be protected by the effects of water corrosion, erosion and electrolysis, extending the life of piping systems such as plastics, PVC (polyvinyl chloride), composite materials, polybutylene. Coatings can be applied to pipes having diameters of approximately ⅜″ up to approximately 6″ so that entire piping systems such as potable water lines, natural gas lines, HVAC piping systems, drain lines, and fire sprinkler systems in single-family homes to apartments to high-rise hotel/resort facilities and office towers, apartment and condominium buildings and schools, can be cleaned and coated to pipes within existing walls. The coating forms at least a 4 mils or greater covering inside of pipes. Buildings can return to service within approximately 24 to approximately 96 hours.
US09889469B2	Process for coating the interior surfaces of pipes made of nonmetal materials Methods and systems for cleaning, coating and sealing leaks in existing pipes made of nonmetal materials selected from a nonmetal material selected from at least one of plastics, PVC (polyvinyl chloride), composite materials, or polybutylene, in a single operation. A piping system can be cleaned in one pass by dry particulates forced and pulled by air throughout the piping system by a generator and a vacuum. Pipes with nonmetal fittings or with metal fittings or pipes with a combination of metal and nonmetal fittings can be protected from wear by water erosion and rupturing, extending the life of pipes made of nonmetal materials selected from at least one of plastics, PVC (polyvinyl chloride), composite materials, or polybutylene. Coatings can be applied to pipes having diameters up to approximately 6″. Leak sealants of at least approximately 4 mils thick can cover insides of pipes, and can include novel mixtures of fillers and epoxy materials, and viscosity levels. A positive pressure can be maintained within the nonmetal pipes during applications. Piping systems can be returned to service within approximately 96 hours.
US09889465B2	Dispensing apparatus A discharging device simultaneously delivers at least two flowable components of a multi-component compound from different storage volumes. The discharging device includes at least two pistons which are movable along an extension direction thereof to deliver the components from the at least two storage volumes, and an advancing unit for moving the pistons along the extension direction thereof. The advancing unit has at least one energy storage element, which is provided for supplying a force for moving the pistons and at least one release element, which is provided for releasing the movement of the pistons by the at least one storage element.
US09889460B2	Continuous vertical spraying of bodies such as cans A vertical internal coating machine is taught, which may be used with bodies such as cans (2 piece, 3 piece, draw, redraw,) and including cylinders, containers and any similar body. In the machine cans or similar bodies are vertical in the machine's star wheel rather than horizontal, and the bodies are sprayed with the star wheel in continuous motion without stopping and starting. The machine teaches that a plurality of spray guns may be provided for each pocket of the star wheel. By means of the machine an improved line layout is devised which may eliminate the need to raise the bodies immediately prior to a necker by allowing the vertical can internal coating machine and internal bake over to be disposed on any level of the facility, upper, lower, mezzanine, etc. In green aspects, the machine may use negative pressure cabinets/hoods and positive pressure tunnels to entrain volatile organic chemicals emitted by the spray guns and coated bodies and may send these VOCs to a VOC desctruction device, such as an oven.
US09889458B2	Sprinkler assembly The present invention includes an improved sprinkler design having a magnetic sensing system for determining the position of the riser nozzle, a waterproofed motor housing and related cables, configurable sprinkler body compartments, and a pilot valve with a check valve assembly, both of which are located within the sprinkler body.
US09889453B2	Centrifugal separation apparatus having a plurality of separators arranged and moveable in a base and centrifugal separation method A centrifugal separation apparatus includes a plurality of centrifugal separators each comprising a rotator which supports a plurality of sample containers containing a sample therein, a base in which the centrifugal separators are arranged in columns and stages and a route is defined therein, the centrifugal separators being movable inside the base, and a movement mechanism that sequentially move the centrifugal separators along the route in the base.
US09889452B2	Methods for facilitating mineral extraction There is provided methods for separating a target material from a raw material by mixing the raw material with water to form a slurry, adding a collector compound to the slurry to modify a relative hydrophobicity of a surface of the target material, adding a facilitator compound to enhance the modification of the relative hydrophobicity of the surface, and forming a froth including a concentrate of the target material. Disclosed methods may also include adding a facilitator compound to a raw material slurry that has been treated with a collector compound and a reagent for neutralizing the collector compound.
US09889442B2	Reagent preparation and dispensing device A reagent preparation and dispensing device includes a body having a reaction chamber for a reagent and a solution reservoir for a solution. The solution reservoir is isolated from the reaction chamber. A plunger is movably coupled with the body. Movement of the plunger from a starting position to a seated position pushes the solution into the reaction chamber. A dispensing path extends from the reaction chamber out of the body. The dispensing path is configured to dispense a reagent mixture formed from the solution and the reagent. A vent path extends from the reaction chamber, the vent path vents reaction chamber gas displaced by the addition of the solution to the reaction chamber throughout movement of the plunger from the starting position to the seated position.
US09889440B2	Method for synthesizing silicoaluminophosphate-34 molecular sieves A method for synthesizing small crystals of silicoaluminophosphate-34 (SAPO-34) molecular sieves with high structural purity. The method includes forming a first slurry and a second slurry which are aged separately to form a first aged slurry and a second aged slurry. The first slurry includes a first source of phosphorus, a first source of aluminium, a first source of silicon, and at least one first organic structure directing agent. The second slurry includes a second source of phosphorus, a second source of aluminium, a second source of silicon, and at least one second organic structure directing agent. Then, the first aged slurry and the second aged slurry are combined to form a mixture of aged slurries. Finally, crystallization of silicoaluminophosphate molecular sieves comprising the SAPO-34 molecular sieves is induced from the mixture of aged slurries.
US09889439B2	High light received heavy oil catalytic cracking catalyst and preparation method therefor The present invention relates to a heavy oil catalytic cracking catalyst having a high yield of light oil and preparation methods thereof. The catalyst comprises 2 to 50% by weight of a magnesium-modified ultra-stable rare earth type Y molecular sieve, 0.5 to 30% by weight of one or more other molecular sieves, 0.5 to 70% by weight of clay, 1.0 to 65% by weight of high-temperature-resistant inorganic oxides, and 0.01 to 12.5% by weight of rare earth oxide. The magnesium-modified ultra-stable rare earth type Y molecular sieve is obtained by the following manner: the raw material, a NaY molecular sieve, is subjected to a rare earth exchange, a dispersing pre-exchange, a magnesium salt exchange modification, an ammonium salt exchange for sodium reduction, a second exchange and a second calcination. The catalyst provided in the present invention is characteristic in its high conversion capacity of heavy oil and a high yield of light oil.
US09889437B2	Isomorphously substituted catalyst Described is a selective catalytic reduction catalyst comprising a zeolitic framework material of silicon and aluminum atoms, wherein a fraction of the silicon atoms are isomorphously substituted with a tetravalent metal. The catalyst can include a promoter metal such that the catalyst effectively promotes the reaction of ammonia with nitrogen oxides to form nitrogen and H2O selectively over a temperature range of 150 to 650° C. A method for selectively reducing nitrogen oxides and an exhaust gas treatment system are also described.
US09889428B2	Ceria zirconia alumina composition with enhanced thermal stability A process for the preparation of a calcined mixed oxide comprising Al-, Ce- and Zr-oxides, comprising the steps of providing an aqueous slurry comprising hydroxides of cerium and zirconium, contacting the hydroxides of cerium and zirconium with an alumina precursor to obtain an aqueous suspension of solids, isolating the solids from the aqueous suspension and drying to obtain a solid composition, calcining the solid composition of step (c) at a temperature from 450° C. to 1200° C. for at least 1 hour to obtain a calcined mixed oxide.
US09889425B2	Porous adsorbent for trapping radioactive iodine gas and method of manufacturing the same Provided are an adsorbent for trapping a radioactive iodine gas generated in a process of oxidizing a nuclear fuel at a high temperature after use and a method of preparing the same, and more particularly, a radioactive iodine gas adsorbent which is formed of bismuth as a main component, thereby exhibiting an excellent radioactive iodine gas trapping capability and an excellent thermal stability after trapping, and a method of preparing the same.An adsorbent for trapping a radioactive iodine gas prepared by a method of preparing an adsorbent for trapping a radioactive iodine gas according to the present disclosure may effectively trap a radioactive iodine off-gas generated in a nuclear fuel pre-treated oxidizing process after use.Particularly, the adsorbent may trap iodine in a larger amount, which is twice or more, than a silver-containing zeolite widely used to trap a radioactive iodine gas, and the trapped iodine forms a stable compound, which is more advantageous for long-term storage.In addition, since an iodine gas is trapped using inexpensive bismuth, instead of expensive silver, in consideration of trapping a large amount of a radioactive iodine gas, the adsorbent has very excellent economic feasibility.
US09889420B2	Fluid injection nozzle for fluid bed reactors A feed injector for a circulating fluid bed reactor is fitted with a discharge nozzle with a circular, radially notched discharge orifice to improve the surface-to-volume ratio of the spray pattern formed by the nozzle. The feed injector is useful for injecting fluids into various types of circulating fluid bed reactors in which good contact between the components of the fluidized bed and the injected fluid is required. It is particularly useful in fluid coking reactors.
US09889418B2	Fluidized fuel gas combustor system for a catalytic dehydrogenation process A fluidized fuel gas combustor system for a catalytic dehydrogenation process comprising a vessel having a lower portion and an upper portion; a plurality of air injection diffusers located in the lower portion of the vessel; a plurality of fuel gas injection diffusers located on fuel gas distributors disposed in the vessel and spaced apart from and above a plurality of air injection diffusers, wherein the fuel gas diffusers are placed in a manner to maximize even mass distribution of a fuel gas injected through the fuel gas diffusers in the vessel, wherein each fuel distributor comprises a tube having a plurality of fuel gas injection diffusers; and one or more grid assemblies disposed in the vessel spaced above the fuel gas distributors is provided.
US09889416B2	Composition comprising HF, 3,3,3-trifluoro-2-chloropropene, and E-3,3,3-trifluoro-1-chloropropene An azeotropic or quasi-azeotropic composition including hydrogen fluoride, 3,3,3-trifluoro-2-chloropropene and one or more (hydro)halogen-carbon compounds including between 1 and 3 carbon atoms. Also an azeotropic or quasi-azeotropic composition including hydrogen fluoride, 3,3,3-trifluoro-2-chloropropene, and one or more compounds selected from among 1,3,3,3-tetrafluoropropene, 1,1,1,2,2-pentafluoropropane, 2,3,3,3-tetrafluoropropene, 3,3,3-trifluoropropene, E-3,3,3-trifluoro-1-chloropropene, trifluoropropyne, 1,1,3,3-pentafluoropropane, 1,1,1,3,3-pentafluoropropane, 1,1,1,3,3-pentafluoropropene, 1,1,1,2,3-pentafluoropropene and 2-chloro,1,1,1,2-1 tetrafluoropropane.
US09889411B2	Nonwoven fabric for semipermeable membrane support Provided is a nonwoven fabric for semipermeable membrane support, in which adhesiveness of a semipermeable membrane to a support is satisfactory, the thickness uniformity of the semipermeable membrane is satisfactory, and permeation-through of a coating liquid does not occur. Disclosed is a nonwoven fabric for semipermeable membrane support, in which when a region extending from the semipermeable membrane-coated side surface of the nonwoven fabric to a predetermined portion of the total basis weight in the thickness direction is designated as a coated layer region, a region extending from the non-semipermeable membrane-coated surface of the nonwoven fabric to a predetermined portion of the total basis weight in the thickness direction is designated as a non-coated layer region, and a region obtained by excluding the respective predetermined portions of the total basis weight in the thickness direction from both the semipermeable membrane-coated side surface and the non-semipermeable membrane-coated surface of the nonwoven fabric is designated as a middle layer region, the pressure drop per unit basis weight of the middle layer region after the exclusion is lower than the pressure drop per unit basis weight of the coated layer region and the pressure drop per unit basis weight of the non-coated layer region, and the pressure drop per unit basis weight of the middle layer region after the exclusion is in the range of 10% to 70% relative to the pressure drop per unit basis weight of the nonwoven fabric before the exclusion. The predetermined portion is defined to be about 25%.
US09889410B2	Tubular braid, hollow fiber membrane using the same, and manufacturing method thereof A tubular braid, a hollow fiber membrane using the same, and a manufacturing method thereof. A hollow fiber membrane can maximize or increase adhesion between a polymer coating film and a tubular braid; significantly reduce degradation of film properties caused by non-uniform coating, that is, reduce leakage; obtain a higher percent rejection; and achieve high water permeability since the hollow fiber membrane has a larger inner diameter.
US09889407B2	Device suitable for treatment of a fluid as well as a method and machine suitable for the manufacture of such a device A device, which is suitable for the processing of at least one fluid, is provided with at least one elongated foil, which is formed in a number of reciprocating foil layers. Between two opposite layers of foil, a spacer is situated that is permeable at least parallel to the foil layers. The foil layers and interposed spacers extend spirally around a central axis, wherein folding lines between two foil layers extend substantially parallel to the central axis. Each spacer is coupled to at least an end near the central axis with a support extending parallel to the central axis where, of the supports near the central axis, first supports are situated between two foil layers, which foil layers are connected to one another near the central axis, whereas second supports are situated between two successive first supports.
US09889406B2	Exhaust gas purification apparatus for internal combustion engine An apparatus may have a selective catalytic reduction NOx catalyst including a high-temperature catalyst layer having high capability of reducing NOx at high temperatures and a low-temperature catalyst layer having higher capability of reducing NOx at low temperatures than that of the high-temperature catalyst layer. The low-temperature catalyst layer may be arranged closer to a catalyst substrate than the high-temperature catalyst layer. A supply valve may add an addition quantity of reducing agent for reducing NOx to exhaust gas flowing into the selective catalytic reduction NOx catalyst. A controller may comprise at least one processor configured to control addition of the reducing agent by the supply valve such that the reducing agent concentration in a reducing agent atmosphere formed in the exhaust gas flowing into the selective catalytic reduction NOx catalyst is higher when the temperature of the selective catalytic reduction NOx catalyst is in a specific low temperature range.
US09889404B2	Process for capturing a heavy metal contained in a moist gas, integrating a heat pump to heat the gas introduced into a capture mass Capturing at least one heavy metal, from mercury and arsenic, contained in a moist gas comprising water vapor, by the following steps: a) heating the moist gas by heat exchange with a compressed heat transfer fluid obtained in step e) in order to obtain a condensed heat transfer fluid and a gas reheated to a temperature Tc; b) bringing the reheated gas into contact with a heavy metal capture mass in order to obtain a gas depleted in heavy metal; c) decompressing the cooled heat transfer fluid; d) cooling the gas depleted in heavy metal by heat exchange with the heat transfer fluid produced in step c) in order to obtain a cooled gas at a temperature Tf, the heat transfer fluid being vaporized; e) compressing the vaporized heat transfer fluid in a manner such as to obtain a compressed heat transfer fluid, the compressed heat transfer fluid being recycled.
US09889397B2	Air passage device An air passage device for installation into a mounting opening in a wall of a housing for components generating waste heat, such as a switching box, has a base housing with a fan support for a fan and a design cover with a fan grid having sheet elements. At least one swivellable sheet element or at least one flexible, tongue-shaped side wall section, separated from the remaining side wall surface of the side walls of the design cover by slits running transversely to the longitudinal direction of the side wall, is formed in the region of the upper side wall of the design cover facing away from the swivel axis for swivelling the design cover. The sheet element and the tongue-shaped side wall section are constructed as a detachable and lockable detent connection, able to be actuated by a finger, between the design cover and the base housing.
US09889396B2	Geosynthetic composite for filtration and drainage of fine-grained geomaterials A geocomposite with a geonet and a geotextile. The geotextile has a nonwoven fabric layer and a woven fabric layer, with the nonwoven fabric connected by needle-punching to the woven fabric whereby fibers of the nonwoven fabric extend through and beyond the woven fabric, and the woven fabric and fibers of the nonwoven fabric extending through the woven fabric are bonded to one side of the geonet.
US09889393B2	Filtration apparatus A plurality of hollow filter sheets have a suction pipe inserted therethrough to be stacked with a ring-shaped packing clamped therebetween. Therefore, a gap between the hollow filter sheet and the suction pipe is watertightly sealed. In the hollow filter sheet, a hollow portion is provided between two filters, and then a spacer with a surface having pits and projections is provided in the hollow portion. A narrow passage space allowing liquid to pass through is provided between the filter and the spacer by pressing the two filters against surfaces of the spacer with the packings and causing the filters to be deformed into a shape according to the surfaces of the spacer. The narrow passage space is smaller than a drainage space between the filters and the spacer that are not clamped by the packings.
US09889392B2	Grease separator A grease separator incorporating a vessel having an upper opening and an interior space, the vessel further having a floor, a front wall, a rear wall, a left wall, and a right wall; a water ejection port positioned at the front wall; left and right flow ports respectively positioned at the left and right walls; a separator baffle and a damping baffle; slide channels adapted for alternatively positioning the separator baffle at the left and right ends of the vessel's interior, the slide channels being further adapted for positioning the damping baffle oppositely from the separator baffle; and a submersible pump having a water intake port positioned at the lower end of the vessel's interior, the submersible pump having an output communicating with the water ejection port.
US09889389B2	Rotary evaporator A rotary evaporator is provided. The rotary evaporator includes a rotary drive and a piston support (11) for an evaporator piston which can be coupled to the rotary drive. The piston support (11) comprises two transverse carriers (19, 21) for supporting the evaporator piston at two support regions spaced apart from one another and a longitudinal guide (25) having a guide element (27), on which longitudinal guide the two transverse carriers (19, 21) are moveably arranged in order to vary the mutual spacing of the two transverse carriers (19, 21). The guide element (27) is displaceably guided in the longitudinal direction (23) in order to displace the evaporator piston between a coupling position with the rotary drive and a position spaced back from the rotary drive.
US09889384B2	Controller device and controller system An example terminal device includes a generally plate-shaped housing, an LCD provided on the front side of the housing, analog sticks, and first and second buttons. The analog sticks are provided respectively in left and right portions of the LCD above the center of the housing. The first and second buttons are provided on the back side of the housing so as to generally correspond to the analog sticks on the front side of the housing.
US09889380B1	Adjusting individualized content made available to users of an online game based on user gameplay information This disclosure relates to adjusting individualized content made available to users of an online game based on user gameplay information. In implementations, information relating to prospective usage of the online game is used to classify users according by user type, and content made available to the users is customized accordingly. Information relating to prospective usage may include predictive information such as demographic and geographic information, as well as game usage information for the users. User types may include resource collection, player versus player, and player versus environment. Customized content may include content made available to the users through the users in-game actions, such as exploring a map, researching a technology or skill, purchasing an in-game item, and completing an in-game achievement, including in-game items, in-game powers, in-game skills, in-game technologies, in-game pets, in-game transportation units, in-game units, and in-game buildings.
US09889379B2	Information processing system, information processing device, storing medium, and display method An example information processing system includes a display controller configured to display a screen that includes a plurality of subjects and at least one content generated by a user, the at least one content satisfying a predetermined timing condition for each subject in a display, at least one content for a subject being included in a plurality of contents posted with regard to the subject.
US09889373B1	Multilayer framework and architecture with variable video gaming capabilities A multilayer framework and architecture with variable video or digital gaming capabilities provides multiple levels of play, permitting players to engage in different ways. The different levels of play options include 1) a peer-to-peer competitive challenge level for “core” players, 2) a “follower” play option for players with restricted capabilities and access to portions of a game; and a 3) “bystander” play option that permits non-players in a network to either observe or play from a reactive perspective.
US09889371B1	Bet spot indicator on a gaming table The invention generally pertains to a system and method for determining if a player has placed a bet in a bet spot on a gaming table, such as, for example, a main bet spot or a progressive or proposition bet spot. By way of example, the tabletop of a gaming table has a plurality of player positions having one or more bet spots positioned in proximity to each player position on the top surface. The tabletop has a light sensor associated with each bet spot and positioned beneath the gaming table layout to detect light intensity through the layout. A plurality of light emitting diodes (LEDs) are associated with each light sensor. The plurality of LEDs are located beneath the gaming table layout so as to illuminate through the material of the gaming table layout. More specifically, the LEDs are configured to illuminate through the layout when a gaming chip is detected in the bet spot, which causes a change in the light intensity detected by the light sensor associated with the bet spot because the bet spot is covered by a gaming chip.
US09889360B1	Baseball swing training apparatus A swing training apparatus for baseball or softball that suspends or propels a tethered ball to be hit by a batter. The apparatus includes two elongated vertically spaced apart cords disposed, one above the other, connected at opposed ends to vertical upright members to extend therebetween relative to a horizontal axis in a taut tightly stretched or drawn condition. One or both cords may be formed of elastic material and may extend between the uprights generally parallel to, or slightly angularly relative to, the horizontal axis. A ball trolley with a practice ball is movably supported vertically between the two elongate cords. The ball trolley includes two pulleys, each mounted on a respective elongate cord in vertically opposed relation, and a practice ball is captured between and attached to the pulleys.
US09889358B2	Systems and methods utilizing a ball including one or more sensors to improve pitching performance A ball, and in particular a baseball or softball, including one or more sensors such as accelerometers and/or inertial measurement units, and systems and methods using the same to improve a pitcher's pitching performance are described herein. In some embodiments, the ball may include one or more inertial measurement units and/or accelerometers capable of monitoring motion of the ball while it is thrown. Various types of pitches may be selected, and in response to the inertial measurement unit(s) and/or accelerometer(s) detecting certain parameters corresponding to a selected pitch, one or more indicators may be caused to perform an action. For example, one or more illuminating elements located on the ball may turn a first color in response to detecting parameters corresponding to the selected pitch.
US09889353B2	Groove pattern for a putter head A putter head is provided. The putter head includes a putter face defining a groove pattern extending in a heel-to-toe direction of the putter face. The groove pattern includes multiple sets of grooves spaced apart from one another in a vertical direction of the putter face. The sets of grooves have different cross-sectional configurations to adjust a launch angle of a golf ball based on an impact location of the golf ball along the vertical direction of the putter face.
US09889350B2	Golf club head A golf club head includes: a sole; a crown; a toe; a heel opposite the toe; a strike face generally bounded by a face perimeter edge, the strike face comprising a geometric center; a rear portion; and a substantially enclosed interior cavity at least partially delimited by the sole, the crown, the strike face, and the rear portion. The golf club head also includes at least one rib having a first portion secured to the strike face, having a second portion secured to the crown, and being positioned such that a location on the strike face laterally spaced toe-ward from the geometric center by no less than 0.4 in is associated with a COR value no less than 0.825.
US09889348B2	Golf club head Provided is a golf club head which produces an improved hitting sound obtained without impairing the appearance of the sole section. A golf club head having a hollow portion (i) formed therein has a sole portion (5) which forms the bottom surface of the head. The sole portion (5) includes a thin-wall portion (8) and a thick-wall portion (9) which has a greater thickness than the thin-wall portion (8). The golf club head is characterized in that a portion of the inner surface of the thick-wall portion (9), the portion facing the hollow section, has a rib (10) secured to the portion by welding.
US09889346B2	Golf club head or other ball striking device having impact-influencing body features A ball striking device, such as a golf club head, has a face with a striking surface configured for striking a ball and a channel extending across a portion of the sole. The channel may be recessed from the sole and have a depth, wherein the channel comprises a center portion extending across a center of the sole, a heel portion extending from a heel end of the center portion toward the heel, and a toe portion extending from a toe end of the center portion toward the toe. The channel may have a width defined between a front edge and a rear edge, and a cross-sectional shape, wherein the cross-sectional shape of the center portion of the channel is substantially semi-circular, and wherein the cross-sectional shape of the channel is different at the heel and toe portions than at the center portion.
US09889345B2	Disc retriever A disc retriever includes an extendable, telescoping pole and a rigid hook configured to interface with various types of disc golf discs and secure a disc within the retriever by reaching across and/or under the disc, receiving the disc into an opening of the hook, and retaining the disc golf disc within the opening of the hook by at least one of gravity, pressure, and/or friction while the pole is pulled and/or manipulated by a user to retrieve the disc golf disc from the unreachable area.
US09889344B1	Instrumented sports paraphernalia system A system for measuring and displaying the pressure of conventional American-style footballs in real time to game officials and spectators continuously. The value of the football's pressure is measured by physical contact with a Durometer and calculated using a CPU configured with software. Game officials may view the football's pressure locally. A transceiver device continuously transmits the value of the football's pressure, ID, time and date to remote receivers where game officials and spectators may continuously monitor the football's pressure remotely.
US09889343B2	Elastically deformable item of sports equipment comprising a deformable electromagnetic coil structure Embodiments relate to a concept for an elastically deformable item of sports equipment comprising at least one deformable electromagnetic coil structure around a curved surface within the item of sports equipment, such that the at least one electromagnetic coil structure forms a three-dimensional curve having non-vanishing geometric torsion and curvature to provide an elongation reserve related to a maximum deformation of the item of sports equipment.
US09889341B2	Dysphagia rehabilitation mask and dysphagia rehabilitation apparatus using thereof The present description relates to a dysphagia rehabilitation apparatus to help tongue muscle rehabilitation exercise during dysphagia rehabilitation. More particularly, it relates to a device that when a patient wearing the dysphagia rehabilitation device contacts the tongue to a position sensing unit configured on the front of a mask, a sensing single according to a change of a physical value of resistance corresponding to the tongue's touching position from the position sensing unit. Then a control unit of a remote device generates a control signal through the transmitted sensing signal, thereby the remote device controls rehabilitation, games and programs of similar functions thereof and induce patient's interest of rehabilitation. Thus, effect of rehabilitation is improved.
US09889339B2	Exercise device with first and second trampoline mats at different heights A stepping device includes a first step tread at a first step height and defining a first opening, and a first trampoline mat suspended within the first opening. The stepping device also includes a second step tread at a second step height which is spaced apart at a single riser height from the first step height. The second step tread defines a second opening and a second trampoline mat is suspended within the second opening.
US09889338B2	Foam roller tract and stretch device A foam roller exercise device is provided for allowing a user to stretch anatomical muscles and performing traction along a vertebral spine of the user. The foam roller exercise device includes a first large elongated body portion taking a semi-cylindrical shape, forms into two second parallel small elongated semi-cylindrical body portions, both body portions meeting the elongated central inner groove. The user applies a downward pressure with the body onto the device, causing both parallel elongated body portions to open outwardly, thereby carrying the force to stretch onto the user's body.
US09889336B1	Chain wheel locking assembly of an exercise apparatus A chain wheel locking device of an exercise apparatus includes a wheel frame mounted on a main frame of the exercise apparatus, wherein the wheel frame is a U-shaped structure and has two supports corresponding to each other. The exercise apparatus includes a chain wheel axle rotatably extending through a chain wheel and the two supports. The chain wheel axle has two opposite ends each having a locking device mounted thereon for positioning the chain wheel axle and preventing the chain wheel axle from being moved relative to the wheel frame such that a tension of a chain on the chain wheel is maintained to prevent the chain from being detached from the chain wheel.
US09889334B2	Devices and methods for determining the weight of a treadmill user A treadmill may comprise a drive motor positioned and configured to drive a treadbelt, and an electrical current sensor configured to measure the electrical current utilized by the drive motor. The treadmill may also include a computer programmed and configured to analyze the measured electrical current usage by the drive motor to determine the weight of a person positioned on the treadbelt. A person's weight may be determined by driving the treadbelt with the drive motor while a person is positioned on the treadbelt, measuring an electric current utilized by the drive motor, and analyzing the measured electric current to determine the weight of the person positioned on the treadbelt of the treadmill. Additionally, the measured weight may be utilized to calculate calorie expenditure.
US09889333B2	High-incline treadmill A treadmill which utilizes provides for a connection between the floor stand and the treadbase which is toward the front end of the treadbase and provides for generally improved support of the front end of the treadbase at higher angles by providing that the lift mechanism is attached to the treadbase at two fixed points a fixed distance from each other. The lift mechanism then utilizes two different motions, the extension of an extension arm and the rotation of a rigid arm, to produce lift. The rotation of the rigid arm generally utilizes a wheel in an enclosed raceway attached to the floor stand.
US09889331B2	Dumbbell A dumbbell with a selectable number of weight disks includes a handle with pins projectable in opposing directions, a base assembly for accommodating two sets of weight disks standing upright, and having through-going openings. Neighbouring weight disks have mutually cooperating connecting arrangements which axially interconnect the weight disks but which permit radial separation. The projection lengths of the pins are stepwise selectable in order thereby to permit selection of the number of weight disks carried on the handle. The handle has, in opposing ends, connecting arrangements for interconnecting with the connecting arrangements of the innermost weight disks in the base assembly. Further, the space between the connecting arrangements of the handle is free through 360° about the handle throughout its entire length, the openings of the weight disks being centrally located.
US09889329B2	Barbell with reciprocating weight sleeves A free weight barbell with an elongated bar with two rotating weight sleeves and with axially moveable hand grips mounted on the bar located inside the weight sleeves. Each hand grip is attached to the distal end of an elongated rack that extends centrally and longitudinally inside the barbell. The inside ends of the two racks extend to or slightly beyond the bar's center axis. The bar is circular in cross-section and made of solid material with two axially aligned channels formed on opposite sides. The two channels extend from the ends of the lifting bar to a center adapter located over the bar's center axis. The hand grips slide over the ends of the bar and the two racks are inserted into the two opposite channels. The two hand grips and the two racks are coupled to a disc gear that controls the resistance forces exerted on the sliding racks.
US09889327B2	Adjustable bracket and hub for flexible hose support An adjustable bracket includes a first bracket portion with a first leg and a first bar element, a second bracket portion with a second leg and a second bar element, and a hub assembly supported on at least one of the first and second bracket portions. The hub assembly can be configured to couple a flexible hose to the adjustable bracket. The first bar element can be telescopically received by the second bar element so that a distance between the first and second legs is selectively adjustable. A fastener can fix the first and second bar elements in a desired relationship. The hub assembly can include first and second support members that are pivotably connected to rotate between open and closed positions. The second support member may have a slot that allows the second support member to rotate and move laterally with respect to the first support member.
US09889320B2	Beam shaping assembly for neutron capture therapy A beam shaping assembly for neutron capture therapy includes a beam inlet, a target having nuclear reaction with an incident proton beam from the beam inlet to produce neutrons forming a neutron beam defining a main axis, a moderator adjoining to the target, a reflector surrounding the moderator, a thermal neutron absorber adjoining to the moderator, a radiation shield arranged inside the beam shaping assembly and a beam outlet. The neutrons are moderated to epithermal neutron energies. The reflector leads the neutrons deviated from the main axis back, and a gap channel is arranged between the moderator and the reflector. The thermal neutron absorber is used for absorbing thermal neutrons so as to avoid overdosing in superficial normal tissue during therapy. The radiation shield is used for shielding leaking neutrons and photons so as to reduce dose of the normal tissue not exposed to irradiation.
US09889314B2	Color light therapy device Provided is a color light therapy device. The color light therapy device includes: a body that is used by being attached to a color light therapy portion of a human body by using a double-sided adhesive tape, a hydrogel pad, or an air suction plate, and includes a printed circuit board (PCB) that supplies driving power to a light source that emits color light in a given wavelength range to perform color light therapy on the human body; and a power jack that is connected to the PCB of the body through an electric wire. Since a user may use the color light therapy device by connecting the power jack to a mobile phone, a PC, a laptop, a tablet PC, a smartphone, a personal digital assistant (PDA), a vehicle, or a socket at home while carrying the color light therapy device, anyone may conveniently use the color light therapy device to perform color light therapy on the human body without exchanging or charging a battery.
US09889313B2	External defibrillation with automatic post-shock anti-tachycardia (APSAT) pacing based on pre-shock ECG A medical device such as an external defibrillator delivers electrical therapy using a special pulse sequence. The special pulse sequence includes a defibrillation shock that is automatically followed by a quick succession of automatic post-shock anti-tachycardia (APSAT) pacing pulses. Because of the pacing pulses, the defibrillation shock can be of lesser energy than an equivalent defibrillation shock of a larger energy. Accordingly, the external defibrillator can be made physically smaller and weigh less, without sacrificing the therapeutic effect of a larger external defibrillator that would deliver a defibrillation shock of higher energy. As such, the defibrillator is easier to configure for transporting, handling, and even wearing.
US09889312B2	Leadless cardiac stimulation device employing distributed logic Systems and methods involve an intrathoracic cardiac stimulation device operable to provide autonomous cardiac sensing and energy delivery. The cardiac stimulation device includes a housing configured for intrathoracic placement relative to a patient's heart. A fixation arrangement of the housing is configured to affix the housing at an implant location within cardiac tissue or cardiac vasculature. An electrode arrangement supported by the housing is configured to sense cardiac activity and deliver stimulation energy to the cardiac tissue or cardiac vasculature. Energy delivery circuitry in the housing is coupled to the electrode arrangement. Detection circuitry is provided in the housing and coupled to the electrode arrangement. Communications circuitry may optionally be supported by the housing. A controller in the housing coordinates delivery of energy to the cardiac tissue or cardiac vasculature in accordance with an energy delivery protocol appropriate for the implant location.
US09889311B2	Systems, protective casings for smartphones, and associated methods to enhance use of an automated external defibrillator (AED) device Embodiments of the invention include systems, protective casings for smartphones, and associated methods to enhance use of an automated external defibrillator (AED) device before arrival of emergency medical personnel. A system can include a smartphone and a protective casing abuttingly contacting one or more side portions of the smartphone and retaining the smartphone positioned therein. The smartphone can include a defibrillation control module to control defibrillation of a victim of sudden cardiac arrest. The protective casing can include sensors, capacitors, and extendable electrode pads. The protective casing further can include a check module to determine whether the victim's heart rhythm requires an electrical shock to reestablish a normal heart rhythm, a space module to measure presence and amount of preselected materials relatively near the system, and a shock module to activate the one or more capacitors and generate an electrical current to deliver an electrical shock to the victim's chest.
US09889309B2	Method and apparatus for detecting a shock applied to a patient during CPR Method and apparatus for detecting electric energy delivered to the heart of a body when performing defibrillation. The method comprises the steps of applying a defibrillator with electrodes placed on opposite sides of the heart; applying an apparatus on the body and between said electrodes for detecting and measuring electric and/or magnetic fields; performing defibrillation by delivering electric energy to the body; detecting electric energy running through the heart with said apparatus, and indicating electric energy applied to the heart. The apparatus for performing the method comprises detection and indications means for performing the method.
US09889307B2	Interleaving power and data in a transcutaneous communications link The present invention is related to an implantable medical device. The medical device comprises an implantable component having a receiver unit; an external charging module having a power transmitter unit; and a data module having a data transmitter unit. The units are configured to establish a transcutaneous communication link over which data and power is transmitted on a single frequency channel via a time interleaving scheme comprising successive frames each divided into at least two time slots, and wherein one or more of the time slots in each frame is allocated to the data transmitter unit, and wherein one or more of the time slots in each frame is allocated to the power transmitter unit, and wherein data and power are transmitted by the transmitter units during their allotted time slots.
US09889300B2	Cochlear implant system including an implantable battery An exemplary cochlear implant system includes 1) a cochlear implant configured to be implanted within a patient, 2) a sound processor configured to be located external to the patient and to direct the cochlear implant to apply electrical stimulation representative of one or more audio signals to the patient, and 3) an implantable battery configured to be implanted within the patient and to provide operating power for the cochlear implant. Corresponding systems and methods are also disclosed.
US09889299B2	Transvenous method of treating sleep apnea A system and method for treating sleep apnea includes inserting an implantable pulse generator subcutaneously within a body of a patient and connecting a lead to the pulse generator. The lead is inserted within the vasculature and advanced transvenously through the vasculature until a stimulation portion of the lead becomes positioned in close proximity to the hypoglossal nerve. A nerve-stimulation signal is applied to the hypoglossal nerve via the stimulation portion of the lead.
US09889296B2	Signal adjustment for electrotherapy Battery-driven stimulators for electrotherapy usually equip with a small battery to generate specified current waveforms applied to human body for stimulation. Such current waveforms can easily get into a saturated status due to high bio-impedance and low battery power. The present disclosure provides a system in which the waveform is adjusted according to feedbacks taken from a patient to reduce or avoid saturation.
US09889293B2	Implantable medical lead for stimulation of multiple nerves In various examples, an apparatus includes a stimulation lead including an elongate body including a distal end and a proximal end. At least one first electrode is disposed proximate the distal end of the elongate body and is configured to stimulate a first target nerve. At least one second electrode is disposed between the at least one first electrode and the proximal end of the elongate body and is configured to stimulate a second target nerve. At least one first fixation structure is disposed between the at least one second electrode and the proximal end of the elongate body. The at least one first fixation structure is configured to anchor the stimulation lead proximate the sacrum, wherein the at least one first fixation structure is located on the elongate body and spaced a first distance proximally along the elongate body from the at least one first electrode.
US09889290B2	Electrode system for electrical stimulation A system for electrically stimulating and/or detecting bioelectrical signals of a user comprising: an array of permeable bodies configured to absorb a solution that facilitates electrical coupling with a body region of the user; a housing defining an array of protrusions conforming to the body region and comprising: an array of channels distributed across the array of protrusions, each channel at least partially surrounding a permeable body, configured to deliver the solution to the permeable body, and comprising a barrier that prevents passage of the permeable body past the barrier, and a manifold configured to distribute the solution to the array of channels; and a coupling subsystem comprising a first electrical coupling region in electrical communication with an interior of the manifold, wherein the first electrical coupling region is configured to couple to a second electrical coupling region that couples the first electrical coupling region to the electronics subsystem.
US09889286B2	Fiducial deployment mechanisms, and related methods of use A medical device that may include an elongate member having a proximal end and a distal end, and a lumen disposed through the elongate member is disclosed. The medical device may also include an opening disposed at the distal end of the elongate member in communication with the lumen, and a pushing element disposed with the lumen. The medical device may also include at least one fiducial disposed within the lumen and distal to the pushing element, and a separating mechanism disposed at the distal end of the elongate member. The separating mechanism may be configured to apply a separating force to deploy the at least one fiducial.
US09889281B2	Cell encapsulation loading device The present invention provides a loading fixture for loading cells, cell clusters, and media to an immune-isolation device. The loading fixture permits the loading of cells into the immune-isolation device without manual manipulation of the immune-isolation device, until the loading device is opened at the point of use, thereby minimizing the risk of contamination of the immune-isolation device.
US09889280B2	Rectal catheter configured for pediatric care A rectal catheter is configured for improved pediatric care. The catheter includes a member that terminates into a rounded tip, a plug mounted about the member, the plug being made of a moldable material, a balloon mounted about the member between the rounded tip and the plug, a conduit that fluidly communicates with the balloon and that extends from the member to enable a pressure source to be operatively connected to the balloon to inflate the balloon, and a pressure relief valve operatively connected to the conduit, the pressure relief valve being configured to open the conduit to atmosphere pressure in response to a pressure in the conduit reaching a predetermined pressure. The predetermined pressure is selected to attenuate significantly risk of bowel perforation in pediatric patients.
US09889279B2	Vascular medical devices with sealing elements and procedures for the treatment of isolated vessel sections Devices for the isolation of a selected portion of a vessel are described. In some embodiments, the device has an introducer sheath and a sealing catheter that are movable relative to each other to create an isolated volume with adjustable size and location. The methods for the treatment of vascular aneurysms using the devices are described. The treatment is achieved through the delivery of an effective amount of stabilization agent to an isolated volume that encompass the aneurysm. The device optionally has an aspiration device to improve the effectives of the treatment.
US09889277B2	Tubing assembly and signal generator placement control device and method for use with catheter guidance systems A tubing assembly having a signal generator placement control device for use in conjunction with electronic catheter guidance systems. The control device facilitates control of the position the guidance systems' signal generator relative to the end of the tubing assembly. The tubing assembly includes a tubular insulator coupled to one end of the control device, and the tubing assembly includes a tubular connector attached to the other end of control device. Also, the tubing assembly includes a catheter attached to the tubular connector and an end member attached to the catheter.
US09889271B2	System, apparatus and method for treating sleep disorder symptoms A system, apparatus and method for treating or lessening sleep disorder symptoms. The system comprising a mask configured to establish a snug fit against a user's eyes and a device including a data management system and a user interface, wherein the device is coupled to the mask. The mask includes a printed circuit board, an accelerometer, one or more therapy lights, one or more electrodes, a pulse oximeter, and a thermometer, wherein the pulse oximeter, thermometer, accelerometer, and electrodes are connected to the printed circuit board, collect data, and send data to the printed circuit board. The device generates a light therapy schedule based on data received from the user through the user interface and data from the mask.
US09889270B2	Method of controlling relaxation equipment, control system for relaxation equipment, and method of creating user model A method of controlling relaxation equipment is a method of controlling relaxation equipment capable of changing a biological value of a user. The method includes: obtaining a user model including a transition in biological value within a period from a start time to an end time of a program being viewed by the user; obtaining a first biological value of the user viewing the program; and controlling the relaxation equipment such that the biological value of the user at the end time approximates a second biological value included in the user model, which is a value at the end time, based on the first biological value and the second biological value.
US09889268B2	On-site medical gas production plant and associated operating method The invention relates to an on-site medical gas production plant (100) comprising a unit (50) for purifying gas, such as air, a first compartment (A) for storing purified gas, and a main gas line (10) fluidically connecting the gas purification unit (50) to the said first storage compartment (A). It furthermore comprises a three-way actuated valve (VA) arranged on the main gas line (10) upstream of the first storage compartment (A), and furthermore connected to the atmosphere (at 12) via a vent line (11), as well as an operating device (4) which controls at least the three-way actuated valve (VA), and at least a first gas analysis device (D1) of which a first measurement line (29) is fluidically connected (at 28) to the main line (10), upstream of the three-way actuated valve (VA), and which is electrically connected to the said operating device (4).
US09889266B2	Breathing mask arrangement as well as an application device and a forehead support device for same A breathing mask arrangement includes an arch body, a sealing lip means for bearing against the surface of the face of a mask user, a respiratory gas conduit means for feeding respiratory gas to a mask internal space which is defined by the arch body and which is in communication with the nose and/or mouth opening of the user of the mask, and an application structure for application of the sealing lip means jointly with the arch body, wherein the application structure has a carrier portion on which a respiratory gas conduit member is releasably coupled.
US09889264B2	Laryngeal mask A laryngeal mask includes an airway tube having an inner lumen and a distal end; and a mask portion connected at a proximal end thereof to the distal end of the airway tube and having a distal tip opposite the proximal end. The mask portion includes an inflatable cuff including an anterior cuff surface, and a wedge portion including a stabilization surface and two walls connected to the inflatable cuff and extending toward from the stabilization surface, the stabilization surface extending from the distal tip of the mask portion toward the distal end of the airway tube at a wedge angle of between about 12 and 30 degrees, the wedge angle formed between the stabilization surface and the anterior cuff surface when the inflatable mask is inflated. The stabilization surface is transversely and longitudinally substantially flat to stabilize the laryngeal mask in use.
US09889263B2	Fluid dispenser device A fluid dispenser device including a body, an elongate flexible strip supporting a plurality of reservoirs, each containing a dose of fluid or powder; an reservoir-opening mechanism for opening a reservoir on actuation; a first displacement mechanism for causing the flexible strip to advance before, during and/or after actuation, so as to bring a full reservoir into register with the reservoir-opening mechanism; and a second displacement mechanism for displacing a full reservoir against the opening mechanism each actuation. The leading end of the flexible strip is fastened to a rotary receiver element, the receiver element including a set of peripheral teeth that co-operates with a movable traction member, a stressed spring acting on the movable traction member so as to displace it, the displacement of the movable traction member causing the receiver element to turn, such that the receiver element exerts a traction force on the elongate strip.
US09889261B2	Nebulizer mesh and production method thereof The present invention relates to a nebulizer mesh which is used, in a nebulizer for atomizing and nebulizing liquid, for atomizing the liquid, and has plural through holes 17, wherein each of the through holes 17 forms a cylindrical space portion 174 on one surface side of the nebulizer mesh, and forms an opening 172 opened in a mortar shape on the other surface side, and to a production method thereof.
US09889248B2	Syringe storage tray A storage tray for one or more syringes includes a recess for each of the syringes to be held in the tray. Each recess has first and second opposed sidewalls that define a space therebetween for receiving the barrel of the syringe. Each of the first and second sidewalls has one or more deformable projections thereon that protrude into the space between the sidewalls for positively retaining the barrel of the syringe between the first and second sidewalls. Additionally, a slot is provided for receiving the thumb rest of the plunger. The slot includes a third sidewall oriented generally transverse to the first and second sidewalls, with the third sidewall including a further projection for engaging a surface of the thumb rest. Preferably, a plurality of such transverse slots is provided to accommodate different positions of the plunger relative to the syringe barrel. The tray also includes a relieved portion intermediate the first and second sidewalls and the slot that provides access to a proximal portion of the syringe barrel to facilitate removal of the syringe from the tray.
US09889242B2	Catheter device The catheter device comprises a motor located at the proximal end of the catheter device and a drive shaft, extending from the proximal end section to the distal end section of the catheter device, for driving a rotating element located at the distal end of the catheter device. The catheter device also comprises a hose-like catheter body which encompasses the drive shaft and extends from the proximal end section to the distal end section of the catheter device. At the proximal end of the catheter device, the drive shaft is connected to a motor by a clutch. The clutch is a magnetic clutch with a proximal and a distal magnet unit. The proximal magnet unit is connected to the motor and the distal magnet unit to the drive shaft. The distal magnet unit is mounted fluid-tight in a clutch housing. The proximal end of the catheter body makes a fluid-tight connection with the clutch housing.
US09889234B2	Scaffold for hard tissue regeneration containing active ingredient for treating osteoporosis and preparing method thereof A scaffold for hard tissue regeneration comprising an active ingredient for treating osteoporosis and a preparation method thereof. The scaffold for hard tissue regeneration is prepared by the steps of mixing a polyphenol-based natural substance containing Quercetein or Genistein involved in the activation of osteoblasts and osteoclasts and the biofunctional analog thereof with a ceramic scaffold material and molding the mixture at room temperature into a three-dimensional scaffold. The biofunctional material included in the scaffold above may be sustain-released slowly over the long period of time so that the osteoblast activity is directly improved and at the same time the osteoclast activity is suppressed in the course of bone regeneration, to have the effect of improving bone regeneration.
US09889231B2	Medical supplies and method of producing the same A method of producing metallic medical supplies includes supplying a metallic material as a base material; treating the base material by carrying out any one of electrochemical treatment, chemical treatment, thermal and/or mechanical treatment or a combination of two or more of these treatments to form a film having micro pores and/or micro unevennesses having a density of 5′ 104/mm2 on a surface of the base material; and carrying out iodine-impregnation treatment to impregnate the film with iodine or iodine compounds.
US09889230B2	Hemostatic implant The present disclosure relates to collagen-containing implants including a porous substrate having a first hydrogel precursor and a second hydrogel precursor applied thereto in a manner such that the first hydrogel precursor and second hydrogel precursor do not react with each other until the implant is placed at the site of implantation and exposed to the physiological fluids of a patient.
US09889225B2	Method for bone formation by administering poly(lactic-co-glycolic acid) cross-linked alendronate A method for bone regeneration which comprises administering a short term release composition into a bone area of a subject in need thereof, wherein the composition comprises a poly(lactic-co-glycolic acid) cross-linked alendronate (PLGA-ALN), wherein the composition releases the alendronate into the bone area, wherein the bone tissue of the bone area is exposed in situ to a therapeutically effective amount of the alendronate over 9 days.
US09889224B2	Spatial control of additives by high temperature Provided is a method of making a polymeric material with a spatially controlled distribution of one or more additives including the steps of blending the one or more additives with a polymeric material, consolidating the polymeric material, heating at least a portion of at least one surface of the consolidated additive-blended polymeric material, and cooling the heated consolidated additive-blended polymeric material, thereby forming a polymeric material with a spatially controlled distribution of additive.
US09889223B2	Temperature-insensitive calcium phosphate cements Temperature-insensitive calcium phosphate cements and methods of using the same are provided. Aspects of the cements include a dry component having fine and coarse calcium phosphate particulate reactants and a setting fluid which includes a cellulose. The dry component and setting fluid may be combined over a broad temperature range to produce a flowable composition. The resultant flowable composition finds use in a variety of different applications, including the repair of hard tissue defects, e.g., bone defects such as fractures.
US09889219B2	Decontamination apparatus and method Provided is a decontamination apparatus that includes a motorized base with a transport system that is operable to autonomously move the decontamination apparatus. A plurality of UVC bulbs, each of which emits UVC light, are supported at a vertical elevation above the motorized base. A controller controls operation of the transport system to move the decontamination apparatus along a desired route while the UVC bulbs are energized during a decontamination process.
US09889218B2	Electrode arrangement for generating a non-thermal plasma The invention relates to an electrode arrangement (1) for generating a non-thermal plasma, comprising: a layer-shaped first electrode (2) made of an electrically conductive material, a layer-shaped second electrode (4) made of an electrically conductive material, wherein the second electrode (4) is electrically insulated from the first electrode (2), and a dielectric barrier (3) being arranged between the first electrode (2) and the second electrode (4), so that the non-thermal plasma is generated by a dielectric barrier discharge. The inventive electrode arrangement is characterized in that at least one of the first electrode (2) and the second electrode (4) comprises several perforations which are distributed over the electrode.
US09889212B2	Preparation method for magnetic composite for treating and diagnosing cancer A preparation method for a magnetic composite for treating and diagnosing cancer. The method may include a step of pyrolyzing a precursor of a magnetic nanoparticle in the presence of a conjugated polymer. The preparation method for a magnetic composite can produce a magnetic composite economically and efficiently because a magnetic composite comprising a magnetic nanoparticle coated with a conjugated polymer can be prepared by a single process.
US09889204B2	Polymeric antibiotics The disclosure provides, inter alia, polymeric antibiotic compounds such as modified chitosans and methods of use thereof.
US09889201B2	Acid-labile lipophilic prodrugs of cancer chemotherapeutic agents The present application discloses an acid labile lipophilic molecular conjugate of cancer chemotherapeutic agents and methods for reducing or substantially eliminating the side effects of chemotherapy associated with the administration of a cancer chemotherapeutic agent to a patient in need thereof.
US09889200B2	Sphingolipid-polyalkylamine-oligonucleotide compounds Provided herein are sphingolipid-polyalkylamine phosphoramidites, methods of generating sphingolipid-polyalkylamine-oligonucleotide compounds, pharmaceutical compositions comprising such compounds, and to methods of use thereof in treating cancer.
US09889196B2	Adjuvanted vaccines for in ovo avian vaccination A composition includes at least one mineral oil, a surfactant having a hydrophilic property characterized by an HLB value equal to 12 and a divalent inorganic salt intended to be used as an adjuvant in a vaccine composition for the in ovo vaccination of avian species wherein the composition is an oil-in-water emulsion or microemulsion.
US09889191B2	Peptide sequences and compositions Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
US09889184B2	Anti-pathogen systems Provided is a system for protecting plants from attack by pests, including pathogens such as fungi. Specifically, a plant defensin is provided in conjunction with a protease inhibitor protects a plant from pest attack or reduces severity of an attack.
US09889181B2	Bacteriophage lysin and antibiotic combinations against gram positive bacteria The present invention provides compositions and methods for prevention, amelioration and treatment of gram positive bacteria, particularly Staphylococcal bacteria, with combinations of lysin, particularly Streptococcal lysin, particularly the lysin PlySs2, and one or more antibiotic, including daptomycin, vancomycin, oxacillin, linezolid, or related antibiotic(s).
US09889173B2	Composition for improving macular pigment density and preventing or treating age-related macular degeneration The present invention provides a composition for improving macular pigment optical density and preventing or treating age-related macular optical degeneration. The composition comprises lutein, zeaxanthin and tea extracts, wherein the weight ratio of zeaxanthin to lutein is more than or equal to 1. The composition may prevent formation of choroidal neovascularization to achieve effects on comprehensively preventing or treating age-related macular optical degeneration (AMD).
US09889171B2	Topical compositions and methods for reducing oxidative stress A composition for the topical application on a mammalian skin comprises one or more Brassica plant extracts selected from the group consisting of: Brassica juncea extract, Brassica oleracea italica extract, Brassica oleracea capitata extract, Brassica oleracea botrytis extract, and Brassica oleracea acephala extract. The composition further comprises one or more selected from the group consisting of: Curcuma longa extract, curcuminoids, tetrahydrocurcuminoids, metabolites of curcuminoids or tetrahydrocurcuminoids, and derivatives of curcuminoids or tetrahydrocurcuminoids. The composition further comprises one or more selected from the group consisting of: Camellia oleifera extract, Camellia sinensis extract, green tea extract and white tea extract; Wasabia japonica extract; Bacopa monnieri extract; Silybum marianum extract; and one or both of Piper nigrum extract or tetrahydropiperine.
US09889170B1	Synthesis of nanoparticles using Balanites aegyptiaca A method of preparing nanoparticles from desert date can include providing a metal salt solution comprising metal ions; providing desert date extract solution that comprises a reducing agent, and combining the metal ion solution and the desert date extract solution while stirring at a temperature in the range of 25° C. to 100° C. to produce metal or metal oxide nanoparticles. The metal nanoparticles can be gold nanoparticles. The metal oxide nanoparticles can be zinc oxide nanoparticles. The nanoparticles can be used to inhibit the growth or proliferation of a cancer cell and/or microorganisms.
US09889164B2	Bacteria engineered to treat a disease or disorder Genetically programmed microorganisms, such as bacteria, pharmaceutical compositions thereof, and methods of modulating and treating a disease and/or disorder are disclosed.
US09889163B2	Bioeffective krill oil compositions Krill oil compositions are disclosed as having high amounts of phospholipids, astaxanthin esters and/or omega-3 contents. The krill oils are obtained from krill meal using supercritical fluid extraction in a two stage process. Stage 1 removes the neutral lipid by extracting with neat supercritical CO2 or CO2 plus approximately 5% of a co-solvent. Stage 2 extracts the actual krill oils by using supercritical CO2 in combination with approximately 20% ethanol. The krill oil materials obtained are compared with commercially available krill oil and found to be more bioeffective in a number of areas such as anti-inflammation, anti-oxidant effects, improving insulin resistances and improving blood lipid profile.
US09889157B2	Phosphate-binding magnesium salts and uses thereof The present invention provides, among other things, compositions and methods suitable for the treatment of hyperphosphatemia based on phosphate-binding magnesium salts. In some embodiments, the present invention provides compositions and methods suitable for the treatment of hyperphosphatemia based on the combination of phosphate-binding magnesium and calcium salts.
US09889152B2	Multiple PPI dosage form Herein provided are dosage forms (variously referred to as “formulations”) comprising a PPI that is released from the dosage form as a first and a second dose. Each dose of PPI is present in an amount sufficient to raise the plasma levels of the PPI to at least 100 ng/ml.
US09889147B2	Analogues of etoposide for the treatment of tumours Compounds for treatment of a patient having a tumor that is metastatic and/or that reduces an organ function, wherein the compounds are of the general formula: wherein X is O, NH and S, wherein n is 0, 1 or 2, wherein R1 and R2 are H, methyl or ethyl, or together form a group CR3R4, and wherein R3 and R4 are H, methyl or ethyl.
US09889140B2	3-(1H-imidazo[4,5-C]pyridin-2-yl)-1H-pyrazolo[3,4-B]pyridine and therapeutic uses thereof Azaindazole compounds for treating various diseases and pathologies are disclosed. More particularly, the present invention concerns the use of an azaindazole compound or analogs thereof, in the treatment of disorders characterized by the activation of Wnt pathway signaling (e.g., cancer, abnormal cellular proliferation, angiogenesis, fibrotic disorders, bone or cartilage diseases, and osteoarthritis), the modulation of cellular events mediated by Wnt pathway signaling, as well as genetic diseases and neurological conditions/disorders/diseases due to mutations or dysregulation of the Wnt pathway and/or of one or more of Wnt signaling components. Also provided are methods for treating Wnt-related disease states.
US09889136B2	Tetrahydropyridopyrimidine compound or salt thereof A method for inhibiting androgen activity, including administering an effective amount of a tetrahydropyridopyrimidine compound of formula (I) or a pharmaceutically acceptable salt thereof to a subject in need thereof, and a method for treating tumor, including administering an effective amount of a tetrahydropyridopyrimidine compound of formula (I) or a pharmaceutically acceptable salt thereof to a subject in need thereof
US09889134B2	Polymorphs of ARRY-380, a selective HER 2 inhibitor and pharmaceutical compositions containing them Polymorphs of N4-(4-([1,2,4]triazolo[1,5-a]pyridin-7-yloxy)-3-methylphenyl)-N6-(4,4-dimethyl-4,5-dihydrooxazol-2-yl)quinazoline-4,6-diamine are provided herein. Processes for preparing the polymorphs and pharmaceutical composition comprising the polymorphs are also disclosed.
US09889133B2	Formulations of 5-fluorocytosine and uses thereof The disclosure provides an extended release formulation of 5-fluorocytosine. In another aspect, a method of treating a fungal disease is provided. The method comprises administering to a subject in need thereof a fungus-treating effective amount of a composition comprising 5-fluorocytosine. In yet another aspect, a method of treating a cancer is provided. The method comprises administering to a subject in need thereof a sufficient amount of an expression vector to induce expression of cytosine deaminase which is capable of converting 5-fluorocytosine to 5-fluorourcail in cells of the cancer and a cancer-treating effective amount of a composition comprising 5-fluorocytosine.
US09889132B2	Pharmaceutical compositions for the treatment of psoriasis Pharmaceutical compositions for topical administration for the treatment of psoriasis are described, containing as active ingredient therapeutically effective quantities of 4,6-dimethyl-N-(3,4,5-trimethoxyphenyl)pyrimidin-2-amine (I) and 2,4-O-(2-furanylmethylene)-1,3,5,6-tetra-O-methyl-D-glucitol combined with suitable excipients and/or diluents.
US09889128B2	Method for producing benzazoloquinolium (BQs) salts and using the biological activity of the composition Disclosed is the synthesis procedure for benzazolo[3,2-a]quinolinium chloride salts and the inclusion of chloro-substituent, amino-substituent, and nitro-substituent resulting in several compounds. The compounds are further used as markers due to their fluorescent properties including in hypoxic environments.This disclosure further describes anti-cancer screening of two BQS, namely, 7-benzyl-3-aminobenzimidazo[3,2-a]quinolinium chloride (ABQ-48: NSC D-763307) and the corresponding 7-benzyl-3-nitrobenzimidazo[3,2-a]quinolinium chloride (NBQ 48: NSC D-763303).
US09889123B2	Polymorphs of deuterated omega-diphenylurea or salts thereof The invention relates to polymorphs of deuterated omega-diphenylurea or salts thereof. In particular, the invention provides polymorphs of 4-(4-{3-[4-chloro-3-(trifluoromethyl)phenyl)-ureido]-phenoxy}-2-(N-1′,1′,1′-trideutero-methyl)picolinamide or its salt, namely, polymorphs of the compound as shown in formula (I) or its salt. The polymorphs are suited for preparing the pharmaceutical composition used for inhibiting phosphokinase (such as raf kinases).
US09889121B2	Heterocyclylalkyne derivatives and their use as modulators of mGluR5 receptors This invention relates to compounds of formula I, their use as allosteric modulators of mGluR5 receptor activity, pharmaceutical compositions containing the same, and methods of using the same as agents for the treatment and/or prevention of neurological and psychiatric disorders associated with glutamate dysfunction, such as schizophrenia or cognitive decline, dementia or cognitive impairment, or other pathologies that can be related directly or indirectly to glutamate dysfunction.
US09889118B2	Use of amisulpride as an anti-emetic Amisulpride is used in the therapy of nausea, vomiting or retches. The therapy may utilize a novel injectable formulation, in unit dosage form, comprising less than 50 mg amisulpride.
US09889115B2	Fitness assay and associated methods The present invention provides an assay for determining the biochemical fitness of a biochemical species in a mutant replicating biological entity relative to its predecessor. The present invention further provides a continuous fluorogenic assay for measuring the anti-HIV protease activity of protease inhibitor. The present invention also provides a method of administering a therapeutic compound that reduces the chances of the emergence of drug resistance in therapy. The present invention also provides a compound of formula (I) or a pharmaceutically acceptable salt, a prodrug, a composition, or an ester thereof, wherein A is a group of formulas (A), (B), (C) or (D); R1, R2, R3, R5 or R6 is H, or an optionally substituted and/or heteroatom-bearing alkyl, alkenyl, alkynyl, or cyclic group; Y and/or Z are CH2, O, S, SO, SO2, amino, amides, carbamates, ureas, or thiocarbonyl derivatives thereof, optionally substituted with an alkyl, alkenyl, or alkynyl group; n is from 1 to 5; X is a bond, an optionally substituted methylene or ethylene, an amino, O or S; Q is C(O), C(S), or SO2; m is from 0 to 6; R4 is OH, ═O (keto), NH2, or alkylamino, including esters, amides, and salts thereof; and W is C(O), C(S), S(O), or SO2. Optionally, R5 and R6, together with the N—W bond of formula (I), comprise a macrocyclic ring.
US09889112B2	Lobaplatin crystal, preparation method and pharmaceutical application The present invention relates to new crystals A, B and F of lobaplatin as well as preparation methods therefor and pharmaceutical applications thereof. Lobaplatin crystal A has a melting point Tm.p. of 220±5° C. and is obtained by adding a lobaplatin trihydrate to a suspension crystallization solvent. Lobaplatin crystal B has a melting point Tm.p. of 230±5° C. and is obtained by performing solvent evaporation on a lobaplatin trihydrate or by adding a solvent to a lobaplatin dihydrate, and performing room temperature evaporation or solventing-out crystallization and then drying. Lobaplatin crystal F has a melting point Tm.p. of 229±5° C. and is obtained by adding methanol or ethanol to a lobaplatin dihydrate, stirring at room temperature until solids are dissolved, filtering out insolubles, slowly adding an organic solvent, crystallizing out, separating the crystal and drying the crystal. Compared with the existing lobaplatin and lobaplatin trihydrate, the lobaplatin crystals A, B and F have better stability and solubility, are more suitable for preparation of various forms of pharmaceutical preparations, are more suitable for storage and use, and can be better used for treating cancers such as breast cancer, small cell lung cancer, or chronic myeloid leukemia.
US09889110B2	Selective androgen receptor modulator for treating hormone-related conditions This invention provides use of a SARM compound or a composition comprising the same in treating and preventing muscle wasting in patients with non-small cell lung cancer (NSCLC); treating pre-cachexia or early cachexia (preventing muscle wasting in a cancer patient); treating and preventing loss of physical function due to cancer or cancer therapy; increase of physical function; and increasing survival in a patient with NSCLC, wherein the patients are subjected to cancer therapy.
US09889106B2	Topical compositions comprising polyunsaturated fatty acids The present invention provides a compound which is a polyunsaturated fatty acid (PUFA) derivative of formula (I), or a pharmaceutically acceptable salt, or solvate thereof, for use in treating various skin disorders.
US09889105B2	In vivo method for treating, inhibiting, and/or prophylaxis of cancer, such as pancreatic cancer An in vivo method of inhibiting tumor growth, specifically pancreatic cancer, includes administering to a subject in need thereof an effective amount of a compound, composition, and/or a pharmaceutical formulation including crocetinic acid.
US09889101B2	Therapeutic treatment of cancer and dysplasia of the cervix or vagina using estrogen antagonists A method for treatment of cervical or vaginal cancer and their associated dysplasia, including the steps of identifying a human cervical or vaginal cancer and/or dysplasia patient, administering an effective amount of an estrogen antagonist therapy to the patient, wherein the amount is effective to reduce cancer and dysplasia symptoms, and observing a reduction of cancer and dysplasia symptoms in the patient.
US09889090B2	Method for treating a periodontal disease A method for treating a periodontal disease affecting a periodontal pocket of a patient. The method comprises inserting an oral delivery device into the periodontal pocket at a frequency of about once every 4 days to about once every 6 weeks. The oral delivery device is a controlled release solid unit dosage form suitable for insertion into a periodontal pocket of a patient, comprising a therapeutically effective amount of at least one anti-inflammatory agent, at least one antibacterial agent, or the combination of at least one anti-inflammatory agent and at least one antibacterial agent.
US09889088B2	Alpha-2 adrenergic agonist having long duration of intraocular pressure-lowering effect The present invention provides a method of lowering intraocular pressure which comprises administering a therapeutically effective amount of a pharmaceutical composition comprising 4-bromo-5-(2-imidazolin-2-ylamino)benzimidazole, or a salt thereof to the affected eye of a patient, as a single dose, wherein the affected eye has an intraocular pressure less than the baseline intraocular pressure for at least eight (8) hours.
US09889087B2	Intranasal delivery of β2-adrenergic receptor agonists for improving cognition in humans with down syndrome and compositions therefor A method of improving cognition in a patient with Down syndrome, which entails intranasally administering one or more β2-ADR agonists or pharmaceutically-acceptable salts of either or both to the patient in an amount and with a frequency effective to improve cognition of the patient as measured contextual learning tests.
US09889086B2	Bioadhesive and injectable hydrogel The present invention provides a novel hydrogel, methods of its use, and methods for producing the hydrogel.
US09889085B1	Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c The present invention is directed to treatments for a disease or condition, in a subject in need thereof, that provide alternatives to treatment by injection that give, relative to treatment by injection, improved treatment outcomes, 100% treatment compliance, reduced side effects, and rapid establishment and/or termination of substantial steady-state drug delivery. The method includes providing continuous delivery of a drug from an implanted osmotic delivery device, wherein substantial steady-state delivery of the drug at therapeutic concentrations is achieved within about 7 days after implantation of the osmotic delivery device in the subject and the substantial steady-state delivery of the drug from the osmotic delivery device is continuous over a period of at least about 3 months. In one embodiment, the present invention is directed to treatment of type 2 diabetes mellitus using insulinotrophic peptides. In embodiments, a subject has a baseline HbA1c % of greater than 6.5% or 10.0%.
US09889081B2	Aldehyde dehydrogenase inhibitors as novel depigmenting agents The present invention provides methods and compositions for reducing pigmentation.
US09889080B2	Color depositing shampoo A composition for coloring and shampooing hair substantially free, preferably totally and completely free, of anionic surfactants, comprising at least one cationic dye, n-methyl alkyl glucamide with a carbon chain length from 8 and 20, inclusive, preferably 8 and 10, an aqueous carrier, and at least one stabilizer of anti-oxidant and free radical scavanger. By weight, (based on the total weight of the composition), the composition comprises 0.0005% to 3.0% cationic dye, 2.5 to 30% n-methyl alkyl glucamide, 30 to 70% water, and 0.01 to 0.5% stabilizers of anti-oxidant and free radical scavenger. Other ingredients, including a rheology modifying polymer, conditioning ingredients, and additional surfactants, may also be included in the composition and are also included in the scope of the invention.
US09889077B2	Oral care composition Disclosed are oral care compositions and the use of such oral care compositions for treating conditions caused by biofilm formation. Also disclosed are methods for inhibiting biofilm formation and/or degrading biofilm. The oral care composition includes a sesquiterpenoid and an antimicrobial agent, in which the sesquiterpenoid and the antimicrobial agent are present in an amount effective to inhibit and/or degrade a biofilm in the oral cavity.
US09889076B2	Light attenuating formulations A preparation provides light or radiation attenuation between about 190 and 800 nm has an amount of diamond nanoparticles in a medium, where the diamond nanoparticles have a size between about 1 nm and 1000 nm are modified to enhance absorption or photoluminescence. This abstract is not to be considered limiting, since other embodiments may deviate from the features described in this abstract.
US09889074B2	Notch filter coatings for use in sunscreen applications Notch filter coatings for use in sunscreen applications are provided herein. An exemplary composition includes multiple zinc oxide particles suspended within a medium forming sunscreen composition; and a combination of multiple notch filter coating materials individually applied as a distinct layer to each of the multiple zinc oxide particles to create a multi-layered structure surrounding each of the multiple zinc oxide particles within the sunscreen composition, wherein the multi-layered structure: reflects light at a user-determined wavelength range based on the wavelength range at which each of the multiple notch filter coating materials reflects light; and allows wavelengths of light (i) within at least a portion of the ultraviolet spectrum and (ii) outside of the user-determined wavelength range to be absorbed by the multiple zinc oxide particles.
US09889072B2	Porous silica particle, method for producing the same, and cleansing cosmetic containing the same A porous silica particle with the small specific surface area and large pore volume, which is contained as the scrubbing agent in the cleansing cosmetics is provided. The porous silica particle has high collapsibility, and therefore the damage of the skin can be prevented. A porous silica particle according to the present invention has: an average circularity of 0.1 to 0.5; a pore volume of 0.1≦Pv<1.0 ml/g; a specific surface area of 5 to 60 m2/cm3; a median size of 100 to 1000 μm; a ratio of a maximum particle diameter to the median size, of 3.0 or less; and a median size of 5 to 40 μm and a maximum particle diameter of 15 to 200 μm, after rubbing for 30 seconds with a load of 1.0 to 1.4 KPa.
US09889064B1	Sexual stimulation device with an oscillator feature Disclosed is a sexual stimulation device that includes a phallus shaped member having a handle opposite a stimulation end. The handle includes a control button for operating the device. The control button is connected to a power source that can activate an oscillating motor, which is attached to a motor head having a motor head attachment and a silicone embedded connector. The motor head oscillates, thereby moving the motor head attachment and the silicone embedded connector therewith. The silicone embedded connector is aligned with a stimulation point at the stimulation end of the device such that when the device is activated, the stimulation point can oscillate. In use, the stimulation end can be inserted into a vagina to contact the g-spot or near the wall of the vagina to stimulate a user.
US09889055B2	Infant warming device with rotating patient support power, signal control data and communications An electrical connection system that can feed power, signal, data, and communication lines into a rotating or static patient support system in an infant warming device.
US09889054B2	Fail-safe release mechanism for use with patient positioning support apparati A fail-safe release mechanism for use with patient positioning support apparati having a base structure and a patient support structure, to prevent collapse of the patient support during disconnection of the patient support structure from the base structure.
US09889051B2	Absorbent article with improved tear resistance and softness A disposable absorbent article may comprise a chassis and an ear. The chassis comprises a liquid permeable topsheet, a backsheet, and an absorbent core disposed between the topsheet and backsheet. The ear comprises an elastomeric material and a first substrate joined to the elastomeric material. The ear has a first void region adjacent the proximal edge of the ear. The ear is joined to the chassis by at least one mechanical bond that engages the elastomeric material.
US09889050B2	Absorbent article An absorbent article that has an absorber which is disposed in the crotch region and an absorber backsheet which is positioned at the outer direction side of the absorber. At least either one of a front end of the absorber and a rear end of the absorber is disposed in the crotch region. In the front end of the absorber backsheet and the rear end of the absorber backsheet, an end at a side at which the absorber is positioned in the crotch region is disposed outboard of the crotch region in the longitudinal direction.
US09889048B2	Absorbent core An absorbent core, intended for use in an absorbent product such as a panty liner, is disclosed, comprising an absorbent material and a superabsorbent material. The core has a first extension in a longitudinal direction and a second extension in a transverse direction, and a longitudinal central line extending through the core, located between a first longitudinal portion and a second longitudinal portion. The first and second longitudinal portions are symmetric about the longitudinal central line. The core has a head portion, an intermediate portion and a rear portion extending in a longitudinal direction of the core. The head portion includes mirror imaged first circular segment portions and first edge lines to which the circular segment portions transition. The intermediate portion includes mirror imaged first convex edge portions. The rear portion includes second edge lines tapering towards a rear end and the central line of the core in an angle.
US09889044B1	Steerable laser probe A steerable laser probe may include a handle, an actuation lever, an optic fiber, and a housing tube. The housing tube may have a first housing tube portion having a first stiffness and a second housing tube portion having a second stiffness. The second stiffness may be greater than the first stiffness. The optic fiber may be disposed within the housing tube and within an inner bore of the handle. An actuation of the actuation lever about a pivot pin of the handle may gradually curve the optic fiber. An actuation of the actuation lever about the pivot pin of the handle may gradually straighten the optic fiber.
US09889041B2	Device for a medical treatment of a sclera The invention relates to a device for a medical treatment of a sclera, the device (100) comprising a curved disc or a belt (102), wherein the disc/belt is configured to be placed into the Tenon's space; the disc/belt is formed such that the inner surface of the curved disc/belt is superficially contactable to the surface of an area of the sclera so as to superficially cover said area; and the disc/belt comprises one, two, three, four, or more independent channel systems (101).
US09889040B2	Warming device with provision for warming hands A warming device includes a clinical garment with at least one convective apparatus supported on the inside of the garment. Slits are provided in the clinical garment which enables a patient to insert his or her hands inside the clinical garment to be warmed therein by operation of the convective apparatus.
US09889037B2	Spinal traction device and method of use A cervical spine traction device and method of use to apply a controlled tractional force to the cervical spine of a patient to remodel and correct improper spinal positioning. The device is affixed to an end of a table and includes a mounting plate, a riser, a height adjusting means, an angular adjusting means, a tensioning means, and a headrest. The patient is placed into the device in a prone position and a tractional force is applied to cervical spine of the patient to remodel proper spinal positioning.
US09889030B2	Endograft delivery device assembly An endograft delivery device assembly is disclosed. The assembly comprises: a tip; a guide wire cannula, the guide wire cannula; a pusher disposed around the guide wire cannula, the pusher having a sheath assembly receiving portion at a proximal end thereof and a main portion extending distally from the sheath assembly receiving portion to a distal end, the sheath assembly receiving portion having at least one longitudinally extending groove; and a sheath assembly slidably mounted to the sheath assembly receiving portion of the pusher. The sheath assembly has a sheath portion, mountable over a endograft, and slide connecter portion. The slide connector portion has at least one inwardly projecting key, the key keying with the groove. The sheath assembly is slidably movable from an extended position over the endograft to a retracted position in which the endograft is uncovered.
US09889028B2	Implant release mechanism An implant release mechanism for releasing, for example, a stent (60) is provided with three restraining wires (62) which pass in the space between a wire guide catheter (24) and a pusher sheath or dilator (30) and are arranged substantially equi-angularly threrearound. Each restraining wire (62) holds both the proximal and distal ends of the stent (60), in this case each holding a proportion of the ends of the stent (60). When the restraining wires (62) are pulled they will first unwrap from the proximal end of the stent (60) and will then release the distal end of the stent (60) so as to allow the stent to become fully deployed within the lumen of the patient. The use of common release wires improves deployment of implants and reduces the number and volume of components in the device, thereby allowing it to occupy a smaller volume.
US09889027B2	Stent delivery system A stent delivery system is provided with an inner elongate shaft having a proximal portion and a distal portion and an outer elongate shaft having a lumen extending at least partially therethrough, wherein the proximal portion of the inner elongate shaft is at least partially movably disposed within the lumen. The system also includes a stent positionable about the inner elongate shaft having collapsed and expanded configurations. The system includes a proximal restraining member removably engaged with the outer elongate shaft and attached the stent, and a distal restraining member removably engaged with the inner elongate shaft and attached to the stent. The system also has a proximal biasing member operatively engaged with a distal portion of the outer elongate shaft, a distal biasing member operatively engaged with the distal portion of the inner elongate shaft, and an outer tube with a lumen movably disposed over the inner elongate shaft.
US09889026B2	Endo-urethral prosthesis An endo-urethral prosthesis characterized in that it comprises a set of guides (100) defining an internal space (201) in a urinary channel, and one or more support elements (110) for supporting the internal wall of the urinary tract, the guides comprising recessed areas and protruding areas, said protruding areas forming locking regions (21) for holding the support elements in place, in a position that allows them to support the internal wall of the urinary tract.
US09889024B2	Cosmetic prosthesis cover The invention relates to a cosmetic cover (1) for lining a prosthesis (10), with a distal section (2), and with a joint section (3) which, when the cosmetic cover (1) for the prosthesis is fitted in place, covers a joint mechanism (30) arranged between a proximal prosthesis component (40) and a distal prosthesis component (20), wherein the joint section (3) is made from a 3D spacer knit having an upper textile and a lower textile, which are spaced apart and attached to each other by support threads.
US09889018B2	Expandable vertebral body replacement device and method Expandable vertebral body implants, systems, instruments, and methods of assembly and using the implants, systems, and instruments are disclosed. The vertebral body implant includes a body with a first end and a second end, a first rotating member rotatably coupled to the first end, wherein an end includes a plurality of first notches inset into the first rotating member, a second rotating member rotatably coupled to the second end, wherein an end includes a plurality of second notches inset into the second rotating member, a first extension member moveably coupled to the first end, and a second extension member moveably coupled to the second end. The expandable cage system comprises a vertebral body implant and an insertion instrument. Methods for assembling and using the vertebral body implants and instruments are also disclosed.
US09889017B2	Intervertebral disc prosthesis The present invention relates to an intervertebral disc prosthesis preferably comprising at least three pieces including an upper plate (1), a lower plate (2) and a mobile core (3) at least in relation to the lower plate (2), co-operation means (23, 33) allowing to limit or eliminate the movements of the core (3) in relation to the lower plate (2), in translation and in rotation, respectively, about an axis substantially parallel to the lower plate (2) and about an axis substantially perpendicular to the lower plate (2), at least one part of the surface of at least one plate being concave and complementary with a convex surface (30) of the core (3), with which it is in contact, wherein the tip (31) of the convex surface (30) of the core (3) is off center, in at least one direction, in relation to the center (32) of this convex surface (30).
US09889016B2	Adjustable total disc replacement device Disclosed is an implantable artificial intervertebral disc joint replacement device for implantation between adjacent vertebral bodies. The device allows selective positioning of a disc implant element and comprises translatable surfaces, a mechanism for translation, a means for bone attachment, and an integrated disc implant. The device can be used in the lumbar, thoracic, and cervical regions of the spine in single or multi-level configurations. When implanted in a patient, the device includes an upper (cranial) component and a lower (caudal) component attached to the vertebral body above and below the replaced intervertebral disc respectively, with the joint implant integrated into the translatable surfaces. Following implantation, precise positioning of the joint implant within the intervertebral space with respect to the spinal axis is then adjusted based upon the particular anatomical and functional needs of the individual patient to satisfy spinal range of motion and stability requirements.
US09889015B2	Expandable coil spinal implant Coiled spinal implants for disc, vertebral body, and spinal motion segment replacement or reconstruction comprise a plurality of loops and spaces between the loops, with the loops formed of a hollow material and having a plurality of apertures or a longitudinal gap that extend(s) through the sidewalls of the loops and into the hollow center. The coiled implants include one or more balloons within the hollow center, the spaces between the coil loops, and/or within the central void that the coil surrounds. Filling the balloon expands the loops and thereby increases the height of the coil. Bone graft material or bone cement may be deployed from the apertures or gap.
US09889013B2	Variable angle blade augment A variable angle blade augment including an augment section and a separate plate or blade segment. According to some embodiments, a first connector of the blade segment and a socket capture mechanism of the augment section provide a ball and socket type joint. Additionally, the socket capture mechanism may be structured to allow for linear displacement of the first connector relative to at least one axis of the socket capture mechanism. By allowing for at least pivotal and linear relative displacement of the augment section and the blade segment, the variable angle blade augment may improve the ability to optimally position a buttress augment against a prosthetic acetabular shell. Moreover, the variable angle blade augment may provide the ability to utilize components of an implantable medical device after stabilizing the components to a bone structure of a patient.
US09889009B2	Heart valve sizing ring and method A heart valve sizing ring is disclosed. The sizing ring includes an outer ring; and an inner ring configured and arranged to couple to the outer ring. The outer ring and inner ring having a pair of complementary mating surfaces configured and arranged to grip sutures therebetween when coupled together. When coupled around sutures, the assembled ring may be tightened down against the heart valve to test the fit as if the sizing ring were a similarly sized prosthetic heart valve ring. The surgeon can then remove the sizing ring and replace it with a prosthetic ring.
US09889000B2	Corneal implant applicators Devices and methods for handling and depositing corneal implants onto corneal tissue. Devices and methods for packaging and storing corneal implants.
US09888994B2	Catheter-based apparatuses and methods Blood flow into vascular tissue is filtered in a manner that can also be useful for trapping particulates while allowing the flow of blood. Consistent with one or more embodiments, a filter apparatus includes a filter, an outer delivery sheath such as a catheter, and one or more shafts that are operable to manipulate the shape of the filter for positioning within vascular tissue. The filter conforms to various types of vascular tissue, and filters blood flow passing through openings in the vascular tissue. In some implementations, the filter is used to trap particulates that have been collected on the filter, and collapses to trap and draw the particulates into the outer delivery sheath.
US09888992B2	Multifilaments with time-dependent characteristics, and medical products made from such multifilaments The invention relates to a resorbable multifilament comprising a number of individual resorbable filaments of a first type having a first degradation time and a number of individual resorbable filaments of a second type having a second degradation time, wherein the filaments of the first type and the filaments of the second type are arranged in close relationship to form a composite multifilament having a length and a specific composite cross-section comprising cross-sections of the individual filaments of the first type and second type, wherein the cross-sections of the individual filaments of the first and second type are located at determined relative positions, wherein the relative positions amongst the individual cross-sections of the filaments of the first and second types are invariant over the length of the composite multifilament.
US09888991B2	Compositions, devices, kits and methods for attaching surgical meshes to tissue The present disclosure is directed to methods, compositions, devices and kits which pertain to the attachment of surgical meshes to tissue by application of an energy source to the meshes and tissue in the presence of a bonding material.
US09888989B2	Intake device Due to the low suction strength or an unsuitable positional relationship or distance between the suction feed and the oral cavity, conventional extra-oral intake devices exhibit the problem of not being able to fully suck particulate matter and droplets from teeth, shavings from repair products, saliva, bacteria, blood, rinse water, tooth surface cleaning agents, etc., that are dispersed to outside the oral cavity during practice. In order to improve suction strength, the present invention provides an intake device that is equipped with a protruding airflow-regulating member, the top of which is oriented in the direction in which the fluid flows into the opening part of the suction feed, and that can efficiently suck dispersed particulate matter and droplets within a wide range.
US09888987B2	Dental blank to be machined, metal powder for powder metallurgy, dental metal frame for porcelain bonding, and dental prosthesis A dental blank is provided for yielding a metal frame having a desired shape according to a dental CAD/CAM system and a machining process. The dental blank is formed from a metal powder sintered body and contains Co as a main component, Cr in a proportion of 26% by mass or more and 35% by mass or less, Mo in a proportion of 5% by mass or more and 12% by mass or less, and Si in a proportion of 0.5% by mass or more and 1.0% by mass or less. Further, part of the Si is silicon oxide, and the ratio of the silicon oxide to the total amount of Si is preferably 10% by mass or more and 90% by mass or less.
US09888986B2	Semi-adjustable, arcon-type articulator Articulator—semiadjustable, arcon with lower and upper parts that could be detached from one another or interconnected, with two mechanical joints. An upper horizontal shoulder (5) is fixed to an elevator (4), said elevator (4) is connected to an upper vertical body (11) and can move vertically to adjust the vertical position. A lower vertical body (10) is fixed to the base (1) and holds an axis with two joint heads (14). The upper vertical body (11) is pivotably connected to the lower vertical body (10) through the two joint heads (14), the distance between the joint heads can vary due to an elastic element (18), thus reproducing the lateral shift. The articulation between the vertical bodies (11 and 10) can be locked and unlocked via an elbow shaped piece (13). The articulator lower part has an incisive platform (8) with a position angle that could be adapted.
US09888985B2	Method for selecting implant components Methods of selecting or designing an implant to be used in a patient are provided. A CT scan of a patient's mouth is performed. A 3D CAD model of the patient's mouth is created utilizing data generated by the CT scan. Properties of the patient's mouth are determined based upon CT scan data and assigned to the 3D CAD model. A desired location for an implant is selected. A FEA simulation is performed on the 3D CAD model to choose an implant or to design an implant that optimizes a selected variable.
US09888983B2	Unified three dimensional virtual craniofacial and dentition model and uses thereof A method and apparatus are disclosed enabling an orthodontist or a user to create an unified three dimensional virtual craniofacial and dentition model of actual, as-is static and functional anatomy of a patient, from data representing facial bone structure; upper jaw and lower jaw; facial soft tissue; teeth including crowns and roots; information of the position of the roots relative to each other; and relative to the facial bone structure of the patient; obtained by scanning as-is anatomy of craniofacial and dentition structures of the patient with a volume scanning device; and data representing three dimensional virtual models of the patient's upper and lower gingiva, obtained from scanning the patient's upper and lower gingiva either (a) with a volume scanning device, or (a) with a surface scanning device. Such craniofacial and dentition models of the patient can be used in optimally planning treatment of a patient.
US09888973B2	Intuitive user interface control for remote catheter navigation and 3D mapping and visualization systems The present disclosure relates to a control system for user-guided robotic control of a medical device and includes an electronic control unit, a computer-readable memory coupled to the ECU, and a visualization system configured to provide a view of an anatomical model. The memory contains user interface logic configured to be executed by the ECU, and configured to obtain input from a touch screen display with respect to the view of an anatomical model. Control logic stored in the memory is also configured to be executed by said ECU and is configured to produce an actuation control signal responsive to the input to control actuation of a manipulator assembly so as to move the medical device.
US09888972B2	Systems and methods for selecting, activating, or selecting and activating transducers Transducer-based systems can be configured to display a graphical representation of a transducer-based device, the graphical representation including graphical elements corresponding to transducers of the transducer-based device, and also including between graphical elements respectively associated with a set of the transducers and respectively associated with a region of space between the transducers of the transducer-based device. Selection of graphical elements and/or between graphical elements can cause activation of the set of transducers associated with the selected elements. Selection of a plurality of graphical elements and/or between graphical elements can cause visual display of a corresponding activation path in the graphical representation. Visual characteristics of graphical elements and between graphical elements can change based on an activation-status of the corresponding transducers. Activation requests for a set of transducers can be denied if it is determined that a transducer in the set of transducers is unacceptable for activation.
US09888970B2	Systems and methods for navigating a surgical device Systems and methods are disclosed for navigating a surgical device toward a target organ in the body of a patient. An example method includes providing a surgical needle and a guide wire, the surgical needle configured for insertion into a vein or a beating heart. The method also includes holding the guide wire within the surgical needle while the surgical needle is inserted into the vein or the beating heart. The method also includes generating output in two modes, the output based on at least one medical positioning system (MPS) sensor on the guide wire, the output corresponding to a position of the surgical needle and the guide wire for navigating the surgical needle and the guide wire toward a target in the vein or the heart. The methods can be carried out directly by a physician or via a computer processor-based surgical system.
US09888967B2	Systems and methods for guiding a user during surgical planning A method for guiding a user during surgical planning includes receiving input information; applying an algorithm to the input information to develop an initial surgical plan; and guiding a user by providing a plurality of suggested actions to the user. If the user performs the plurality of suggested actions, the plurality of suggested actions leads the user to the initial surgical plan. The user has an option to deviate from one or more of the plurality of suggested actions by performing non-suggested actions. Deviation from one or more of the plurality of suggested actions leads to development of a final surgical plan that is different from the initial surgical plan.
US09888963B2	Electrosurgical devices with balun structure for air exposure of antenna radiating section and method of directing energy to tissue using same An energy applicator for directing energy to tissue includes a feedline having an inner conductor, an outer conductor and a dielectric material disposed therebetween, and an antenna assembly having a radiating section operably coupled to the feedline. The energy applicator also includes a first balun structure configured to substantially confine energy to the radiating section when the energy applicator is energized and disposed in tissue, and a second balun structure configured to substantially prevent energy emitted from the radiating section from propagating proximal to the second balun structure along the feedline when the energy applicator is energized but not disposed in tissue.
US09888962B2	Apparatus and method of use for treating blood vessels An electrosurgical apparatus is provided. The electrosurgical apparatus includes a cannula insertable into a patient and positionable adjacent abnormal tissue. The electrosurgical apparatus includes a microwave antenna that includes a distal end having a radiating section receivable within the cannula and positionable within a patient adjacent abnormal tissue. The microwave antenna is adapted to connect to a source of electrosurgical energy for transmitting electrosurgical energy to the radiating section. A portion of the radiating section substantially encompasses a portion of the abnormal tissue and may be configured to apply pressure thereto. The microwave antenna is actuated to electrocautery treat tissue to reduce blood flow to the abnormal tissue.
US09888960B2	Handle and power cord assemblies for bipolar electrosurgical devices Bipolar electrosurgical devices may include a handle assembly configured to control movement of components of the electrosurgical device to perform an electrosurgical procedure and a power cord assembly configured to electrically connect the bipolar electrosurgical device with a power source. For bipolar sphincterotomes, an active portion of the handle assembly may include a first active member that contacts and slides across a second active member as the gripping portion moves about a handle stem component of the handle assembly. The power cord assembly may include a pair of return contacts that are shorted together when connected with the handle assembly, which in turn may deactivate an alarm output by the power source.
US09888959B2	Therapeutic treatment system and operation method for therapeutic treatment system A therapeutic treatment system includes a holding section configured to hold a biological tissue, electrodes provided in the holding section and capable of outputting first high-frequency energy for sealing the biological tissue at a first sealing temperature and second high-frequency energy for dissecting the biological tissue at a first dissection temperature higher than the first sealing temperature, electrodes provided in the holding section and capable of outputting first thermal energy for sealing the biological tissue at a second sealing temperature higher than the first sealing temperature and second thermal energy for dissecting the biological tissue at a second dissection temperature lower than the first dissection temperature and higher than the second sealing temperature, and a control section configured to control temperature of each of the electrodes to output the second thermal energy after the output of the first high-frequency energy.
US09888958B2	Surgical forceps A forceps includes an end effector assembly including first and second jaw members. One or both of the jaw members is moveable relative to the other between a spaced-apart position and an approximated position for grasping tissue therebetween. One or both of the jaw members includes a jaw frame including an engagement recess defined on each lateral side thereof and a replaceable component configured for slidable positioning about the jaw frame. The replaceable component includes an outer jaw housing having an engagement tang disposed on each lateral side thereof. The engagement tangs are configured to engage the engagement recesses of the jaw frame upon slidable positioning of the replaceable component about the jaw frame to secure the replaceable component to the jaw frame. The replaceable component includes an electrically conductive tissue sealing plate engaged to the outer jaw housing to define a tissue sealing surface.
US09888955B2	Electrosurgical system and an electrode assembly for an electrosurgical system An electrosurgical system includes a first unit including a generator, and a second unit including an electrode assembly, the second unit being detachably connectible to the first unit such that radio frequency power can be conveyed to the electrode assembly, wherein the second unit firstly includes a passive electrical identification component having a parameter of a finite non-zero value indicative of a characteristic of the electrode assembly, and the second unit additionally includes an output circuit adapted to generate an identifiable characteristic signal, the first unit firstly including a sensing circuit for determining the value of the electrical identification component so as to identify the second unit when the second unit is connected to the first unit, and the first unit additionally including means for receiving the identifiable characteristic signal from the output circuit when the second unit is connected to the first unit.
US09888953B2	Nested balloon cryotherapy A cryotherapy system includes a cryotherapy catheter having an inflatable balloon portion and a pressure regulator. The inflatable balloon portion includes an outer balloon and an inner balloon within the outer balloon. The inner balloon is configured to receive during a cryotherapy procedure a cryogenic agent for extracting heat from body tissue at a desired location. The inflatable balloon portion is at a distal end of the cryotherapy catheter. The pressure regulator is adapted to maintain a positive pressure between the inner balloon and the outer balloon during a cryotherapy procedure.
US09888945B2	Systems and methods for correcting spinal deformity An exemplary system for correcting a spinal deformity includes a plurality of transverse rods, a longitudinal rod, and at least one node. The plurality of transverse rods each includes a first end for coupling with an extension member of a spinal fixation system and a second end. The longitudinal rod extends transverse to the transverse rods. The at least one node receives the second ends of first and second transverse rods and the longitudinal rod within a receiving portion and an adjustment member selectively secures the second ends.
US09888942B1	Adaptor for robotics cannula and seal assembly An adaptor apparatus comprises a seal assembly housing, a channel, and tapered surfaces. The adaptor apparatus is configured to connect a trocar seal assembly with a robotic trocar cannula and maintain pneumostasis in an insufflated body cavity of a patient. The seal assembly housing comprises an open area sufficient to receive, support, and fix the trocar seal assembly within the adaptor apparatus. The channel provides a pathway for inserting instruments from the trocar seal assembly and into the cannula. The robotic trocar cannula includes an annular flange and a tapered proximal opening. The tapered surfaces of the adaptor apparatus are configured to engage the annular flange and the tapered proximal opening of the cannula. The tapered surfaces of the adaptor apparatus are configured to complement the exterior of the annular flange and the angled opening of the cannula.
US09888938B1	Uvula excision device and method of use Disclosed herein are embodiments and methods of use for a surgical excision device which contains a disposable handheld instrument with a blade for severing a uvula and an attached net for capturing and removing the uvula.
US09888937B2	System and method for minimally invasive tissue treatment using ultrasonic cannula Delivering ultrasonic energy to a target musculoskeletal tissue site includes connecting a delivery device to a vacuum source, a fluid source, and a power signal source. The delivery device has a housing portion maintaining an ultrasound transducer and a tip portion having a sleeve and a cannula. The cannula is coupled to the ultrasound transducer and received in the sleeve to define a covered portion and an exposed portion. Ultrasonic energy is generated by sending a power signal from the power signal source to the ultrasound transducer. The ultrasonic energy is transmitted from the ultrasound transducer to the cannula, such that the exposed portion of the cannula delivers ultrasonic energy at a frequency that is pre-selected to debride musculoskeletal tissue upon percutaneous insertion of the tip portion.
US09888936B2	Device and methods for use during arthroscopic surgery The present disclosure relates to a method of use during arthroscopic surgery. The method includes inserting a cannulated needle into a joint area of the body, inserting a guidewire through the needle, removing the needle, and inserting an arthroscopy knife into the joint area via the use of the guidewire. An arthroscopy knife and another method of its use is also disclosed.
US09888930B2	Aiming device The invention relates to an aiming device (15) for the placement of Kirschner-wires in orthopedics/traumatology. The aiming device (15) comprises an adjustable aiming block (10) which is displaceably attached to a forceps (20). The fixation of the aiming device at the bone (30) can be varied by clamping the forceps (20) more or less strongly. The aiming block (10) can be displaced to the periost (31) and be fixed. The aiming device (15) according to the invention allows the alignment of the guidance (2) of the Kirschner-wire (1) about an axis of rotation (12). Before the Kirschner-wire (1) is inserted in the bone (30) its position and direction can be intraoperatively represented and aligned in at least two non-parallel planes of projection (P1, P2) by means of fluoroscopy and/or navigation. Repeated drilling and mistaken positioning of the Kirschner-wire (1) can so be avoided. Thus, allowing to reduce the time of operation and the exposure of the patient to radiation.
US09888929B2	Drill, drill cover, and surgical instrument for collecting autologous bone employing same A drill and drill cover and autogenous bone collector using the same are provided. The autogenous bone collector comprises a shaft unit connected to a driving device and a cutting unit which revolves and collects bone particles of a patient. The cross-sectional area of the cutting unit is from 10% to 40% of an area of a circle having a radius corresponding to a distance from the center of the cutting unit to the outermost end portion of the cutting unit.
US09888925B2	Left atrial appendage devices and methods Devices and methods for clamping tissue and/or moving two tissue structures together by moving two plates or arm together. The pressure or force applied to the tissue may be used to bring the tissue together, to seal an opening or to cut through and remove a portion of the tissue. In one procedure disclosed, a clip applier may be used to apply one or more clips to the left atrial appendage of the heart to prevent clots from the left atrial appendage from embolizing and causing harm to the patient, such as a stroke.
US09888920B2	Connecting a plurality of tissue parts A device for fixing a first and a second tissue part or a tissue part and an implant part to each other is provided, providing a fastener including a thermoplastic material and a fastening instrument. The fastening instrument includes a first instrument component with a first contact surface facing toward a distal side and a second instrument component has a foot with a second contact surface distally of the first contact surface and facing toward a proximal side. The first instrument component and the second instrument component are displaceable with respect to each other, so that the fastener is compressible between the first and second contact surfaces by application of a relative force between the components. The instrument also includes an energy source for coupling mechanical energy into one of the instrument components to soften and/or melt an end portion of the fastener.
US09888919B2	Method and system for operating a surgical instrument A method and system for operating a surgical instrument. A surgical instrument can operate in an initial operating state and a secondary operating state. The secondary operating state can be one of a warned operating state or a modified operating state. After receiving feedback from the surgical instrument, an operator of the surgical instrument can decide whether to proceed to the warned operating state or the modified operating state.
US09888917B2	Medical device and method for injecting a fluid In one general aspect, a medical device can include an implant having a medial portion and a distal portion. The medical device can include a delivery member including a dilator having a distal portion, and a tube coupled to the dilator. The tube can define a lumen in fluid communication with an opening in the tube. The opening can be disposed between the distal portion of the implant and the distal portion of the dilator of the delivery member. The medical device can include a sleeve having a lumen. The distal portion of the implant and at least a portion of the delivery member can be disposed within the lumen portion of the sleeve.
US09888916B2	Method and device for securing body tissue A suture and a suture retainer are positioned relative to body tissue. Ultrasonic vibratory energy is utilized to heat the suture retainer and effect a bonding of portions of the suture retainer to each other and/or to the suture. Portions of the body tissue may be pressed into linear apposition with each other and held in place by cooperation between the suture and the suture retainer. The suture retainer may include one or more portions between which the suture extends. The suture retainer may include sections which have surface areas which are bonded together. If desired, the suture may be wrapped around one of the sections of the suture retainer. The suture retainer may be formed with a recess in which the suture is received. If desired, the suture retainer may be omitted and the sections of the suture bonded to each other.
US09888911B2	Surgical impaling member An implant for orthopedic surgery includes an impaling member (101,102), which is separable into portions (102a, 102b) for impaling and attaching to tissue, for example, bone. Once the portions (102a, 102b) of the impaling member (101,102) are separated and attached to the requisite tissue, they may accommodate stabilizing members for fixation, or other instrumentation for procedures such as fusion.
US09888907B2	Ultrasound diagnostic apparatus and ultrasound image producing method Disclosed are an ultrasound diagnostic apparatus and an ultrasound image producing method capable of producing a spatial compound image with reduced artifacts. Reception data of frame images is repeatedly acquired in a data acquisition cycle of four frames such that, of three frame images for use in producing a spatial compound image, the angle difference in steering angle between two frames for which the acquisition of reception data is most temporally separated is smaller than a maximum value among the angle differences in steering angle between two frame images among three frame images having different steering angles, and each time reception data of two frame images or reception data of another two frame images is acquired, three frame images sequentially produced based on reception data for three frames sequentially acquired hitherto are synthesized to produce a spatial compound image.
US09888905B2	Medical diagnosis apparatus, image processing apparatus, and method for image processing A medical diagnosis apparatus of embodiments includes a scanner and processing circuitry. The scanner configured to scan a three-dimensional region including a target region and acquire data of the three-dimensional region. The processing circuitry is configured to discretely arrange fixed points framing three-dimensional shape of the target region in a first medical image based on the data. The processing circuitry is configured to set a boundary of region of interest (ROI) on the three-dimensional shape of the target region according to a position of the fixed point. The processing circuitry is configured to receive an instruction to change a position of the boundary from an input device controlled by a user. The processing circuitry is configured to change the position of the boundary based on a position or positions of at least one of the fixed points according to the instruction while maintaining positions of the fixed points.
US09888904B2	Housing and connector for door using the same The present disclosure relates to a housing and a connector for a door using the same. The housing forming a skeleton of a connector for a door coupled with a counter connector which is mounted in a panel includes: a terminal seating space configured to be formed by penetrating through the housing back and forth and an electric wire seating space configured to communicate with the terminal seating space to be opened to a rear of the housing, and an electric wire guide cover configured to prevent the electric wire seating space from protruding backward so as to prevent a load from being applied to a grommet in which an electric wire is coupled with the housing.
US09888902B2	X-ray CT device, calcuration device, recording medium for X-ray CT device, and maintenance method for X-ray CT device In X-ray CT devices, degradation of quantitative determination ability for CT values resulting from the beam hardening (BH) effect of X-ray is prevented. X-ray absorption characteristic S obtained by simulation and a target value T thereof are saved beforehand, the simulation value S is revised by using projection data measured by maintenance measurement for obtaining basic data required for BH correction, and a BH correction coefficient is calculated by using the revised X-ray absorption characteristic S and the target value T. With a few actually measured values, BH correction accuracy can be improved, and reduction of incorrect diagnosis resulting from inhomogeneity of the CT values and improvement in the diagnostic ability based on improvement in quantitative determination ability for the CT values can be realized.
US09888901B2	X-ray diagnostic apparatus and X-ray CT apparatus An X-ray diagnostic apparatus according to an embodiment includes an X-ray tube, a detector, an acquisition circuitry, and imaging control circuitry. The acquisition circuitry creates photon count data indicating the number of photons of the X-rays incident on the detector, for each of a plurality of energy bins for identifying a plurality of target substances, based on the detection signal output by the detector. The imaging control circuitry determines an imaging plan including at least one of a setting condition that is a condition concerning setting of a plurality of energy bins used when the acquisition circuitry creates photon count data in main imaging, and an X-ray radiation condition that is a condition concerning X-rays emitted by the X-ray tube in main imaging, based on the photon count data created by the acquisition circuitry or image data of the subject.
US09888900B2	Imaging management apparatus, X-ray imaging system, method for processing information, and program A dose measured from region information, X-ray information, and a captured image in a previous imaging operation and a dose of radiation obtained from a DAP meter are saved as pieces of information. A dose used in a first imaging operation is based on the saved pieces of information, and a dose to be used in a second imaging operation is estimated from region information or X-ray information in the second imaging operation. If there is a significant difference between the dose in the first imaging operation and the estimated dose for the second imaging operation, a warning is issued. If an image of a region is captured for testing purposes, a warning is not issued.
US09888899B2	X-ray diagnostic apparatus An X-ray diagnostic apparatus according to one embodiment includes an X-ray generating device, an X-ray detector, an image generation device, a display device, a portion detection device, and an attenuation device. The X-ray generation device generates X-rays to irradiate an object. The X-ray detector detects X-rays transmitted through the object. The image generation device generates an X-ray image based on the detected X-rays. The display device displays the X-ray image. The portion detection device detects an exposure dose reduction target portion based on the X-ray image. The attenuation device attenuates the X-rays to irradiate a region including the detected portion.
US09888894B2	Multi-energy X-ray imaging Acquisition of X-ray transmission data at three or more energy levels is described. Various implementations utilize generator waveforms that utilize fast-switching, slow-switching, or a combination of fast- and slow-switching to transition between X-ray energy levels. In addition, various sampling arrangements for sampling and/or binning three or more energy levels of X-ray transmission data are discussed. The use of these data in subsequent processing steps, such for material decomposition and/or improvement of dual-energy material decomposition processing, are also described.
US09888890B2	Filter arrangement for CT system having a plurality of X-ray sources A filter arrangement is described. The filter arrangement includes an inner filter region, covering a cross-sectional area of a fan beam of a first X-ray source, and an outer filter region covering, together with the inner filter region, a larger cross-sectional area of a larger fan beam of a second X-ray source. The inner filter region has a first spectral filter function. The outer filter region is divided into a first subregion having a second spectral filter function and a second subregion having a third different spectral filter function. A computed tomography system is described. A method for producing a filter arrangement for a spectral filtering of X-ray radiation of a CT system having a first X-ray source and a second X-ray source is also presented. A method for reconstructing image data on the basis of projection measurement data is also described.
US09888887B2	X-ray diagnostic apparatus and X-ray diaphragm thereof An X-ray diagnostic apparatus according to the present embodiment includes: an X-ray tube which generates X-rays to be irradiated at an object; an X-ray diaphragm which houses an X-ray shielding member forming an irradiation aperture, through which the X-rays pass, along a side surface of the X-ray tube; an X-ray detector which detects X-rays passing through the object; and an image data generation circuitry which generates image data based on the X-rays detected by the X-ray detector.
US09888883B2	Sensor device for sensing body fluid density and/or membrane resistance The present invention relates to a sensor device for measuring tensile variation against a membrane separating a liquid such as the skin on humans and animals and any other membrane separating a liquid on one of its sides.
US09888881B2	Systems, methods, and devices for facilitating access to target anatomical sites or environments Methods and structures for detecting a physiologic parameter of a target anatomical environment. The device including a housing with a distal portion first port couplable to a probe and a proximal portion; and a sensing unit, a processing unit, and an output unit carried by the housing, the output unit configured to output a reporting signal based on the determined physiologic parameter value such as pressure; the sensing unit, processing unit, and output unit being disposed substantially between the first port and the proximal portion of the housing.
US09888879B1	Method and system for estimating fractional fat content of an object A method and system for estimating fractional fat content of an object of interest. An energy emitter is used to direct an energy signal with an energy signal electric field strength toward the region of interest, wherein the region of interest has an object of interest, a reference, and a boundary between the object of interest and the reference. Next, a thermoacoustic or ultrasonic transducer is used to receive a thermoacoustic bipolar signal from the boundary, wherein the thermoacoustic bipolar signal is induced by the energy signal. Finally, a machine is used to accept data from the energy emitter and thermoacoustic or ultrasonic transducer, correlate the thermoacoustic bipolar signal to an electric field strength of the reference at the boundary to generate a corrected thermoacoustic bipolar signal at the boundary, and calculate a fat concentration of the object of interest as a function of the corrected thermoacoustic bipolar signal at the boundary.
US09888875B2	Driver monitoring apparatus A driver monitoring system recognizes a state of a driver and determines a recognition stability. When the recognition stability is less than a predetermined reference value, the driver monitoring system makes a request to the driver to perform a different action that is different from an action requested when the recognition stability is not less than the reference value and detects an action of the driver that responds to the request.
US09888872B2	Tissue oximetry probe geometry for robust calibration and self-correction A sensor head for a compact oximeter sensor device includes light sources and light detectors. A compact oximeter sensor device implementation is entirely self-contained, without any need to connect, via wires or wirelessly, to a separate system unit. The sources and detectors are arranged in a circular arrangement having various source-detector pair distances that allow for robust calibration and self-correction in a compact probe. Other source-detector arrangements are also possible.
US09888869B2	Neural block determination An apparatus for neural block determination is provided including processing circuitry configured to receive muscle movement measurements, analyze the muscle movement measurements in a frequency domain, and determine an effectiveness of an anesthetic based on the analysis of the muscle movement measurements in the frequency domain.
US09888866B2	System for extracting respiratory rates from a pulse oximeter Accurate AR method for extracting respiratory rates directly from a pulse oximeter and accurate methods of extracting respiratory rates directly from a pulse oximeter under low signal-to-noise ratio (SNR) conditions.
US09888863B2	Method and device for measuring electrical impedance of biologic tissues A device for measuring an electrical impedance of biologic tissue may include electrodes configured to contact the biologic tissue and generate a differential voltage thereon. The device may include a first circuit coupled to the electrodes and configured to force an oscillating input signal therethrough, and a differential amplitude modulation (AM) demodulator coupled to the plurality of electrodes. The differential AM demodulator may be configured to demodulate the differential voltage, and generate a base-band signal representative of the demodulated differential voltage. The device may further include an output circuit downstream from the differential AM demodulator and may be configured to generate an output signal representative of the electrical impedance as a function of the base-band signal.
US09888860B2	Methods and systems for identifying and mapping cardiac activation wavefronts A map of cardiac activation wavefronts can be created from a plurality of mesh nodes, each of which is assigned a conduction velocity vector. Directed edges are defined to interconnect the mesh nodes, and weights are assigned to the directed edges, thereby creating a weighted directed conduction velocity graph. A user can select one or more points within the weighted directed conduction velocity graph (which do not necessarily correspond to nodes), and one or more cardiac activation wavefronts passing through these points can be identified using the weighted directed conduction velocity graph. The cardiac activation wavefronts can then be displayed on a graphical representation of the cardiac geometry.
US09888859B1	Directional dilator for intraoperative monitoring A stationary dilator includes one or more electrodes in the distal region that are rotatable around the longitudinal axis of the dilator. The one or more electrodes are operable to deliver electrical stimulation signals to tissue through which the dilator is passed. The stimulation signals can be used for determining nerve directionality and optionally nerve proximity during surgical procedures involving the presence of neural structures.
US09888858B2	Method and apparatus for detecting cardiac signals Devices and systems provide methods for detecting cardiac signals from head or facial biopotential sensors. In one embodiment, a facial biopotential signal is measured by a set of sensors. A processor derives a cardiac signal from the facial biopotential signal. Optionally, heart rate is detected from the cardiac signal. Heart rate variability may be determined and evaluated by the processor to generate warnings or messages from the evaluation. One or more head or facial biopotential electrodes for measuring the facial biopotential signal may be integrated in or at a contact surface of head support structures such as a headgear support or respiratory treatment mask. In some such embodiments a controller of a respiratory treatment apparatus may serve as a cardiac signal detector by processing the facial biopotential signal from the sensors and may make control adjustments or generate warnings based on an evaluation of detected signals.
US09888855B2	Reflection detection type measurement apparatus and method for skin autofluorescence Provided is a reflection detection type measurement method for skin fluorescence. The method includes: irradiating excitation light on a measurement target; detecting a reflected light and a skin fluorescence generated from the measurement target due to the excitation light; irradiating light with a wavelength range of the skin fluorescence on the measurement target; detecting a reflected light generated from the measurement target due to the light with a wavelength range of the skin fluorescence; and calculating a skin fluorescence value of the measurement target by correcting a calculation based on the detected reflected light and skin fluorescence.
US09888854B2	Biometric device, biometric method, program, and recording medium Provided is a biometric device including a light source unit arranged facing a first part on a surface of an organism and configured to irradiate the first part with excitation light, and a light-reception unit arranged facing a second part adjacent to the first part on the surface of the organism and configured to receive fluorescence light which is generated by the excitation light exciting a first body substance of the organism and emitted from the second part.
US09888853B2	Method for monitoring a physiological characteristic of human body based on WBAN The provided are a method and system for monitoring one or more physiological characteristic based on WBAN. The method includes: an node of a micro-network for monitoring the human body acquires physiological characteristic information of the human body; and a hub of the micro-network for monitoring the human body recognizes at least one identifier for identifying a physiological status of the human body according to the acquired physiological characteristic information of the human body, and selects, according to the at least one identifier for identifying the physiological status of the human body, whether to send the physiological characteristic information of the human body to a medical monitoring system terminal via a wireless network or not. According to the method, sign information of the monitored human body may be mastered in first time to provide a strong basis for subsequent treatment.
US09888852B2	Hand-held medical-data capture-device having determination of a temperature by a microprocessor from a signal from a digital infrared sensor and having interoperation with electronic medical record systems to transmit the temperature and device information In one implementation, an apparatus estimates body core temperature from an infrared measurement of an external source point using a cubic relationship between the body core temperature and the measurement of an external source point is described, estimates temperature from a digital infrared sensor and determines vital signs from a solid-state image transducer, or determines vital signs from a solid-state image transducer and estimates body core temperature from an infrared measurement of an external source point using a cubic relationship between the body core temperature and the measurement of an external source point; after which the estimated and/or determined information is transmitted to an external database.
US09888846B2	Ophthalmological apparatus An ophthalmological apparatus includes an optical system, a display device, a subject's eye position acquisition processor, and a control processor that acquires information on positional displacement of the optical system for inspection with respect to the subject's eye on the basis of the three-dimensional position to allow an alignment index image for performing alignment of the optical system for inspection with respect to the subject's eye in accordance with the information on positional displacement to be displayed in a screen of the display device in a pseudo manner, where the control processor has a plurality of display modes, in each of which the alignment index image is displayed in a different display form to allow the alignment index image to be displayed in the screen of the display device in a display mode selected from the plurality of display modes in a pseudo manner.
US09888839B2	Methods and apparatuses for determining contact lens intolerance in contact lens wearer patients based on dry eye tear film characteristic analysis and dry eye symptoms Methods and apparatuses for determining contact lens intolerance in contact lens wearer patients based on tear film characteristics analysis and dry eye symptoms are disclosed. In embodiments herein, imaging of the ocular tear film is performed during contact lens wear. An analysis of the image of the ocular tear film is performed to determine one or more tear film characteristics of the ocular tear film. The tear film characteristics can be used to determine the effect or possible effect of contact lens wear on the ocular tear film, and thus be used to determine contact lens intolerance of the patient. The tear film characteristics used to analyze contact lens intolerance based on images of the ocular tear film involving contact lens wear may include dry eye symptoms, including but not limited to tear film (e.g., lipid and/or aqueous) thickness, tear film viscosity, and tear film movement rate in the eye.
US09888838B2	Light source device A light source device to illuminate a target to be imaged by an imaging unit which includes N kinds of light detection elements which wavelength sensitivity regions are different each other includes a light source section, an insertion portion, an illumination light emitting portion and a light guide member. The light source section emits M kinds of narrow-band light which have different peak wavelengths, a difference between the peak wavelengths being equal to or more than an effective wavelength gap. The insertion portion is configured to be inserted into an internal space of an object. The illumination light emitting portion is provided in the insertion portion and which emits an illumination light. The light guide member guides the narrow-band light emitted from the light source section to the illumination light emitting portion.
US09888835B2	Endoscope and endoscopy method An endoscope is provided with a main part, an endoscope shaft and an imaging lens system. An imaging lens system includes a correction module, which comprises a splitter unit and a superimposition unit. Light is routed to the correction module via a first beam path, which is split into a first and a second partial beam path by the splitter unit. The splitter unit guides light from the visible spectrum into one of the two partial beam paths and light from the near infrared range into the other partial beam path. The superimposition unit superimposes the light from the two partial beam paths and guides it into a second beam path, coaxial with the first beam path. The optical path lengths of the two partial beam paths for the light from the visible spectrum and the light from the near infrared range are selected such that they are different.
US09888830B2	Dishwasher utensil basket A dishwasher utensil basket includes a mechanism for unloading multiple utensils at once without the user having to directly handle the utensils. The mechanism can include a grid that is loaded with utensils for treatment. The basket can include multiple zones for loading utensils, each provided with an individually-operable unloading mechanism. A user can unload the basket by holding a handle of the basket in one hand and squeezing an actuator of the mechanism toward the handle using the thumb of the same hand.
US09888827B2	Dishwasher appliance and a method for forming a unitary tub A dishwasher appliance with a tub that defines a wash chamber is provided. A bottom wall of the tub defines a volute. An impeller is positioned within the volute of the bottom wall, and a motor mounted to the tub at the bottom wall of the tub. The motor is coupled to the impeller such that the motor selectively rotates the impeller within the volute of the bottom wall. A related method for forming a unitary tub for a dishwasher appliance is also provided.
US09888826B2	Environment-protection energy-saving barrel An environment-protection energy-saving barrel is an integral formed by three parts, i.e. an outer barrel, a middle barrel and an inner barrel. The inner barrel is communicated with the middle barrel; the bottom of the middle barrel is provided with a water inlet pipeline; the water inlet pipeline is communicated with the bottom of the outer barrel used for storing water; a water inlet quantity controller is arranged on the water inlet pipeline; the inner barrel communicated with the middle barrel is used for dewatering and cleaning a mop; and the water inlet quantity controller arranged on the water inlet pipeline is used for controlling the water inlet quantity which flows into the middle barrel from the outer barrel and controlling the on/off of a valve of the water inlet pipeline. Therefore the water in the barrel can be repeatedly used.
US09888815B2	Hand sanitizer latch control A system having a dispenser enabled to contain and dispense a liquid or semi-liquid material and located on a wall of a facility having a door, a user-operable triggering mechanism causing dispensing of a volume from the dispenser upon operation of the triggering mechanism, and a door latch mechanism incorporated at an opening edge of the door of the facility and coupled to the dispenser in a manner that operating the triggering mechanism to dispense the volume also unlatches the door latch mechanism, allowing the door to open.
US09888810B2	Toaster A toaster for evenly toasting bread products is provided. The toaster comprises at-least one heating zone inside a toasting chamber, the heating zone having at-least one baffle provided on top of at-least one heating element, the baffles trapping the hot air and reducing the rate at which hot air moves up maintaining a minimum temperature gradient along the toaster, thereby evenly toasting the bread product.
US09888809B2	Steam oven installation There is disclosed a steam oven installation, that in certain embodiments, comprises: a steam oven; a supply steam line for receive a superheated steam flow and for delivering supply steam to the steam oven; an injector for injecting a volume of control fluid into the supply steam line; a monitor for monitoring at least one thermodynamic property of steam within the steam oven installation; and a controller for controlling the injection of the control fluid based on the at least one monitored thermodynamic property so that the supply steam flow delivered into the steam oven comprises substantially dry saturated steam. There is also disclosed a corresponding method of controlling the supply of steam to a steam oven in a steam oven installation.
US09888806B2	Capsule, device, and method for preparing infused beverages A device 120 for preparing infused beverages including: a capsule 102, with the front face 103 in a substantially vertical position; an injector 124 for introducing an infusing liquid into the capsule 102 through the frangible region 116 when the capsule 102 is in the receptacle 118; and an infusion vessel 123 with a substantially vertical side opening 125 to the receptacle 118, so as to be in fluid connection with the filter wall 114 of the capsule 102 when the capsule 102 is in the receptacle 118, and an openable and closable bottom opening 127 to allow an infused beverage to flow out of the infusion vessel 123.
US09888805B2	Brewing assembly for a machine for the preparation of beverages using capsules The brewing assembly (1) comprises a support structure (2) which is operationally stationary and in which the following are mounted: a movable part (4) including a cup-shaped body (5) in which there is defined a receptacle (6) suitable for receiving a capsule (C) or the like containing a substance for the preparation of a beverage; a cooperating locating part (9) provided with a member (10) for performing perforation and/or injecting water and/or steam; and a displacement mechanism (11) for causing displacement of the movable part (4) between an open position, remote from the locating part (9), in which the cup-shaped body (5) is in a position suitable for receiving a capsule (C) or the like, and a closed position, in which the cup-shaped body (5) is able to be coupled with the locating part (9) so as to define therewith a brewing chamber in which the capsule (C) is sealingly clamped, for preparation of the beverage. When passing from the closed position to the open position the movable part (4) performs an initial movement away from the locating part (9) and a subsequent movement during which it substantially pivots about an at least approximately horizontal transverse axis.A disengagement member (30) protruding axially beyond the cup-shaped body (5) towards the locating part (9) is fixed to the movable part (4) and is configured and arranged such that during the subsequent pivoting movement of the movable part (4) its path is able to interfere with a used capsule (C) which may be still attached to the locating part (9) so as to cause it to be detached therefrom.
US09888802B2	Centrifugal separator for separating fruit or vegetable juice from fruit or vegetable pulp The present application relates to a centrifugal separator for separating fruit or vegetable juice from fruit or vegetable pulp. The centrifugal separator comprises a body (22) configured to rotate about a central axis (24), a chamber (28) formed by the body (22) for receiving pulp and juice, and an elongate aperture (29) defined by and extending arcuately around the body (22). Therefore juice in the chamber (28) is urged to flow through the aperture (29) when the body (22) is rotated about the central axis. The present application also relates to a juicer for extracting fruit and or vegetable juice from fruit or vegetable pulp comprising a centrifugal separator.
US09888800B2	Rotatable serving carousel for outdoor table A rotatable serving carousel is configured to provide serving elements extending from a centerpiece. Bowls or other useful items may be placed or connected with a carrier of the serving element. At least one arm extends from the second portion of the centerpiece to the carrier(s) and allows for rotation of the bowl generally horizontally over the table through the connection with the arm to the second portion. A user may manually push or pull on any portion of the serving element to rotate the bowl to a desired position relative to the table. The serving carousel may be provided with one or more serving elements and bowls, and the carousel improves access to these bowls while also lifting those elements off a tabletop surface to allow for more space efficiency in outdoor patio furniture using the serving carousel.
US09888797B2	Dual-purpose dispensing container and utensil Disclosed are dual-purpose dispensing containers and utensils for dispensing measured amounts of beverage or food ingredients, useful for the preparation and consumption of the beverages and foods. A dual-purpose dispensing container and utensil comprises a handle having a functional part at first end thereof, the functional part configured for preparing and/or consuming a beverage or foodstuff, at least two compartments extending from a lower surface of the handle and along a longitudinal length of the handle from a second end of the handle opposite the first end. Each two neighbor compartments are spaced apart a pre-selected distance from each other. A cover is attached to the handle along a perimeter of a top opening of each one of the compartments on an upper surface of the handle. Each compartment is configured to contain ingredient for dispensing into a liquid beverage or solid foodstuff for preparing the liquid beverage or solid foodstuff.
US09888794B2	Combined plate and collapsible beverage holder An apparatus includes a plate defining a surface for holding food and further defines at least one opening therein. A collapsible beverage holder fits within the at least one opening defined within the surface of the plate and moves between a collapsed configuration responsive to the apparatus being placed on a surface and an un-collapsed configuration responsive to the apparatus being lifted off the surface by the plate. A plurality of flexible latching tabs secures the collapsible beverage holder to an edge of the at least one opening. The plurality of flexible latching tabs further comprises at least one locking member for engaging the edge of the at least one opening to removeably secure the collapsible beverage holder to the plate. A flexible member interconnects the at least one locking member to the collapsible beverage holder. The flexible member enables the at least one locking member to be moved between a first position for inserting and removing the collapsible beverage holder from the plate and a second position for securing the collapsible beverage holder to the plate.
US09888793B2	Travel pillow for sleeping in a vertical or near-vertical reclined position The present invention is directed towards a travel pillow for sleeping in a vertical or near-vertical reclined position. When sleeping in these positions, gravity tends to pull the head forward of the shoulders causing it to droop. The current state of the art travel pillow does not provide a support means to counter this forward drooping tendency. Moreover, its rear support displaces the cervical spine forward, further increasing the tendency for the head to slump forward. The present invention holds a resting head in an upright and stable position to prevent forward head drooping and does so without forwardly displaying the cervical spine. The five novel elements of the present invention are integrally configured to maintain a healthy alignment between the occipital bone of the head, the cervical spine of the neck, and the thoracic spine of the upper back.
US09888786B2	Child sleeping apparatus A children's sleeping apparatus includes a structural support frame and a child receiving receptacle supported by the structural support frame. The child receiving receptacle is preferably movably coupled to the structural support frame to provide pivotal motion of the child receiving receptacle relative to the structural support frame.
US09888784B2	Traveling wave air mattresses and method and apparatus for generating traveling waves thereon A traveling wave air mattress apparatus includes an air mattress comprised of a array of laterally disposed, longitudinally spaced air bladder cells that are individually inflatable to quiescent pressure levels which provide comfortable support for a human body, and an air pressure-pulse generator controlled by a wave sequence generator for periodically introducing into a sequence of the air bladder cells a time sequence of air pressure pulses which vary pressures in the cells from quiescent pressures, the air pressure variations resulting in a soliton-like traveling wave of body support force variation which travels longitudinally over the surfaces of the pulsed air bladder cells, thus inhibiting formation of bedsores. The wave pattern may optionally simulate water waves and/or rocking motions of a boat to produce relaxing effects.
US09888775B1	Cabinet with sliding doors A cabinet is provided with a housing including a rear wall, a first side wall, a second side wall opposite to the first side wall, a bottom, a top frame member, and a front frame member, and two sliding doors, each disposed on the top frame member, the front frame member, and one of the first and second side walls. The housing is shaped as a truncated trapezoid in its side elevation.
US09888772B2	Storage rack system A storage rack system includes a horizontal support surface. A rack is hingedly coupled to the horizontal support surface. The rack is selectively positioned in a stored position having the rack being coextensive with the horizontal support surface. The rack is positioned in a deployed position having the rack extending downwardly from the horizontal support surface. Thus, the rack is accessible. Thee rack stores a plurality of fishing rods. A pulley unit is coupled between the horizontal support surface and the rack. Thus, the pulley unit may be manipulated. The pulley unit selectively urges the rack between the stored position and the deployed position.
US09888770B1	Shelf assembly A shelf assembly includes four vertical posts each having vertically spaced first engaging holes and vertically spaced second engaging holes. Each of two horizontal beams includes a first board. Each end of each horizontal beam includes a third engaging groove and a first buckle having a first coupling groove. Each of two connecting beams includes a second board. Each end of the second board includes a second buckle having a second coupling groove. A support board is mounted on top of the horizontal beams and the connecting beams. Each first buckle engages one of the first engaging holes. Each second buckle extends through one of the third engaging holes and one of the second engaging holes. Each first coupling groove engages a bottom edge of one of the first engaging holes. Each second coupling groove securely receives a corresponding connecting wall and the first board of a corresponding horizontal beam.
US09888765B2	System of retractable shelves The retractable shelf system allows for the compartmentalization of storage container. The system is integrated into the interior space of the storage container and includes a plurality of shelving units distributed along the length of the storage container.Each shelving unit includes a first retractable shelf and a second retractable shelf. The first retractable shelf and the second retractable shelf each include a storage panel, a support beam, a hinge mechanism, and an at least one support leg. The support beam from each retractable shelf is mounted parallel and offset to each other within the storage container. The storage panel is mounted adjacent to the support beam by the hinge mechanism. The support leg is hingedly connected to a bottom surface of the support storage panel, opposite the support beam. The first retractable shelf and the second retractable shelf can be positioned into a retracted configuration and a functional configuration.
US09888764B2	Mat device for cleaning cosmetic brushes A brush cleaning device includes a flexible body having first and second opposed surfaces defining a top and a bottom. A plurality of different brush treatment surfaces are provided on the top of the flexible body, variously configured for washing and rinsing bristles of brushes having different sizes.
US09888760B2	Rod-shaped cosmetic container A cosmetic container (1) has a cap (3) with a first cap portion (11). An inner cylinder (13) is fit internally to an upper part of the first cap portion, and a return spring (20) biases the inner cylinder up. A second cap portion (12) is fit rotatably on the first cap portion. The first cap portion has a temporary holding hole (22) in which a guide protrusion (13a) of the inner cylinder is held temporarily against the biasing force of the return spring so that an upper end of the inner cylinder is lower than an upper end portion of the first cap portion when the guide protrusion is held temporarily in the temporary holding hole. Thus, the upper end of the first cap portion can deform to bend inward without being obstructed by the inner cylinder when the second cap portion is fit on the first cap portion.
US09888759B2	Drawing device and method of drawing A drawing device includes a pen that applies a liquid material to a drawing surface and a cap that covers a tip side of the pen and is arranged at a standby position of the pen. The cap includes: an inner cap that has an opening and covers the tip side of the pen when a periphery of the opening is brought into contact with the outer peripheral surface of the tip side of the pen; an outer cap that has an opening, is arranged outside of the inner cap, and covers the tip side of the pen that is covered by the inner cap when the pen is locked into the outer cap; and an elastic member that is arranged between the outer cap and the inner cap and energizes the inner cap towards an opening side of the outer cap. The pen and the outer cap each have an interlockable locking mechanism.
US09888753B2	Protective enclosure for a portable electronic device A protective enclosure for use with a portable electronic device includes a rigid shell and a cushion layer. The rigid shell is configured to removably cover at least a portion of the portable electronic device. The rigid shell includes openings and one of a tab and a groove on an external surface of the rigid shell. The cushion layer is removably disposable over the rigid shell and conforms to the external surface of the rigid shell to cushion the rigid shell. The cushion layer includes one of a groove and a tab that corresponds to and interfaces with the one of a tab and a groove of the rigid shell to retain the cushion layer to the rigid shell when the cushion layer is disposed over the rigid shell. The cushion layer further includes an opening that aligns with at least one of the openings of the rigid shell.
US09888751B2	Umbrella An umbrella includes (a) a rod assembly including a plurality of rods; (b) a canopy connected to the rod assembly and movable between an open position in which the canopy is deployed and a closed position in which the canopy is retracted; (c) a stationary handgrip connected to the rod assembly for grasping the umbrella; (d) a trigger assembly that is releasably connected to at least one rod of the rod assembly, wherein, upon actuation of the trigger assembly, the trigger releases the at least one rod of the rod assembly which deploys and causes the canopy to move from the closed position to the open position; and (e) a handle movable with respect to the handgrip and connected to the rod assembly, the handle being translatable to move the canopy from the open position to the closed position.
US09888750B2	Manual tool for precision forming of ear wires for jewelry A tool is provided for bending wire for use in earrings. The tool has a two handles; an anvil plate; two terraced floating bars; two forming links, each having a stanchion projecting therefrom and a forming link rod projecting from the first forming link; an upper and lower linkage arm; a translating pin; and a planetary gear having an eccentric forming rod projecting from its lower face. The anvil plate has a longitudinal slot and arcuate minor and major forming slots formed therethrough; a circumferential gear formed on one side of the anvil plate, adjacent and exterior to the major forming slot, spanning less than 360°; and a retaining wall and a forming anvil formed on the other side of the anvil plate. The handles are pivotally joined to the anvil plate such that the forming link rod and a stanchion engage a wire lying against the retaining wall.
US09888747B2	Zip fastener A zip fastener comprises two opposing and mutually engageable rows of zip teeth each being mounted upon a respective stringer tape; first and second sliders movably mounted upon the teeth, each slider being movable forward along the teeth to cause interdigitation of the teeth thereby to fasten the zip and backwards to cause extradigitation and unfastening of the zip, the sliders being mounted on the teeth in opposing directions such that motion of the sliders towards and away from each other results in the same action (e.g. fastening or unfastening) on the zip teeth; a docking member, mounted upon the teeth and being movable along the teeth, the docking member being mounted between the two sliders; and each slider being engageable with the docking member thereby to fasten the zip.
US09888743B2	Reinforcement component for an article of footwear A reinforcement component for an article of footwear is formed by a folded knit element. The knit element includes a plurality of strap members that are separated by slits when the knit element is in a contracted position. In an expanded position, the slits become openings between the plurality of strap members. The knit element has an upper portion that is folded over a lower portion so that ends of the plurality of strap members are brought together and a plurality of loops are formed along a top of the folded knit element. The folded knit element forms the reinforcement component and the plurality of loops are configured to receive a lace. Forces applied to the reinforcement component by the lace are distributed through the plurality of strap members across the upper of the article of footwear.
US09888740B2	Multiply shockproof, hygroscopic and breathable shoe pad and shockproof, hygroscopic and breathable shoe A multi-ply shockproof, hygroscopic and breathable shoe pad includes, from bottom to top in succession: a support bottom layer (1), wherein a lower end face of the support bottom layer (1) is provided with a plurality of protruding portions (5), an upper end face of the support bottom layer (1) is provided with air holes (6), and the protruding portions (5) and the air holes (6) are alternately arranged; an elastic interlayer (2), wherein the elastic interlayer (2) is provided with air holes (6), and is coated with an antibacterial deodorization layer; a hygroscopic interlayer (3), wherein the hygroscopic interlayer (3) is provided with air holes (6), and is coated with an antibacterial deodorization layer; and a breathable waterproof layer (4) coated with an antibacterial deodorization layer; and the support bottom layer (1), the elastic interlayer (2), the hygroscopic interlayer (3), and the breathable waterproof layer (4) are successively bonded.
US09888737B2	Systems and methods for eyelash extensions Embodiments disclosed herein describe systems and methods for applying branched eyelash extensions, wherein two types of eyelash extensions are coupled to the user's natural eyelash. In embodiments, an eyelash extension of a first type may be coupled to a user's natural lash in a first direction, and an eyelash extension of a second type may be coupled to the user's natural lash in a second direction.
US09888736B1	Fastener for garment drawstrings, laces, and the like A fastener connects two strings together, such as the drawstring of sweatpants or the two shoe lace strings ends of respective shoe lace strings in a pair of sneakers. The body of the fastener is made out of a material, such as highly dense polyurethane foam, that is strong, yet flexible, or of a rigid plastic, that is strong, yet flexible. The two strings to be fastened pass through one or more gripping and/or locking holes in the fastener body. When the shoelace is passed through the gripping and/or locking holes, the dense polyurethane foam grips the lace tightly. The free ends are pulled through one or more peripheral slits extending towards, but not all the way to, the gripping and/or locking holes and then bent against the upper outer surface of the disk and locked in place in the respective one or more peripheral locking slits.
US09888735B2	Clothing and clothing article Provided is a clothing as well as a clothing article having a similar structure of the clothing, the clothing comprising a base layer (200) having an inner surface and an outer surface; the inner surface being substantially planar and forming a first fluid passage (400) with human skin (200); the outer surface being formed as a flow-disturbing face or the outer surface being attached with components having flow-disturbing face; the base layer being provided with at least one through opening (500), through which the first fluid passage being communicated with the flow-disturbing face. The clothing and the clothing article of the present invention is particularly suitable for sports.
US09888734B2	Energy absorbing athletic glove An energy absorbing receiving glove constructed with a substrate having an exterior surface and a complementary interior surface. The substrate is used in constructing a palmar portion of the glove. The glove may incorporates a gripping layer of material affixed to the exterior surface of the substrate. Further, the glove may incorporate an energy absorbing layer of material affixed to the interior surface of the substrate. Additionally, the energy absorbing layer of material may have both a first thickness in a first location and a second thickness in a second location of the substrate. In an embodiment, the energy absorbing material is a silicone gel and the gripping material is a silicone material. Additionally, the varied thicknesses of the energy absorbing material may be effective for covering a palmar side of joints located on a hand wearing the glove.
US09888733B2	Protective device for use with a glove A protective device for use in a high temperature and liquid environment provides a glove integrally formed with a protective member in the thumb webbing region. The protective member is not readily detectable when viewing the outside of the glove. The protective member is cut resistant and constructed to protect a workman's hand as a sharp and hot object passes over the protective member contacting the outer surface of the glove.
US09888730B2	Aquatic sport performance garment with restraints and method of making same An aquatic sport performance garment comprising restraints affixed to a lateral material surface of the aquatic sport performance garment approximately parallel to a sagittal plane along each side of the garment and further comprising restraints affixed to a material surface across the back of the aquatic sport performance garment, posteriorly offset from the coronal plane of the garment in a criss-cross fashion, intersecting the longitudinal axis with the ends of the criss-cross restraints located in proximity to the ends of the longitudinally placed lateral restraints on each side of the garment; said restraints configured to inhibit side-to-side bending of the body of a user, reduce longitudinal drag, improve stroke mechanics, encourage proper torso rotation and muscle coordination about the midsection of the body of the user during movement and improve endurance when the garment is worn by the user when swimming.
US09888727B2	Heating assembly, atomizer and electronic cigarette having same An exemplary heating assembly includes a substrate, a heating part formed on the substrate, an electrode part connected with the heating part, and a liquid conducting body configured for absorbing tobacco liquid. The liquid conducting body is in tight contact with the substrate. The liquid conducting body is capable of conveying the tobacco liquid to the substrate.
US09888726B2	Electronic cigarette battery assembly An electronic cigarette battery assembly, including a charging electrode, the charging electrode including an inner electrode arranged on the inner rim thereof and having a spherical cap end face, and an outer electrode arranged outside the inner electrode and having a ring shape; the charging electrode and the rechargeable battery of the electronic cigarette being connected by means of a control module, when it is necessary to charge the rechargeable battery, one need only connect the charging electrode to the electric power output terminal of the external charger in order to charge the rechargeable battery. There is no need to remove the rechargeable battery, thus the invention is very convenient to use and solves the problems of existing electronic cigarettes, wherein it is inconvenient to remove a rechargeable battery for charging and the electrical connection is unreliable due to loosening of the battery.
US09888715B2	Electronic cigarette case An electronic cigarette case for accommodating a cigarette. The electronic cigarette case comprises a housing main body and a rotation door mechanism arranged on the housing main body; the housing main body comprises a housing top face and a housing bottom face opposite to each other, and at least one first housing side face which is arc-shaped with a certain radian, an opening is formed in the first housing side face for picking and placing the cigarette; the rotation door mechanism at least comprises a rotation door which has an arc-shaped surface matching with the radian of the arc-shaped first housing side face, for covering the opening, and the rotation door is configured to have a capability of rotating along an arc plane defined by the radian thereof to expose the opening so as to take out or put into the cigarette.
US09888710B2	Method for producing cooked egg product having irregular shaped egg curds Provided are methods of manufacturing a cooked egg product having irregular shaped egg curds similar in shape, size, and mouthfeel to that of freshly cooked scrambled eggs. Liquid egg product is optionally first preheated then transferred to a belt oven and cooked to form a layer of cooked egg product. The layer of cooked egg product is then transported through an agitator, which initially breaks down the layer of cooked egg product, and subsequently is passed through a forming plate to shape the cooked egg product into irregular shaped egg curds similar in appearance to that of freshly cooked scrambled eggs. This process allows for a simplified ingredient deck and reduces the number of fines present in the final product.
US09888705B2	Sealed pack of ingredients for an individual smoothie, and associated methods and apparatuses A sealed pack (440) contains quantities of ingredients to make an individual smoothie portion. The ingredients comprise a flavour ingredient (410) such as pieces of fruit (strawberries, raspberries, mango), a frozen portion of liquid (420) such as water, fruit juice, milk, coffee or tea; and a consistency ingredient (430) such as ice-cream, sorbet and yoghurt. The pack may be subjected to a temperature sufficiently low to maintain the frozen state of some of the ingredients in the pack (440). Also disclosed is a method of packaging the ingredients into the pack, or into first and second containers, or into a container with compartments for different ingredients in frozen and unfrozen states; and a method of preparing an individual smoothie using the sealed pack wherein the ingredients are blended with additional liquid; and an apparatus that uses sealed pack for automatically vending an individual smoothie portion.
US09888700B2	Process for the preparation of structured oil phase Process for manufacturing a spreadable edible emulsion, the emulsion comprising oil, water and a micronized fat powder, wherein during processing the oil with the fat powder with a minor amount of water is stored for a period of from 8 hours to 7 days prior to further processing.
US09888699B2	Product and process for its preparation The invention relates to a low-energy, low-fat or fat-free, high-protein soured or unsoured product prepared by means of a crosslinking enzyme, and to a process for the preparation thereof.
US09888690B2	Insecticidal compounds from Nothapodites foetida and process for the extraction thereof The present invention relates to an insecticidal enriched extract (biopesticide) isolated from the stem of Nothapodites foetida (Wight) Sleumer (formerly Mappia foetida (Miers) useful for the insect free storage and transport of grains and seed. The insecticidal activity of the enriched extract (biopesticide) of the invention is ascribed to compound/s other than camptothecin. The invention further relates to the process for preparation thereof, containing Compounds of general formula 1 and formula 2 (General formula 1) wherein R1=CH3, CH2OAC and wherein R2=COOH, or (I) and R3=H. OH. (Formula 2)
US09888689B2	Compositions containing a pyripyropene insecticide and an adjuvant The present invention relates to a compositions comprising a pyripyropene pesticide of the formula (I) or (II) as defined below and an adjuvant. The present invention relates also to methods of preparing and applying such compositions, as well as several uses thereof, and finally seeds, comprising said composition.The invention also relates to an aqueous pesticide formulation comprising a pesticide compound of the formula I as defined in claim 1 in the form of fine particles suspended in an aqueous liquid.
US09888688B2	Tetrazolinone compounds and applications thereof A tetrazolinone compound represented by formula (1): wherein Q represents a 6-membered aromatic heterocyclic group optionally having one or more atoms or groups selected from Group P1, provided that a heteroatom constituting the heterocyclic group is a nitrogen atom, and the number of nitrogen atom is 1, 2, or 3; R1, R2, R3, and R11 each represents a C1-C6 alkyl group optionally having one or more atoms or groups selected from Group P2; R4 and R5 each represents a hydrogen atom, etc.; R6 represents a C1-C6 alkyl group optionally having one or more halogen atoms, etc.; R7, R8, and R9 each represents a hydrogen atom, etc.; and X represents an oxygen atom or a sulfur atom, has excellent control activity against pests.

1 2 3 4 5 6 7 8 9 10