Document | Document Title |
---|---|
US09518189B2 |
Binder solutions
The present invention is directed to alternate solvent systems for polyethersulfone, polyamideimide, polyether imide, polyimide, and/or polyamic acid binder solutions. The present invention provides stable binder solutions equivalent or superior to current binder solvent solutions. |
US09518188B2 |
Method of printing a conductive article and articles made thereby
A method of printing articles having variable conductivities, including those having conductivity gradients. |
US09518187B2 |
High-gloss surface by means of hot-coating
The present invention relates to a process for producing high-gloss surfaces on at least one portion of a substrate area, where the steps comprise (a) applying a layer made of a melt to at least one portion of the substrate area; (b) polishing of the applied layer of melt; (c) applying at least one lacquer layer to the polished layer of melt by means of a curtain-coating process; and (d) hardening the layer structure applied. The invention further relates to articles obtainable by this type of process. |
US09518180B2 |
Method for producing polyacrylic acid (salt)-based water absorbing agent, and water absorbing agent
The present invention relates to an absorbent suitable for use in a thin sanitary material/absorbent article having a high absorbent content and not prone to gel blocking, the absorbent having excellent liquid diffusibility (e.g. SFC) and minimal decrease in absorption ratio under pressure (e.g., AAP or PUP) even when a liquid permeation enhancer is added, and to a method for manufacturing the high-performance absorbent stably during actual production. The method is a method for manufacturing a polyacrylic acid (salt)-based absorbent, having a surface-crosslinking agent addition step for adding a solution of a surface-crosslinking agent, and a liquid permeation enhancer addition step for adding a liquid permeation enhancer, the liquid permeation enhancer addition step being performed after and/or at the same time as the surface-crosslinking agent addition step, the method characterized in that a surface crosslinking step for performing heat treatment in an atmosphere having a dew point of 45° C. to 100° C. is performed after or at the same time as the surface-crosslinking agent addition step. |
US09518178B2 |
Milling process
The invention pertains to a process for cryogenic milling mixtures of (per)fluoroelastomers and semicrystalline thermoplastic VDF polymers, and to free-flowing micronized pellets obtainable therefrom, said micronized pellets advantageously yielding, after extrusion and compounding, excellent mechanical properties, even improved over those of base fluoroelastomer matrix. |
US09518177B2 |
Composite material for means of transport including polypropylene resin and long carbon fiber
The present invention relates to a composite material for a transport, including a polypropylene resin and a carbon long fiber, and more particularly, to a fiber reinforced composite material composition for a transport including 40-90 wt % of a polypropylene resin, 5-60 wt % of a carbon long fiber having a fiber diameter of 1-50 μm and a weight average fiber length of 20-150 mm, and 0.3-10 wt % of a compatibilizer. The compatibilizer includes one selected from the group consisting of an ionomer, a copolymer of propylene-polar monomer, a modification water added polymer and combinations thereof. The composite material has improved interface properties between the polypropylene resin and the carbon long fiber owing to a specific compatibilizer, improved rigidity, impact resistance and heat resistance, and may be applied to various fields requiring the fiber reinforced composite material as well as various transports including an automobile. |
US09518176B2 |
High temperature geomembrane liners and master batch compositions
Geomembrane liners suitable for use at elevated temperatures up to 100° C., as well as master batch compositions suitable for preparing such geomembrane liners. |
US09518167B2 |
Bioderived based plasticizers
A bioderived based plasticizer is produced by reacting a bioderived diol (and/or a bioderived alcohol) and a bioderived carboxylic acid in the presence of N,N′-dicyclohexylcarbodiimide (DCC), wherein the bioderived carboxylic acid includes a hydrolyzed oil. The bioderived carboxylic acid (e.g., linoleic acid, α-linolenic acid, oleic acid, and mixtures thereof) may be produced by hydrolyzing a triglyceride, such as canola oil, linseed oil, soybean oil, and mixtures thereof. In one embodiment of the present invention, a bioderived based plasticizer is produced by reacting 2,5-bis-(hydroxymethyl)furan and α-linolenic acid in the presence of DCC. In some embodiments of the present invention, the bioderived based plasticizer is blended into one or more polymers. |
US09518166B2 |
Film forming auxiliary agent composition for emulsion resin
A film forming auxiliary agent composition for an emulsion resin in accordance with the present invention is characterized in that containing a specific ester compound (A) and a specific fatty acid (B), and having an acid value of 0.05 to 5 mg KOH/g, said composition has low odor, a high boiling point and good film forming ability, and the emulsion resin that is blended with said composition has good long-term storage stability. |
US09518161B2 |
Polymer compositions, methods of making the same, and articles made therefrom
The present disclosure is directed to compositions and methods for improving the cling performance in stretch-cling films. Compositions include: (a) 80.0 to 99.5 wt. % of a propylene-based elastomer, the propylene-based elastomer comprising at least about 60.0 wt. % propylene-derived units and about 5.0 to about 25.0 wt. % ethylene-derived units, based on total weight of the propylene-based elastomer, wherein the propylene-based elastomer has a heat of fusion of less than about 80.0 J/g; and (b) 0.5 to 20.0 wt. % of a polyalphaolefin, wherein the amounts of the propylene-based elastomer, and the polyalphaolefin are based on the weight of the composition. Methods of making such compositions as well as compositions including an ethylene-based polymer and films and methods of making films are also disclosed. |
US09518153B2 |
Polymerizable composition for optical materials
The present invention addresses the problem of providing: a catalyst for preliminary reaction and a preliminary reaction method, which are suitable for a composition that is obtained by adding a thiol compound and an isocyanate compound to an episulfide compound; and a polymerizable composition for optical materials, which is capable of preventing yellowing of an optical material which contains a composition that is obtained by adding a thiol compound and an isocyanate compound to an episulfide compound. The above-mentioned problem can be solved by a polymerizable composition for optical materials, which contains a thiourethane oligomer that is obtained by preliminarily reacting the whole or a part of a thiol compound and an isocyanate compound in a composition that contains an episulfide compound, the thiol compound and the isocyanate compound, while using a compound represented by formula (2) below as a catalyst for preliminary reaction In formula (2), R represents an alkyl group having 1 to 4 carbon atoms; and X represents an organic group which has 2 to 11 carbon atoms and contains a vinyl group, a vinylidene group or a vinylene group. |
US09518143B2 |
“No-bake” foundry mix with extended work time
A “no-bake” process allows the forming of larger metal castings, by providing longer work times, in the range of about 45 to about 60 minutes. This is achieved using a liquid curing catalyst that is a pyridine, substituted at the second or third position with a moiety having a molecular weight in the range of about 30 to about 100 mwu. Examples of the liquid curing catalyst include 2-ethanolpyridine, 3-chloropyridine and 2-methoxypyridine. When combined with a two-part polyurethane binder precursor and a foundry aggregate, the liquid curing catalyst provides not only the longer work time, but also a strip time that is less than about 167% of the work time, as measured from the point of activating the polyurethane precursors by mixing them in the presence of the curing catalyst. |
US09518142B2 |
Process for preparing isocyanate homopolymers containing uretdione groups
The present invention relates to a process for preparing isocyanate homopolymers containing uretdione groups, in which the phosphinoboron compound of formula (I) are used as catalysts to catalyze the homopolymerization reaction of raw isocyanates, thereby obtaining a solution of isocyanate homopolymers having uretdione groups, then separating the solution and thus obtaining the isocyanate homopolymers containing uretdione groups. The isocyanate homopolymers containing uretdione groups prepared by this process have a high amount of the uretdione groups, wherein the dependence of the amount on the conversion rate of raw isocyanates is significantly ameliorated, with low chromaticities. |
US09518137B2 |
Ethylene propylene-diene interpolymer composition
The present disclosure is directed to a composition and articles containing the composition. The composition includes an ethylene-propylene-diene interpolymer (EPDM) having a rheology ratio greater than 33. The EPDM also has a molecular weight distribution greater than 3.0. The composition has a dissipation factor less than or equal to 0.01 radians as measured in accordance with ASTM D 150 (130° C., 60 Hz). |
US09518136B2 |
Control over reverse addition fragmentation transfer polymerization processes
A procedure for improved temperature control in controlled radical polymerization processes is disclosed. The procedure is directed at controlling the concentration of the persistent radical in ATRP and NMP polymerizations procedures and the concentration of radicals in a RAFT polymerization process by feeding a reducing agent or radical precursor continuously or intermittently to the reaction medium through one of more ports. |
US09518131B2 |
Generating metal ion binding proteins
The present invention provides for a method for generating a metal ion binding protein, the method comprising a) integrating the amino acid sequence DDD into CDR1 of a light chain variable region of an antibody or fragment thereof; and b) combining the sequence of step a) with a heavy chain variable region of an antibody or fragment thereof; and c) isolating the protein. Also provided is the use of metal ion binding proteins generated by the method of the present invention for isolation and purification of proteins and for the reversible labeling of a target molecule. Also provided is a metal ion binding anti-CD8 protein. |
US09518127B2 |
Inhibitory anti-factor XII/XIIA monoclonal antibodies and their uses
The invention relates to inhibitory anti-factor XII/FXIIa antibodies and methods of their use. |
US09518124B2 |
Anti-Notch3 agonist antibodies and their use in the treatment of Notch3-related diseases
The present invention relates to agonist antibodies that specifically bind to Notch 3 and activate signaling. The present invention includes antibodies binding to an epitope comprising the first Lin12 domain. The present invention also includes uses of these antibodies to treat or prevent Notch 3 related diseases or disorders. |
US09518119B2 |
IL3Rα antibody conjugates and uses thereof
The present invention provides antibodies that bind to the IL-3 receptor alpha subunit alpha (Il3Rα) chain, and compositions comprising such antibodies. The present invention provides methods for inhibiting or reducing an IL3Rα-expressing cell population, the methods comprising contacting a population of IL3Rα-expressing cells (e.g., cancer cells and/or cancer stem cells) with an antibody that binds to IL3Rα. The present invention also provides antibody conjugates comprising an antibody that binds to an IL3Rα chain linked to a cytotoxic agent or anticellular agent and compositions comprising such conjugates. The present invention also provides methods for preventing, treating and/or managing a disorder associated with IL3Rα-expressing cells (e.g., a hematological cancer), the methods comprising administering to a subject in need thereof an antibody that binds to IL3Rα. |
US09518118B2 |
Anti-HER2 antibodies and immunoconjugates
The invention provides anti-HER2 antibodies and immunoconjugates and methods of using the same. |
US09518112B2 |
TGF-β1 specific antibodies and methods and uses thereof
Specific binding members, particularly antibodies and fragments thereof, which bind to transforming growth factor beta 1 (TGF-β1) are provided, particularly recognizing human and mouse TGF-β1 and not recognizing or binding TGF-β2 or TGF-β3. Particular antibodies are provided which specifically recognize and neutralize TGF-β1. These antibodies are useful in the diagnosis and treatment of conditions associated with activated or elevated TGF-β1, including cancer, and for modulating immune cells and immune response, including immune response to cancer or cancer antigens. The anti-TGF-β1 antibodies, variable regions or CDR domain sequences thereof, and fragments thereof may also be used in therapy in combination with chemotherapeutics, immune modulators, or anti-cancer agents and/or with other antibodies or fragments thereof. Antibodies of this type are exemplified by the novel antibodies hereof, including antibody 13A1, whose sequences are provided herein. |
US09518111B2 |
Compositions comprising a p75 tumor necrosis factor receptor/Ig fusion protein
The present invention relates to pharmaceutical compositions comprising a p75 tumor necrosis factor receptor/Ig fusion protein. |
US09518110B2 |
Antibody preparations
An antibody preparation suitable for intravenous administration in humans includes IgG, IgA and at least 5% IgM antibodies by weight of the total amount of antibodies. The preparation is prepared from human plasma, has specific complement activating activity, and, in an in vitro assay with human serum suitable to determine the ability of the antibody preparation to activate complement unspecifically, the antibody preparation generates substantially no C5a and/or substantially no C3a. The antibody preparation can have medical uses. |
US09518108B2 |
Immunoglobulin frameworks which demonstrate enhanced stability in the intracellular environment and methods of identifying same
Compositions are provided, which can be used as frameworks for the creation of very stable and soluble single-chain Fv antibody fragments. These frameworks have been selected for intracellular performance and are thus ideally suited for the creation of scFv antibody fragments or scFv antibody libraries for applications where stability and solubility are limiting factors for the performance of antibody fragments, such as in the reducing environment of a cell. Such frameworks can also be used to identify highly conserved residues and consensus sequences which demonstrate enhanced solubility and stability. |
US09518106B2 |
Collagen fibrillar construction
Methods and compositions are described for organizing collagen into fibrillar networks, e.g, short and long-range organization. Collagen produced by the disclosed methods can be used for tissue engineering. |
US09518105B2 |
Polypeptides derived from calcitonin receptors and methods of use
The present invention is based, in part, on our discovery of compositions and methods that can be used to treat a patient who has a compromised bone (due, for example, to a disease such as osteoporosis or an injury such as a bone fracture). The compositions can also be administered prophylactically. For example, they can be administered to help maintain bone health as a patient ages. More specifically, the compositions include polypeptides that constitute (or that include) a fragment of a calcitonin receptor (CR) and polypeptides that constitute (or include) biologically active variants of those fragments. Sequence-specific formulas are provided herein, and polypeptides conforming to those formulas, as well as nucleic acids encoding them, expression vectors, host cells, pharmaceutical formulations, and methods of their preparation and use are within the scope of the present invention. |
US09518099B1 |
Refolded chlorotoxin, chlorotoxin variant, refolded chlorotoxin variant, and preparation technology thereof
Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare. |
US09518090B2 |
Compositions and methods for treating hepatitis B
The present invention provides compositions and methods for treating hepatitis B virus (HBV) infection as well as methods for identifying a compound or a composition that is suitable for treating HBV infection. In addition, the present invention provides a suitable non-mammalian animal model that can be used to screen for a compound or a composition that can inhibit HBV replication or treat HBV infection in a mammal. In particular, the present invention provides compositions and methods for treating hepatitis B infection by inhibiting interaction between HBV x protein and a Bcl-2 family protein or by reducing the expression level of a Bcl-2 family protein. |
US09518080B2 |
Androstane and pregnane steroids with potent allosteric GABA receptor chloride ionophore modulating properties
This invention describes compounds of Structures 1, 2, and 3 and their use as allosteric modulators of the GABA receptor chloride ionophore complex to alleviate stress, anxiety, mood disorders, seizures, depression, treatment of drug and alcohol abuse, memory, premenstrual disorders, and neural system damage. |
US09518079B2 |
Effective treatment of tumors and cancer with triciribine and related compounds
The inventors have determined, contrary to the prior art and experience, how to successfully use triciribine to treat tumors and cancer by one or a combination of (i) administering triciribine only to patients which according to a diagnostic test described below, exhibit enhanced sensitivity to the drug; (ii) use of a described dosage level that minimizes the toxicity of the drug but yet still exhibits efficacy; or (iii) use of a described dosage regimen that minimizes the toxicity of the drug. |
US09518077B2 |
Electrochemical synthesis of chloro-chitosan
The present disclosure provides methods for producing chitosan derivatives and the derivatives formed by these methods. The processes of the present disclosure utilize electrochemical methods to functionalize and/or modify amine and/or hydroxyl groups present on chitosan, to form new derivatives. In embodiments, a chloro-chitosan derivative may be prepared. The altered cationic affinity of these derivatives make them excellent candidates for biomedical applications, including pharmaceuticals, as well as food applications. |
US09518072B2 |
Ester-functional silanes and the preparation and use thereof; and use of iminium compounds as phase transfer catalysts
A method for producing a reaction product comprising an ester-functional silane, the method comprising: i) reacting a composition comprising: a) a haloorganosilane, b) a metal salt of a carboxy-functional compound, c) a phase transfer catalyst comprising a bicyclic amidine, an iminium compound, or a mixture thereof, provided that the iminium compound is not an acyclic guanidinium compound or pyridinium compound, and d) a co-catalyst, provided that the co-catalyst is optional when the phase transfer catalyst comprises the iminium compound. |
US09518065B2 |
IRAK inhibitors and uses thereof
The present invention provides compounds of the general formula I: or a pharmaceutically acceptable salt thereof, wherein each variable is as defined and described herein, as inhibitors of one or more interleukin-1 receptor-associated kinases (“IRAK”). |
US09518062B2 |
Compounds and compositions for use in phototherapy and in treatment of ocular neovascular disease and cancers
The invention relates generally to anti-angiogenesis agents and related methods of using to anti-angiogenesis agents for biomedical applications including direct monotherapy and combination therapy for treatment of an angiogenesis related condition. In an embodiment, the invention provides a class of opioid compounds and structurally related opioid derivatives exhibiting anti-VEGF activity for use in therapeutic procedures, including phototherapy. Opioid compounds and structurally related opioid derivatives of the invention may be administered alone or in combination with administration of a phototherapy agent and/or other therapeutic agent. |
US09518061B2 |
Substituted pyrazolylpyrazole derivative and use of same as herbicide
Provided is a compound capable of effectively control worst weeds of higher leaf stages that present practical problems. A specific pyrazolylpyrazole derivative of formula (1) is disclosed that is able to solve the above-mentioned problems. |
US09518059B2 |
Inhibitor crystalline form and preparation method and use thereof
The present invention relates to new crystalline forms of the inhibitor, 5-fluoro-3-phenyl-2-[(S)-1-(9H-purin-6-ylamino)-propyl]-3H-quinazoline-4-one; the present invention also relates to methods for preparing the new crystalline forms of 5-fluoro-3-phenyl-2-[(S)-1-(9H-purin-6-ylamino)-propyl]-3H-quinazolin-4-one, pharmaceutical compositions containing the new crystalline forms thereof, and uses thereof for the treatment and/or prevention of diseases such as chronic lymphocytic leukemia and indolent non-Hodgkin's lymphoma. |
US09518058B2 |
Process for the preparation of N,N-dicyclopropyl-4-(1,5-dimethyl-1H-pyrazol-3-ylamino)-6-ethyl-1-methyl-1,6-dihydroimidazo[4,5-d]pyrrolo[2,3-b]pyridine-7-carboxamide
The invention relates to an improved process for synthesizing N,N-dicyclopropyl-4-(1,5-dimethyl-1H-pyrazol-3-ylamino)-6-ethyl-1-methyl-1,6-dihydroimidazo[4,5-d]pyrrolo[2,3-b]pyridine-7-carboxamide of the formula: (I) Compound (I) is currently in clinical trials for the treatment of myeloproliferative disorders, such as polycythaemia vera, thrombocythaemia and primary myelofibrosis. |
US09518057B2 |
Derivatives and methods of treating hepatitis B infections
Provided herein are compounds useful for the treatment of HBV infection in a subject in need thereof, pharmaceutical compositions thereof, and methods of inhibiting, suppressing, or preventing HBV infection in the subject. |
US09518056B2 |
Inhibitors of influenza viruses replication
Methods of inhibiting the replication of influenza viruses in a biological sample or patient, of reducing the amount of influenza viruses in a biological sample or patient, and of treating influenza in a patient, comprises administering to said biological sample or patient an effective amount of a compound represented by Structural Formula (I): or a pharmaceutically acceptable salt thereof, wherein the values of Structural Formula (IA) are as described herein. A compound is represented by Structural Formula (IA) or a pharmaceutically acceptable salt thereof, wherein the values of Structural Formula (IA) are as described herein. A pharmaceutical composition comprises an effective amount of such a compound or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier, adjuvant or vehicle. |
US09518054B2 |
2-(azaindol-2-yl) benz imidazoles as PAD4 inhibitors
Compounds of formula (I) wherein; R1 is hydrogen or C1-6alkyl; R2 is hydrogen, C1-6alkyl, perhalomethylC0-5alkyl-O—, or C1-6alkoxy; R3 is hydrogen, C1-6alkyl, or C1-6alkoxyC1-6alkyl; R4 is hydrogen, C1-6alkyl, perhalomethylC1-6alkyl; or unsubstituted C3-6cycloalkylC1-6alkyl; A is C—R5 or N; B is C—R6 or N; D is C—R7 or N; with the proviso that at least one of A, B, and D, is N; R5 is hydrogen or C1-6alkyl; R6 is hydrogen or C1-6alkyl; R7 is hydrogen, C1-6alkyl, C1-6alkoxy, or hydroxy; R8 is hydrogen or C1-6alkyl, with the proviso that one of R4 and R8 is hydrogen; R9 is hydrogen or hydroxy; R10 is hydrogen or C1-6alkyl; and salts thereof are PAD4 inhibitors and may be useful in the treatment of various disorders, for example rheumatoid arthritis, vasculitis, systemic lupus erythematosus, ulcerative colitis, cancer, cystic fibrosis, asthma, cutaneous lupus erythematosis, and psoriasis. |
US09518052B2 |
Pyrazolopyridines and pyrazolopyrimidines
A compound having the structure: or a pharmaceutically acceptable salt or solvate thereof, wherein A and A′ are C or N, where C may be substituted by halo or C1-C6 alkyl; R and R0 are selected from the group consisting of H, C1-C6 alkyl, —(CH2)n—W, etc., where W is 5- or 6-membered heteroaryl or heterocyclic containing N, S and/or O atoms, —NR″SO2—R′, etc., where R′ and R″ are C1-C6 alkyl, etc.; wherein each alkyl, etc., may be substituted; or, R and R0 and the N atom to which they are bonded together to form a monocyclic or bicyclic heterocyclic ring, etc.; R1 is H, halo or cyano; R2 and R2′ are H, C1-C6 alkyl, etc.; X is a bond, etc.; R3 is H, C1-C4 alkyl, etc.; Y is a bond, —(CH2)m—, etc. The invention also relates to compositions and uses in the treatment of various diseases. |
US09518048B2 |
Process for the preparation of teneligliptin
A process for the preparation of teneligliptin. |
US09518047B2 |
Process for the industrial synthesis of lurasidone
Disclosed is a process for the industrial synthesis of Lurasidone from (1R,2R)-cyclohexane-1,2-diyldimethanol (1), 3-(piperazin-1-yl)benzo[d]isothiazole (3) and (3aR,4R,7R,7aS)-3a,4,7,7a-tetrahydro-4,7-methanoisobenzofuran-1,3-dione (6).). Said process is optimised to obtain Lurasidone with high yields and high purities by preparing highly pure synthesis intermediates, using critical raw materials and reagents in amounts close to the stoichiometric amounts, increasing productivity and reducing the costs and environmental impact of the process. |
US09518044B2 |
Prostaglandin receptor EP2 antagonists, derivatives, compositions, and uses related thereto
The present invention is directed to compounds of Formula IC: wherein the substituents are described herein. These compounds and their pharmaceutically acceptable salts thereof are prostaglandin receptor EP2 antagonists. |
US09518042B2 |
Nitrogen-containing heterocyclic compound
The present invention provides a compound having a cholinergic muscarinic M1 receptor positive allosteric modulator activity and useful as an agent for the prophylaxis or treatment of Alzheimer's disease, schizophrenia, pain, sleep disorder, Parkinson's disease dementia, dementia with Lewy bodies, and the like.The present invention relates to a compound represented by the formula (I) or a salt thereof. wherein each symbol is as described in the specification, or a salt thereof. |
US09518039B2 |
Polymer-fixed derivatives of dithiolane or dithiane
Derivatives of 1,3-dithianes and 1,3-dithiolanes of the general formula 1a or salts thereof of the general formula 1b where P=polymeric support, m=1 or 2, Z is an organic linker or X=inorganic or organic anion, processes for preparation thereof and use thereof. |
US09518038B2 |
Condensation product of theanine derivative and carboxylic acid coumarin derivative, its intermediate, preparation method and use thereof
The present invention relates to a compound as represented by formula (I), which is a condensation product of a theanine derivative and a carboxylic acid coumarin derivative, compounds as represented by formula (II) and formula (III), both of which are intermediates of the condensation product, a method for preparing these compounds, a pharmaceutical composition comprising the compounds, and a use thereof in preparing a medicament for prevention and treatment of tumors, inflammation, cardiovascular diseases, immune deficiency diseases and the like. Wherein, (Ia)R═CH3R1═HR2═H (Ib)R═CH2CH3R1═HR2═H (Ic)R═CH2CH3R1═ClR2═H (Id)R═CH2CH3R1═BrR2═H (Ie)R═CH2CH3R1═FR2═H (If)R═CH2CH3R1═NO2R2═H (Ig)R═CH2CH3R1═ClR2═Cl (Ih)R═CH2CH3R1═BrR2═Br (Ii)R═CH2CH3R1═NH2R2═H Wherein, (IIa)R═CH3 (IIb)R═CH2CH3 Wherein, (IIIc)R1═ClR2═H (IIId)R1═BrR2═H (IIIe)R1═FR2═H (IIIf)R1═NO2R2═H (IIIg)R1═ClR2═Cl (IIIh)R1═BrR2═Br |
US09518035B2 |
Method for preparing glycidol using glycerol and glycidol obtained thereby
A method for preparing glycidol using glycerol includes mixing glycerol with urea in the presence of at least one zinc-based catalyst selected from the group consisting of Zn(NO3)2, ZnCl2, ZnO and Zn(OAc)2 under a pressure of 0.5-10 kPa at a temperature of 100-170° C. to obtain glycerol carbonate; filtering the glycerol carbonate mixed with the zinc-based catalyst through an adsorbent including a polymer resin coordinated with amine groups to separate the zinc-based catalyst and glycerol carbonate from each other; and carrying out reaction of the glycerol carbonate separated from the zinc-based catalyst in the presence of an anion alkali metal salt catalyst that is Na, K, Rb, Cs or a mixture thereof containing at least one anion selected from the group consisting of Cl−, Br−, I−, NO3−, NO2− and acetate under a pressure of 0.13-6.67 kPa at a temperature of 140-250° C. to obtain glycidol. |
US09518034B2 |
Synthesis of chiral enaminones, their derivatives, and bioactivity studies thereof
This invention provides enantioenriched heterocyclic enaminone compounds with quaternary stereogenic centers and novel methods of preparing the compounds. Methods include the method for the preparation of a compound of formula (I): comprising treating a compound of formula (II): with a transition metal catalyst under alkylation conditions. |
US09518032B2 |
Small molecule inhibitors of USP1 deubiquitinating enzyme activity
Provided are small molecule inhibitors of ubiquitin specific protease 1 (USP1) activity and methods for their use in treating and characterizing cancers. The small molecule USP1 inhibitors of the invention are particularly useful in the treatment of cancers that are resistant to DNA cross-linking agents. |
US09518031B2 |
Photo-sensitive resin composition, cured film, method for forming a pixel, solid state image sensor, color filter and ultraviolet absorber
Provided is a photo-sensitive composition capable of yielding pixels having a high translucency and a large refractive index, with a less amount of development residue in the process of formation. The photo-sensitive resin composition contains an ultraviolet absorber represented by Formula (I); a photo-polymerization initiator; and a polymerizable monomer: wherein each of R1, R2 and R3 independently represents a hydrogen atom or an alkyl group having 1 to 10 carbon atoms; one of R4 and R5 represents an electron withdrawing group, and the other of R4 and R5 represents —SO2R6, —CO2R6, —COR6, —CN or —CONR6R7; each of R6 and R7 independently represents a hydrogen atom, alkyl group having 1 to 8 carbon atoms or aryl group. |
US09518030B2 |
Purification of aryltriazoles
Impure aryltriazoles such as benzotriazole and tolyltriazole that are contaminated with dark colored impurities can be purified by conversion to an aryltriazole acid salt by treatment with aqueous acid. The aryltriazole acid salt is water soluble whereas the dark colored impurities are not. The aryltriazole acid salt solution is separated from the dark colored impurities and the aryltriazole acid salt is isolated by precipitation. The free aryltriazole may be recovered by neutralization with base. |
US09518029B2 |
Certain chemical entities, compositions, and methods
Chemical entities based on quinoxaline that are kinase inhibitors are described. Specifically quinoxaline derivatives of Formula I, containing a diarylamide or diarylurea substructure that inhibit Braf mutant kinase activity, pharmaceutical compositions containing the inhibitor compounds and methods of treatment of cancer comprising administering an effective amount of the Braf inhibitor compound are described. |
US09518028B2 |
Process for the preparation of Rosuvastatin calcium and preparation of its novel intermediates
The present invention relates to process for the preparation of 7-[4-(4-fluorophenyl)-6-isopropyl-2-(N-methyl-N-methylsulfonylamino)pyrimidin-5-yl]-(3R,5S)-dihydroxy-(E)-6-heptenoic acid calcium having formula (I). The compound of formula (I) has adopted name “Rosuvastatin Calcium”. The present invention is also related to novel intermediates of formula (4) and formula (5) used in preparation of formula (I), and process of their preparation. |
US09518027B2 |
Deuterated momelotinib
The present invention in one embodiment provides a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the variables shown in Formula I are as defined in the specification. |
US09518025B2 |
Process for preparing 3,5-bis(haloalkyl)pyrazole derivatives from a,a-dihaloamines
The present invention relates to a novel process for preparing 3,5-bis(haloalkyl)pyrazole derivatives. |
US09518013B2 |
Generation of peroxyformic acid through polyhydric alcohol formate
The present invention relates generally to peroxyformic acid forming compositions, methods for forming peroxyformic acid, preferably in situ, using the peroxyformic acid forming compositions. The present invention also relates to the peroxyformic acid formed by the above compositions and methods. The present invention further relates to the uses of the peroxyformic acid, preferably in situ, for treating a surface or a target. The present invention further relates to methods for treating a biofilm using peroxyformic acid, including peroxyformic acid generated in situ. |
US09518012B2 |
Method of preparing core-shell copper nanoparticles immobilized on activated carbon and method of preparing chalcogenide compound using nanoparticles as catalyst
Disclosed herein is a method of preparing a Cu/Cu2O core-shell copper nanoparticle catalyst having high catalytic activity from [Cu3(BTC)2] and NaBH4 via a simple chemical reduction method. Also disclosed is a method of preparing a chalcogenide compound by using the nanoparticle catalyst as a heterogeneous catalyst in a cross-coupling reaction between a chalcogenide precursor compound and a boron-containing compound. The disclosed cross-coupling reaction is performed via a simple process, and the disclosed nanoparticle catalyst is compatible with various substrates under mild reaction conditions and exhibits excellent recyclability without a reduction in catalytic activity. |
US09518011B2 |
Recording material produced using non-phenol compound
An object of the present invention is to provide a recording material or a recording sheet using, as a color-developing agent, a non-phenol compound that is a safe compound in no danger of corresponding to an endocrine disruptor and is good in color developing performance. The non-phenol compound used in the present invention is at least one selected from the group consisting of compounds represented by the following formulas (I) to (III). |
US09517999B2 |
Process for purifying (meth)acrylic acid
A process for producing a grade of (meth)acrylic acid having residual formaldehyde levels of under 100 parts per million. |
US09517998B1 |
Device method of making, separating, and purifying artepillin C in propolis
A method of making, separating, and purifying artepillin C in propolis includes mixing propolis with ethanol to obtain a propolis-ethanol extract; providing supercritical carbon dioxide and the propolis-ethanol extract to a chromatographic column to separate wax, artepillin C, and flavonoids; providing supercritical carbon dioxide, the artepillin C, and the flavonoids to an adsorption column to remove the flavonoids; keeping the adsorption column still; and providing ethanol to the adsorption column to obtain the purified artepillin C. |
US09517994B2 |
Antibacterial agents: phloroglucinol derivatives
The invention provides a compound of formula I: or a salt thereof, wherein R1-R3 have any of the values described in the specification, as well as compositions comprising a compound of formula I. The compounds are useful as antibacterial agents. |
US09517981B2 |
Membrane-based gas separation processes to separate dehydrogenation reaction products
Gas separation processes are provided for separating dehydrogenation reaction products from a raw gas stream to recover hydrocarbons, specifically olefins, such as propylene and iso-butene, as well as unreacted feedstock. The processes employ a sequence of partial condensation steps, interspersed with membrane separation steps to raise the hydrocarbon dewpoint of the uncondensed gas, thereby avoiding the use of low-temperature or cryogenic conditions. |
US09517979B2 |
Process and apparatus for the production of para-xylene
A process for producing para-xylene (PX) comprises supplying a hydrocarbon feed comprising xylenes and ethylbenzene (EB) to a PX recovery unit, where a PX-rich stream and at least one PX-depleted stream are recovered from the feed. The PX-depleted stream is then separated into an EB-rich stream and an EB-depleted stream in a divided wall column. The EB-depleted stream is then isomerized under at least partial liquid phase conditions to produce a first isomerized stream having a higher PX concentration than the PX-depleted stream, and the EB-rich stream is isomerized under at least partial vapor phase conditions to produce a second isomerized stream having a higher PX concentration than the PX-depleted stream. The first and second isomerized streams are then recycled to the PX recovery unit to recover additional PX and the process is repeated to define a so-called xylene isomerization loop. |
US09517978B2 |
Methanol to olefins process
A process for chilling ethylene to required storage temperatures is disclosed, the process including: cooling an ethylene product from at least one of an ethylene production process and an ethylene recovery process via indirect heat exchange with a coolant at a temperature less than about −100° C. to decrease the temperature of the ethylene product; mixing a portion of the cooled ethylene product with methane to form the coolant; expanding at least one of the coolant, the methane, and the portion of the cooled ethylene to reduce a temperature of the coolant to less than −100° C. prior to the cooling; and feeding the heat exchanged coolant to at least one of the ethylene production process, the ethylene recovery process, and an open-loop refrigeration system. |
US09517977B2 |
Materials for electronic devices
The present invention relates to compounds of the formula (I), to mixtures of the said compounds with emitter compounds, to the use of compounds of the formula (I) and the said mixtures in electronic devices, and to electronic devices containing one or more compounds of the formula (I) and/or mixtures of compounds of the formula (I) with emitter compounds. |
US09517974B2 |
Methods to convert mealworm castings to organic fertilizer
Methods to convert the light and powdery mealworm castings into a suitable fertilizer product are disclosed. The methods can include saturating the mealworm castings using an infusion process with a liquid, such as water, until an elevated temperature is reached. The mealworm castings can be replenished and the infusion process can be repeated until the targeted N—P—K rating is achieved. The saturated mealworm castings or mealworm castings can be dried and formed into fertilizer pellets or into a granular soil-like product. In some examples, a binding agent such as dried mashed potato extract can be added to the saturated mealworm castings. In some examples, the fertilizer excludes artificially produced chemicals, hormones, antibiotics, and steroids. In some examples, the fertilizer has an N—P—K rating of 4-3-2. In some examples, the mealworm castings are produced by mealworms fed wheat bran and raw carrots. |
US09517971B2 |
Dual-color coating of optical fibers with UV curable inks
A method of coating a silica-silica optical fiber, comprising, in a single pass on a fiber coating machine: applying a primary layer of UV curable acrylate carrying a first color, on said fiber; and applying a second layer of UV curable acrylate carrying a second color different from the first color, on top of the primary layer, the second layer being applied in patterns over the primary layer. The method is used to identify fibers in bundles or loose tubes where there are more fibers than there are basic colors. |
US09517970B2 |
Transparent glass substrate having a coating of consecutive layers
The invention relates to a transparent glass substrate having a coating including, in order: a first reflected color neutralization layer; a low-emissivity second layer essentially made up of SnO2:F and having a thickness between 455 and 800 nm; and a third layer that is essentially made up of SiOx, x being less than or equal to 2, and has a thickness between 40 and 65 nm or between 140 and 180 nm. The invention also relates to a double glass sheet and a triple glass sheet, manufactured from such a glass substrate, and to a window comprising said glass sheets. |
US09517968B2 |
Strengthened glass with deep depth of compression
Chemically strengthened glass articles having at least one deep compressive layer extending from a surface of the article to a depth of at least about 45 μm within the article are provided. In one embodiment, the compressive stress profile includes a single linear segment extending from the surface to the depth of compression DOC. Alternatively, the compressive stress profile includes two linear portions: the first portion extending from the surface to a relatively shallow depth and having a steep slope; and a second portion extending from the shallow depth to the depth of compression. The strengthened glass has a 60% survival rate when dropped from a height of 80 cm in an inverted ball drop test and an equibiaxial flexural strength of at least 10 kgf as determined by abraded ring-on-ring testing. Methods of achieving such stress profiles are also described. |
US09517964B2 |
Method for producing optical fiber preform
Provided is a method for producing an optical fiber preform including a dehydration step and a sintering step. In the dehydration step, a porous glass base material is provided to a furnace core tube of a dehydration-sintering furnace, and the porous glass base material is dehydrated using a dehydration agent added with an argon gas. In the sintering step, the porous glass base material dehydrated in the dehydration step is sintered. Further, in the dehydration step, a temperature of the porous glass base material begins to be increased in a condition such that a high heat conductivity gas, having a heat conductivity higher than a heat conductivity of the argon gas, is remaining inside the porous glass base material. |
US09517963B2 |
Method for rapid laser drilling of holes in glass and products made therefrom
Forming holes in a material includes focusing a pulsed laser beam into a laser beam focal line oriented along the beam propagation direction and directed into the material, the laser beam focal line generating an induced absorption within the material, the induced absorption producing a defect line along the laser beam focal line within the material, and translating the material and the laser beam relative to each other, thereby forming a plurality of defect lines in the material, and etching the material in an acid solution to produce holes greater than 1 micron in diameter by enlarging the defect lines in the material. A glass article includes a stack of glass substrates with formed holes of 1-100 micron diameter extending through the stack. |
US09517959B2 |
Mixing apparatus for crushing sludge
The present invention relates to mixing apparatus for crushing sludge comprising a motor part in which a rotary shaft is inserted into the motor part and the motor part is rotated, a moving part formed to penetrate the motor part from one side to another side and move a chemical which is flowed through an outside chemical feeder to the another side, and a paddle mounted on the another side of the motor part to rotate based on the rotation of the motor part and spray the chemical. |
US09517958B2 |
System for water filtration
The water filtration system may include a support base. A first receptacle may be detachably disposed on the support base and configured to store source water. A second receptacle may be detachably disposed on the support base and configured to store supply water. A filter system may be disposed between the first receptacle and the second receptacle. |
US09517957B2 |
Facility for removal of materials and/or polluting substances contained in watercourses
“IMPROVEMENT ON FACILITY FOR REMOVAL OF MATERIALS AND/OR POLLUTING SUBSTANCES CONTAINED IN WATERCOURSES”, applied to facility comprising: the implementation of a sandbox arranged at the bottom and in a stretch of the watercourse, followed by a floating garbage fence arranged substantially transversely to the watercourse; whereas downstream and at a certain distance from this garbage fence is provided a suspended and transverse metallic structure to the watercourse, in which curtains for selective injection and automatically set in motion are mounted, arranged spaced and interspersed by homogenization diffusers, these curtains are responsible for the injection of coagulants; by the injection of polymers into the watercourse to be treated, and ahead there is a phase for release of microbubbles of air, causing a flotation of these aggregate particles; allowing that from this flotation stretch arises, along the watercourse, a superficial agglomeration of the floated material, and the conduction by flexible and longitudinal barriers formed by synthetic membranes of this floated material to a transverse alignment of dredging modules, that extend through the entire watercourse's width promoting the concentration of floated material and its removal. This improvement consisting of all equipment (3, 4, 7) originally installed transversally the watercourse, which are subject to partial or total removal from this transverse condition, allowing the clearance of part and/or entire bed of the watercourse. |
US09517956B2 |
System and method for generation of point of use reactive oxygen species
Systems and methods for generating reactive oxygen species formulations useful in various oxidation applications. Exemplary formulations include singlet oxygen or superoxide and can also contain hydroxyl radicals or hydroperoxy radicals, among others. Formulations can contain other reactive species, including other radicals. Exemplary formulations containing peracids are activated to generate singlet oxygen. Exemplary formulations include those containing a mixture of superoxide and hydrogen peroxide. Exemplary formulations include those in which one or more components of the formulation are generated electrochemically. Formulations of the invention containing reactive oxygen species can be further activated to generate reactive oxygen species using activation chosen from a Fenton or Fenton-like catalyst, ultrasound, ultraviolet radiation or thermal activation. Exemplary applications of the formulations of the invention among others include: cleaning in place applications, water treatment, soil decontamination and flushing of well casings and water distribution pipes. |
US09517955B2 |
System and method for generation of point of use reactive oxygen species
Systems and methods for generating reactive oxygen species formulations useful in various oxidation applications. Exemplary formulations include singlet oxygen or superoxide and can also contain hydroxyl radicals or hydroperoxy radicals, among others. Formulations can contain other reactive species, including other radicals. Exemplary formulations containing peracids are activated to generate singlet oxygen. Exemplary formulations include those containing a mixture of superoxide and hydrogen peroxide. Exemplary formulations include those in which one or more components of the formulation are generated electrochemically. Formulations of the invention containing reactive oxygen species can be further activated to generate reactive oxygen species using activation chosen from a Fenton or Fenton-like catalyst, ultrasound, ultraviolet radiation or thermal activation. Exemplary applications of the formulations of the invention among others include: cleaning in place applications, water treatment, soil decontamination and flushing of well casings and water distribution pipes. |
US09517954B2 |
Chemical injection control method and chemical injection controller
A controller performs multiple regression analysis using an optimum chemical injection rate as a target variable and using one or more water quality indices of a raw water as explanatory variables and thereby derives a calculation formula for a basic chemical injection rate corresponding to the water quality indices. Next, the controller calculates the basic chemical injection rate corresponding to the water quality indices by substituting the measured values of the water quality indices of the raw water into the calculation formula. Then, the controller corrects the basic chemical injection rate based on a measured value of the water quality index of the treated water, thereby newly calculates a chemical injection rate, and outputs the newly calculated chemical injection rate as a control factor for a chemical injection pump while supplying the newly calculated chemical injection rate to calculation of the optimum chemical injection rate. |
US09517952B2 |
Hydrophilic-oleophobic copolymer composition and uses thereof
Provided herein are copolymers and copolymer compositions that are both hydrophilic and oleophobic. The copolymers include structural units derived from a fluoroalkyl monomer and a zwitterionic monomer. It further relates to membranes formed by coating a porous substrate with the copolymeric compositions. The copolymeric coating imparts hydrophilicity and oleophobicity/oil-tolerance to the membranes. The uses of such membranes as microfiltration membrane or ultrafiltration membrane are also provided. |
US09517951B2 |
Apparatus and method for the seawater pre-treatment for desalinating seawater into fresh water
Disclosed are an apparatus and method for the seawater pre-treatment to remove salt from seawater. The seawater pre-treatment apparatus for desalinating seawater into fresh water comprises: a seawater pre-treatment unit, located at a predetermined depth of a sea floor, for obtaining a pre-treated water by removing impurities from the seawater; a pre-treatment water tank, located on the ground, for accommodating the pre-treatment water tank produced by the pre-treatment unit; and a connection flow channel for connecting the pre-treatment unit and the pre-treatment water tank such that the pre-treated water can be transported. The seawater pre-treatment apparatus and method are capable of simplifying the configuration of the entire apparatus while reducing the consumption of energy during the pre-treatment process for the seawater desalination. |
US09517949B2 |
Water treatment apparatus with circulating flow path and water treatment method using the same
A water treatment apparatus and a water treatment method using the same are provided. The water treatment apparatus includes a cohesive agent input device configured to input a cohesive agent to raw water, a membrane filtering device, a raw water pump configured to transfer raw water including the cohesive agent therein to the membrane filtering device, a water supply flow path connecting a discharge side of the raw water pump to the inlet of the membrane filtering device, a circulation flow path connecting the raw water discharge opening of the membrane filtering device to the water supply flow path and a circulation pump provided in the circulation flow path to transfer discharged raw water to the water supply flow path. |
US09517945B2 |
Low-temperature route for precision synthesis of metal oxide nanoparticles
Methods for making metal oxide nanoparticles, including mixed metal oxides and core-shell metal oxide nanoparticles, are disclosed. A solution comprising a metal carboxylate and a carboxylic acid is combined with a solvent comprising an alcohol heated to a temperature ≦250° C. for an effective period of time to form metal oxide nanoparticles. The metal may be a group IIIA metal, a group IVA metal, a transition metal, or a combination thereof. A metal oxide shell may be deposited onto metal oxide nanoparticles by dispersing the metal oxide nanoparticles in an alcohol, adding a metal carboxylate, and maintaining the reaction at a temperature ≦200° C. for an effective period of time to form core-shell nanoparticles. The nanoparticles may have a relative size dispersity of ≦20%, and may further comprise a plurality of carboxylic acid, carboxylate, and/or alcohol ligands coordinated to the nanoparticles' outer surfaces. |
US09517942B2 |
Transition-metal-containing zeolite
A transition-metal-containing silicoaluminophosphate zeolite having excellent high-temperature hydrothermal durability is easily and efficiently produced. A method for producing a transition-metal-containing zeolite that contains a silicon atom, a phosphorus atom, and an aluminum atom in at least its framework structure includes hydrothermal synthesis using an aqueous gel containing a silicon atom raw material, an aluminum atom raw material, a phosphorus atom raw material, a transition metal raw material, and a polyamine (other than diamines). A transition-metal-containing silicoaluminophosphate zeolite produced by hydrothermal synthesis using a zeolite raw material and the aqueous gel containing the transition metal raw material and the polyamine has excellent high-temperature hydrothermal durability and high catalytic activity. |
US09517939B2 |
Method of enhancing the connectivity of a colloidal template, and a highly interconnected porous structure
A method of enhancing the connectivity of a colloidal template includes providing a lattice of microparticles, where the microparticles are in contact with adjacent microparticles at contact regions therebetween, and exposing the lattice to a solution comprising a solvent and a precursor material. The solvent is removed from the solution, and the precursor material moves to the contact regions. A ring is formed from the precursor material around each of the contact regions, thereby creating interconnects between adjacent microparticles and enhancing the connectivity of the lattice. |
US09517938B2 |
Applying spatial gradient magnetic field to metallic/semiconducting SWNTs in fluid
A process of sorting metallic single wall carbon nanotubes (SWNTs) from semiconducting types by disposing the SWNTs in a dilute fluid, exposing the SWNTs to a dipole-inducing magnetic field which induces magnetic dipoles in the SWNTs so that a strength of a dipole depends on a conductivity of the SWNT containing the dipole, orienting the metallic SWNTs, and exposing the SWNTs to a magnetic field with a spatial gradient so that the oriented metallic SWNTs drift in the magnetic field gradient and thereby becomes spatially separated from the semiconducting SWNTs. An apparatus for the process of sorting SWNTs is disclosed. |
US09517929B2 |
Method of fabricating electromechanical microchips with a burst ultrafast laser pulses
A method for making an electromechanical chip using a plurality of transparent substrates, comprising the steps of: machining, using photoacoustic compression, full or partial voids in at least one of the plurality of substrates. The plurality of transparent substrates are stacked and arranged in a specific order. The transparent substrates are affixed and sealed together. The chip may be sealed by laser welding or adhesive. |
US09517925B2 |
Valve-integrating container, liquid withdrawing device equipped with the same, and method for manufacturing valve-integrating container
The valve-integrating container includes a container body and a valve mechanism switching whether a liquid stored in the container body is allowed to flow out. The valve mechanism has a spring, a spring supporting part, and a valve plug. The spring supporting part has a liquid flow channel formed in a cylindrical shape extending along the axis, a lower end portion mounted to an internal threads of a reduced-diameter portion, an upper end portion projecting toward the enlarged-diameter portion, and a guide groove formed on a lower end side outer circumferential surface for guiding a liquid stored in a connecting portion downwardly. The valve plug has on its outer circumferential surface a guide groove guiding the liquid guided by the guide groove downwardly to an opening portion. |
US09517922B2 |
Evacuated bottle system
An evacuated bottle system including providing a bottle defining a hollow interior, the bottle having a neck defining an opening that provides fluid communication with the interior; providing a cap assembly including a funnel having a first portion and a second portion, where the second portion extends radially outward from the first portion to form a floor on an interior thereof and a shoulder on an exterior thereof, the first portion defining a first bore and the second portion defining a second bore fluidly connected to the first bore; a self serum stopper having a self sealing membrane that extends radially outward to overlie at least a portion of the floor of the funnel; and a cap having a cap wall sized to fit over the funnel and a cover portion extending radially inward from the cap wall, the cover portion defining at least one evacuating opening; assembling the cap assembly with the bottle by inserting the first portion of the funnel into the neck of the bottle; supporting the funnel on the neck of the bottle at the shoulder; inserting the serum stopper within the funnel where the self-sealing membrane covers at least a portion of the floor to seal the first bore of the funnel from the second bore; applying the cap over the funnel and attaching the cap to the bottle, wherein the cover portion extends radially inward over a portion of the self-sealing membrane and defines a gap axially outward of the self-sealing membrane; applying a pressure differential relative to the interior of the bottle to create a suction at the evacuating opening to draw the self-sealing membrane axially outward within the gap a distance effective to provide fluid communication between the first bore of the funnel and the second bore the funnel; maintaining the suction until a selected pressure is achieved within the interior of the bottle; and withdrawing the suction, wherein the selected pressure within the bottle draws the self-sealing membrane against the floor of the funnel to reseal the interior of the bottle. |
US09517906B2 |
Conveying guide, sheet conveying apparatus, and image forming apparatus
A conveying guide includes: a plate having a guide surface which guides a sheet; a recess portion provided on the plate and recessed from the guide surface; and a bend portion bent from the recess portion in a direction away from the guide surface. |
US09517903B2 |
Paper feeding device and image forming apparatus
A paper feeding device that includes, in a drive transmission mechanism to a paper feeding roller that delivers paper, a drive member provided on an apparatus body side as a member to transmit torque in a given direction for delivery of paper from a conveying motor to the paper feeding roller and a driven member provided on the paper feeding roller side. By relatively rotating the drive member and the driven member to form a coupling state of the members before an instruction to start the delivery of paper is output, the rotation of the paper feeding roller is started without a time lag when the instruction to start the delivery of paper is output. |
US09517902B2 |
Vertically stored telescoping lip leveler
The present invention is a vertically stored dock leveler with a telescoping lip that selectively extends and retracts through a range positions relative to the deck. The lip is held and guided by a deck frame carriage. When the deck is raised and lowered, the lip is extended and retracted by an electro-hydraulic control system. When the deck reaches a preselected incline position, the lip is fully extended. Sensors on the underside of the deck determine the incline position of the deck and when the lip is retracted. The leveler is then lowered until the lip engages and rests on the bed of the trailer. Similarly, when the deck is raised for storage and reaches the preselected incline position, the lip is fully retracted prior to returning to its stored position. The telescoping lip is selectively moveable to a range of partially extended position to facilitate end loading a trailer. |
US09517900B2 |
Dredged soils long distance transport system using magnetic field and tornado and its control method thereof
A long distance dredged soil transport system includes a pump module including a pump for generating a compressed air and a plug flow flowing by dividing an inner state of a pipeline to a gaseous unit and a liquefied unit by introducing the generated compressed air into the pipeline by being interlinked to one lateral surface of the pipeline, a pipe module wound with a coil to apply an electromagnetic wave to the liquefied unit and including a plurality of pipelines, database stored with flow information on flow velocity and flow form in response to physical properties of liquefied unit, and a control module communicating with the pipe module, the pump module and the database and applying, to the coil, a waveform of a current matching to a flow waveform of the liquefied unit transported inside the pipeline, and a control method thereof. |
US09517895B2 |
Vehicle frame turnover system and method
A system for turning over a vehicle frame defining openings and having a longitudinal center axis includes first and second robots each having an end effector. Each end effector has a pair of oppositely-positioned locator pins, at least one of which is selectively moveable toward the other. A controller is used to control the positioning of the frame via the robots and end effector by executing method instructions to cause the robots to align the locator pins of the end effectors with the openings of the frame, and to insert the aligned locator pins into the openings toward the center axis from outside of the vehicle frame. The robots lift the frame from a first conveyor, with weight of the vehicle frame born by the locator pins during the lift. The robots also rotate the frame about the center axis and lower the vehicle frame onto a second conveyor. |
US09517894B2 |
Floating conveyor belt cleaner assembly
A floating conveyor belt cleaner assembly for removing residual material on the surface of a conveyor belt has a scraper assembly with a plurality of scraper blades rotatably mounted between mounting frames attached to the support structure of a conveyor belt adjacent the opposing edges of the belt. A rotating mechanism selectively rotates the scraper assembly relative to the mounting frames to position a new set of scraper blades against the conveyor belt once the worn set of scraper blades requires replacement. A float mechanism permits movement of the scraper assembly vertically substantially perpendicular to the surface of the belt as the scraper blades wear down. |
US09517893B2 |
Method and device for feeding products to a processing station
A device for launching products into a feeding path, including a launcher; a detection sensor to detect the passage of products launched by the launcher; a launcher central control unit; conveyors to move forward the products in the feeding path, associated with a drive member; and at least one movement sensor to detect the position of the products moved by the conveyors. The central control unit is programmed to control the start position taken by each group of products, downstream of the detection sensor, and to impose on each group of products a forward movement according to the length of the group of products and to an adjustment factor determined by the error, if any, between the detected start position and a desired start position. |
US09517892B2 |
Return roller battery for conveyor belts
A return roller battery has a plurality of idler rollers rotatably attached at either end to opposing mounting plates. The mounting plates are rotatably attached to a conveyor belt frame and selectively rotated by a crank mechanism to position one of the idler rollers beneath the conveyor belt to support the belt. A locking mechanism secures the mounting plates against rotation when an idler roller is in position. |
US09517889B1 |
Conveyor belts and modules with twist-lock accessories
A conveyor belt and belt modules with plug-in accessories, such as sideguards. The accessories have plugs that plug into sockets in the belt or individual belt modules. Lugs and mounting slots and tabs and detents on the plugs and sockets help guide, register, and lock the accessories in place. The plugs and sockets allow the accessories to be locked and unlocked by twisting the plugs in the sockets. |
US09517888B2 |
Endless belt and image heating apparatus including the endless belt
An endless belt for heating an image on a sheet includes a resistance layer for generating heat by the supply of electric power; a first ring member provided in a widthwise end side of the endless belt so as to be electrically connected with the resistance layer; a second ring member, one of the first and second ring members being fitted around the other with the resistance layer sandwiched therebetween; and a fixing member configured to fix the first and second ring members to each other so that the first and second ring members are rotated integrally with the resistance layer. |
US09517886B2 |
Cleated conveyor belt
A belt includes one or more devices that prevent roll-back of material being conveyed by the belt wherein the one or more devices are formed as a pattern on the belt. The pattern includes one of the one or more devices being offset from at least another of the one or more devices. The pattern is at distance from another pattern of the one or more devices formed on the belt. |
US09517883B1 |
Methods and systems for waste mangement
A waste management system for transferring waste from an elevated platform to a ground level includes a waste disposal station coupled to the platform such that the waste disposal station is configured to receive the waste from a technician. The waste management system also includes at least one chute coupled to the waste disposal station such that the at least one chute configured to channel the waste downward from the waste disposal station. The waste management system also includes at least one container coupled to the at least one chute. The at least one container is located at the ground level and is configured to collect the waste deposited in the at least one chute at the waste disposal station. |
US09517880B2 |
System for automatically containing leakage of liquid
A system for automatically containing leakage of liquid from a reservoir includes a surrounding wall, a driving unit, a sensor and a controller unit. The driving unit is configured to drive the surrounding wall to move between containing and non-containing positions. The sensor is capable of generating a detection signal. The controller unit receives the detection signal, and determines whether leakage of liquid from the reservoir has occurred. When it is determined that the leakage of liquid from the reservoir has occurred, the driving unit is actuated by the controller unit to drive the surrounding wall to move from the non-containing position to the containing position for containing the leakage of liquid. |
US09517879B2 |
Foldable transport container with horizontally slidable side walls and method for folding said container
A foldable transport container substantially slides and folds so that the transport container can be folded and unfolded conveniently. In an example embodiment, a foldable transport container comprises a planar foldable base, a pair of opposing straight side walls, a pair opposing foldable end walls, a foldable top, and a folding mechanism. A first straight side wall is operable to slide towards a second straight side wall along a first longitudinal axis, and a first foldable end wall and a second foldable end wall are operable to fold inwardly towards each other along a second latitudinal axis. The folding mechanism allows surfaces of the first and second foldable base sections to be used for storing goods within the container without any interfering protrusions when the foldable transport container is in its erected configuration. |
US09517878B2 |
Flexible wrapping material for wrapping flowers and/or plants
Flexible wrapping material for wrapping flowers and/or plants, wherein at least two connected parts having mutually distinctive shapes border next to each other along a straight line separating said parts from each other. Optionally said parts are provided with mutually distinctive prints on said parts. In another embodiment said parts are embodied in mutually different materials. It is suitable that one part is embodied in a plastic material and the other part is embodied in a woven or nonwoven fabric material. Neighboring edges of adjacent parts are sealed to each other. Sealing can be achieved in many ways, for instance by heating or by ultrasonic sealing. |
US09517877B2 |
Condiment packet holder
A holder for a single-serving condiment packet that allows an opened packet to maintain an upright position without spilling its inner contents and also without having the opening of the open packet touch any part of the holder. The single-serving condiment packet holder has a thin three-dimensional cavity which is defined by one or more internal sidewalls. The holder may also have sidewalls, a base side, and a top side that is any geometric shape. A clip may be used to suspend the holder. |
US09517876B2 |
Integrally blow-moulded bag-in-container having an inner layer and the outer layer made of the same material and preform for making it
The present invention relates to an integrally blow-molded bag-in-container (2) having an integrally blow-molded bag-in-container wherein the same polymer is in contact on either side of the interface between the inner (11) and outer layers (12). It also concerns a preform (1, 1′) for blow-molding a bag-in-container, having an inner layer and an outer layer, wherein the preform forms a two-layer container upon blow-molding, and wherein the thus obtained inner layer of the container releases from the thus obtained outer layer upon introduction of a gas at a point of interface between the two layers. The inner and outer layers are of the same material. |
US09517871B2 |
Child-resistant air freshener container
A child-resistant container including a bottle having a first locking member associated therewith, a bottle cap for selectively engaging the bottle, the bottle cap including a second locking member for selectively engaging the first locking member, and a removable gasket positioned and located within the bottle cap for allowing the bottle cap to partially engage the bottle but preventing the first locking member from engaging the second locking member so long as the gasket is positioned within the bottle cap. Removal of the gasket from the bottle cap allows the bottle cap to be fully engaged with the bottle and allows the first locking member to engage the second locking member thereby activating the child-resistant locking mechanism. |
US09517863B2 |
Multi-component dispenser
A dispensing device for a multi-component composition comprising a housing (1) in the form of an elongate sleeve. The housing has a first end for receiving a compression device (3) and a second end defining an outlet (7) from which a supply of components housed within the housing are dispensed. Each component is retained within a compartment (21, 22) of a collapsible bag (2; 9, 10) prior to being dispensed. The collapsible bag compartments each have a sealed end for receiving pressure from the compression device and a dispensing end for dispensing a component via an outlet (23). The dispensing device is provided with a closure device (4) through which the dispensing ends of the collapsible bag compartments extend. The closure device (4) is adapted to apply a clamping force on the dispensing ends to seal off the supply of the components and to release the clamping force when required to allow the components to be dispensed. |
US09517856B2 |
Unit for applying glue on labels and conveying such labels
There is described a unit for applying glue on a plurality of labels to be cold-glued on respective containers and for conveying labels applied with glue, comprising: a roll covered of glue and operable to rotate about a first axis; a first carousel operable to rotate about a second axis and which comprises, in turn, a plurality of paddles adapted to cooperate with roll to be covered with glue and to take a relative label from a storage; a second carousel operable to rotate about a third axis and which comprises, in turn, a plurality of hooks adapted to receive respective labels covered with glue from respective paddles and to move respective labels with glue applied thereon along a first path; at least a first belt operatively connected to first carousel and to one between roll and second carousel. |
US09517854B2 |
Machine and method for treating containers of liquids
A machine (10) for treating containers (12) and corresponding lids (11) in order to contain a liquid for feeding animals comprises a first line (50) for washing, treating and filling the containers (12), from which the lids (11) have been removed beforehand, disposed in a first washing direction (X), and a second line (60) for washing and treating the lids (11) removed from the containers (12) disposed in a second washing direction (Y) disposed parallel to the first direction (X). |
US09517852B2 |
Ultrasonic welding device
Device (10) for ultrasonic welding of a flexible, notably tubular, structure (F), to be conformed into sachets, this device including at least two airgaps each defined between a sonotrode (20) and an anvil (30,40) carried by respective support structures (28,54) the distance between which varies between a close together welding position and a spaced apart flexible structure movement position, in which airgaps the flexible structure to be welded is intended to be received to produce at least two weld lines, wherein for each airgap an anvil and/or a sonotrode both associated with this airgap is at least partially mobile relative to a support structure (54) of this anvil or sonotrode. |
US09517848B2 |
Direct broadcast alert apparatus and method
An alert apparatus and an alert method implemented by said direct broadcast apparatus for protection against collisions with debris and the like found in the Earth's atmosphere or in space, said apparatus comprising: —a containing structure mounted outside or inside a body of an aircraft, of a space vehicle or of a flying object in general which moves through the atmosphere or the space, in which sensor means are housed that is arranged for checking a release of debris and the like, coming from said body following an explosion and/or ablation thereof that are dispersed in a hazard space (2) and/or arranged for checking conditions that are referable to said explosion and/or ablation and for detecting features of the hazard space (2), —a processing unit, arranged in the containing structure, connected to the sensor means for processing the features of the hazard space (2) in order to determine the extent and the dynamics of the hazard space (2); —transceiver means arranged for sending an output signal (B) carrying an alert message on the basis of the extent and of the dynamics of said hazard space (2) to a space vehicle (3) and/or to an aircraft (4) having a route intersecting the hazard space (2), and/or to a ground station (5, 17) and/or to an end user (6, 16) arranged on the Earth's surface (20) at a presumed impact area between the hazard space (2) and the Earth's surface (20) in order to activate respective emergency procedures, the sensor means and the transceiver means being positioned at the hazard space. |
US09517843B2 |
Generator for flight vehicle
A flight vehicle includes a fuselage and a gas turbine engine. The gas turbine engine is coupled to the fuselage to provide thrust when air surrounding the flight vehicle is admitted to the gas turbine engine and combusted with fuel. The flight vehicle further includes a generator coupled to the gas turbine engine to provide power to equipment included in the vehicle. |
US09517841B2 |
Ballistic powered inertia reel
A ballistic powered inertial reel device comprises an inertia unit and a ballistic powered unit. The inertia unit includes a reel shaft and a webbing wound on the reel shaft. A reel lock has a disengaged orientation with the reel shaft during normal operation and an engaged orientation to prevent rotation of the reel shaft during an emergency. A control dog drives the reel lock. A geared cam rotates to drive a lock rod which operates against the control dog to drive the reel lock into the engaged orientation. The ballistic powered unit comprises a flywheel coupled to the geared cam. A piston drives the flywheel and a rewind spring couples the flywheel to the reel shaft. Actuation of the piston rotates the flywheel to cause the rewind spring to rotate the reel shaft to rewind the webbing and rotate the geared cam to lock the reel lock. |
US09517839B2 |
Electromechanical linear actuator for in blade rotor control
A rotor blade assembly includes a rotor blade and a movable trim tab located along a span of the rotor blade. A linear positioner is located inside the rotor blade and operably connected to the trim tab to move the trim tab thereby reducing rotor blade vibration. A method for reducing vibration of a rotor assembly includes energizing a linear positioner located inside a rotor blade of the rotor assembly and moving an output piston of the linear positioner. A trim tab located at the rotor blade is moved to a selected trim tab angle relative to the rotor blade by the output piston, and the linear positioner is deenergized thereby locking the trim tab at the selected trim tab angle. |
US09517836B2 |
Method of operating an aircraft fuel management system
A method of operating an aircraft fuel management system for an aircraft having at least one fuel tank, each fuel tank having an associated fuel quantity indicator arranged to provide an indication of the amount of fuel in the associated fuel tank, the method comprising calculating a value for the amount of fuel on board (FOB_FailedFQI) the aircraft to be utilized by the fuel management system in the event of a failure of at least one of the fuel quantity indicators, the amount of fuel on board being calculated as a value for the initial amount of fuel on board (FOBinit) minus the amount of fuel used. Additionally or alternatively a value for the gross weight center of gravity of the aircraft is calculated using an assigned value of fuel for each of the fuel tanks having an associated failed fuel quantity indicator. |
US09517835B2 |
Device for preventing rotational movement of failed selector lever
A selector lever with two detent plates and corresponding detent pins that travel along a shaft includes a float that moves with each of the detent pins. When a detent pin fails, a float pin remains engaged with a catch, thereby preventing rotational movement of the shaft. |
US09517834B2 |
Interface for control of a foldable wing on an aircraft
An aircraft comprises a foldable wing, the wing comprising an inner region and an outer region, such as a wing tip. The outer region is moveable relative to the inner region between a flight configuration and a ground configuration in which the span is reduced. The aircraft comprises a control system and a control interface. The control interface comprises a selector for selecting the desired configuration of the outer region, and is arrange to provide: a first output, such as a light, when the flight configuration is selected and the outer region is in the flight configuration; a second output, such an amber light, when the ground configuration is selected and the outer region is in the ground configuration; and a third output, such as a red light, when the outer region is not in the selected configuration. |
US09517833B2 |
Apparatuses and methods for manufacturing a structure
A structure (100) comprises a first panel (102); first stringers (106), coupled to the first panel (102) and comprising stringer pairs A; a second panel (104) opposite the first panel (102); and second stringers (108), coupled to the second panel (104) and opposite the first stringers (106). The second stringers (108) comprise stringer pairs B. The structure (100) also comprises braces (200). Each of the braces (200) is geometrically interlocked with one of the stringer pairs A of the first stringers (106) and one of the stringer pairs B of the second stringers (108) in all directions along a plane (112) perpendicular to the first stringers (106) and the second stringers (108). |
US09517829B2 |
Aircraft fuselage structure
An aircraft fuselage structure is disclosed having an outer skin, a support structure arrangement with frame elements, and a floor structure arrangement with floor support struts, the floor structure arrangement connected to the support structure arrangement via connection parts. A connection exists between the floor structure arrangement and the support structure arrangement, with a clamping element on the connection part and a locking element on the connection part. The clamping element includes a longitudinal section having a first and a second end. The first end is pivotally attached to the connection part. The second end includes a transverse section, the locking element including at least one locking groove, and the clamping element pivotable between an engagement position in which the transverse section engages the locking groove, and a released position, in which the transverse section is disengaged therefrom. |
US09517828B2 |
Aircraft fuselage frame made of laminated composite materials and including reinforcement curved zones of varying value of radius of curvature
A structural frame for a fuselage of an aircraft. The frame is formed from a composite material profile comprising curved zones (7) that interconnect together zones to be joined of the frame, having respective orientations. Each of the curved zones (7) of the frame is geometrically defined by at least one radius of curvature. The value of the radius of curvature (R2), geometrically defining a curved zone (7) of the frame varies as a function of the curvilinear abscissa of each points on the inside periphery of the inside flange from any point of the curved zone relative to a given reference point (P1). |
US09517825B1 |
Systems and methods for positioning a marine propulsion device to prevent hydro-lock of a marine propulsion engine
A method and system position a marine propulsion device with respect to a transom of a marine vessel to which it is coupled. A controller determines whether an actual speed representing a speed of the vessel or a speed of an engine powering the propulsion device is greater than a given speed and whether a transmission of the propulsion device is in forward gear, and if so, sets a trim control unit of the controller to a ready state. If the transmission is shifted out of forward gear while the trim control unit is in the ready state, the controller sets the trim control unit to an active state. The controller determines whether an actual trim position of the propulsion device is less than a target trim position while the trim control unit is in the active state, and if so, sends a signal to trim the propulsion device up. |
US09517824B1 |
Watercraft
A watercraft kit includes a watercraft and a buoyant removable rear extension optionally connected to a rear of the watercraft. The watercraft includes a hull having a transom and a deck disposed above the hull. The deck is supported by the hull. A propulsion system is operatively connected to an engine for expelling a stream of water rearward of the transom to propel the watercraft. When the removable extension is connected to the rear of the watercraft, the removable rear extension is disposed at least in part rearwardly of the transom. The removable rear extension defines a longitudinal channel. When the removable extension is connected to the rear of the watercraft, the channel receives at least one of at least a portion of the propulsion system, and at least a portion of the stream of water flowing therethrough when the propulsion system is operating to propel the watercraft forwardly. |
US09517812B2 |
Bicycle component operating device for controlling a bicycle component based on a sensor touching characteristic
A bicycle component operating device includes a touch sensor and a controller. The controller is configured to control a bicycle component based on a control signal from the touch sensor. The touch sensor is separate from the bicycle component and is configured to provide the control signal to the controller based on a touching characteristic in which a user performs a subsequent touching of the touch sensor after performing an initial touching of the touch sensor such that the initial touching does not cause the controller to control the bicycle component. |
US09517811B1 |
Bicycle bottom bracket assembly
A bicycle bottom bracket assembly having a rotational central axis includes a support member, a bearing unit and a radially inward force reducing structure. The support member includes a hanger mounting portion and a bearing mounting portion. The bearing mounting portion is configured to be at least partly positioned within a hanger part of a bicycle frame. The bearing unit includes an outer race, an inner race and at least one roller element disposed between the outer and inner races in a radial direction with respect to the rotational central axis. The outer race is fixed to the bearing mounting portion of the support member. The radially inward force reducing structure reduces a radially inward force being transmitted to the bearing unit. |
US09517809B2 |
Scooter
A scooter or bicycle including a chassis is provided. The chassis has a guide bearing for a steering column holding a front wheel and for a supporting arm for a pivotable footboard having a rear wheel. The supporting arm includes a seat. The supporting arm, connected to the pivotable footboard, is pivotally coupled to the guide bearing. A portion of the chassis including the supporting arm and the pivotable footboard is transferable from a first usage position as a scooter, in which the pivotable footboard is substantially parallel with the road surface, by a rotation of 180° around an axis of the supporting arm into a usage position as a bicycle, in which the pivotable footboard supports the supporting arm facing rearwardly from the steering column. The seat is arranged on a side of the supporting arm facing away from the pivotable footboard. |
US09517808B2 |
Handlebar switch
A handlebar switch can include a switch case housing switches, and manipulation members arranged on the switch case and configured to be manipulated by a driver to operate the respective switches. A center portion of the switch case 66 on which the manipulation members are arranged is formed as an expanded section expanded in radial directions of a main body section beyond a right end portion, and a left an end portion of the main body section. The manipulation members are arranged in a center part of the expanded section. |
US09517807B2 |
Vehicle
In a vehicle, a size of an acute angle θL defined by a virtual plane perpendicularly or substantially perpendicularly intersecting with an upper axis and a lower axis of a cross member and a up-and-down direction of a vehicle body frame is smaller than sizes of an acute angle θTR and an acute angle θTL which are defined by an expansion and contraction direction of telescopic elements and the up-and-down direction of the vehicle body frame, and an acute angle θSR and an acute angle θSL which are defined by axes of side rods and the up-and-down direction of the vehicle body frame. The sizes of the acute angle θTR and the acute angle θTL are greater than the size of the acute angle θL defined by the virtual plane perpendicularly or substantially perpendicularly intersecting with the upper axis and the lower axis of the cross member and the up-and-down direction of the vehicle body frame, and are equivalent to or smaller than the sizes of the acute angle θSR and the acute angle θSL. |
US09517804B2 |
Notification system for a vehicle assembly process at an assembly plant and a method
A notification system for a vehicle assembly process at an assembly plant includes a base unit of a vehicle at the assembly plant and a first component coupled to the base unit at a station in the assembly plant to further define the vehicle. A tag is coupled to one of the base unit and the first component. A reader is disposed downstream from the station at the assembly plant. The reader is configured to detect if the tag is coupled to one of the base unit and the first component when the vehicle is scanned by the reader. Furthermore, a method of notifying a user during the vehicle assembly process at the assembly plant includes scanning the vehicle, via the reader that is disposed downstream from the station at the assembly plant, to detect if the tag is coupled to one of the base unit and the first component. |
US09517799B2 |
Vehicle front portion structure
A vehicle front section structure includes: a pair of left and right front side members extending along a vehicle front-rear direction at both vehicle width direction sides of a power unit installed in a vehicle front section; a spacer including an angled wall that is provided at a side face on a vehicle width direction outer side of the front side member, that is disposed at the vehicle width direction outer side of the side face, and that increases in distance from the side face on progression toward a vehicle front side, and including a rear end wall extending from a rear end of the angled wall toward the side face, and a spacer extension portion that is provided at the vehicle width direction outer side of the angled wall of the spacer, and that includes an extension wall extending the rear end wall of the spacer toward the vehicle width direction outer side. |
US09517796B2 |
Thin-walled magnesium diecast shock tower for use in a vehicle
A shock tower assembly includes a cast shock tower body composed of magnesium or magnesium alloy and at least one steel bridging bracket. An insulating adhesive layer is formed between the tower body and the bracket. A mechanical fastener is used for fastening the tower body to the bracket. One or more structural ribbings are formed on the tower body. The mechanical fastener may be selected from any of several mechanical fasteners, including self-piercing rivets. Alternatively, a screw boss may be formed for receiving a screw. The rivet may be inserted from the bracket into the shock tower body or from the shock tower body into the bracket in which case an insulating layer is positioned between the head of the self-piercing rivet and the cast shock tower body. A sealant is preferably formed along the intersection of the cast shock tower body and the steel bridging bracket. |
US09517793B2 |
Method of preventing over stroke in rear-wheel steering system and linear sensor applied thereto
The present invention relates to a method of preventing over stroke in a rear-wheel steering system for a vehicle, and more particularly, to a method of preventing the over stroke of a lead screw using a linear sensor moving together with the lead screw in a rear-wheel steering system. In detail, there is provided a method of preventing over stroke in a rear-wheel steering system, including determining whether a linear sensor which moves in conjunction with a lead screw enters preliminary sections A of a stroke section a and restricting the movement of the lead screw when the linear sensor enters the preliminary sections A. |
US09517784B2 |
Driving assist unit of truck
A driving assist unit of a truck for assisting a driving force applied to the truck by a worker includes a unit body connected to the truck, the unit body being turnable with respect to the truck, an operation portion provided on the unit body, the operation portion being configured to input a driving force to the truck through the unit body by being pressed by the worker, a driving wheel provided on the unit body, the driving wheel being rotatable in a longitudinal direction of the unit body, an assist force according to the operation of the operation portion being applied to the driving wheel, a lower engagement mechanism configured to be engaged with a connecting rod, the connecting being provided protruding to an outside from the truck and perpendicularly with respect to a ground, the lower engagement mechanism being slidable in an axial direction with respect to the connecting rod, and an upper engagement mechanism provided above the lower engagement mechanism and configured to be engaged with the connecting rod, the upper engagement mechanism being slidable in the axial direction with respect to the connecting rod. |
US09517782B2 |
Tools for railway traffic control
Tools (such as system, apparatus, methodology, etc.) may be provided to control traffic over a railway track section, when a railway worker is working on or near the track section. Move particularly, when traffic over the track section is to be blocked, a release code is generated and sent to an electronic contact address of the railway worker. Traffic through the track section is blocked until the release code is entered in the system. |
US09517781B2 |
Air spring for railroad car
An air spring for railroad cars includes an air spring part formed by an upper support on a vehicle body side, an intermediate support arranged therebelow, and a diaphragm made of rubber and extending between the upper support and the intermediate support; and an elastic mechanism b formed by a rubber mass 5 interposed between the intermediate support and a lower support 4 on a bogie side arranged therebelow. The rubber mass 5 has an end in contact with the lower support 4 formed as an enlarged end 5A increasing in diameter as approaching the lower support 4 in a vertical direction. An outer circumferential portion of this enlarged end is fitted in and bonded to an annular groove 12 formed in the lower support 4, and the annular groove 12 has an annular bottom 12A inclined to decrease in height radially outwards to have an annular tapered bottom 12a. |
US09517780B2 |
Apparatus for controlling speed in railway vehicles
An apparatus for controlling speed in railway vehicles is disclosed, the apparatus estimates a future train speed and determines a control input (first speed control) configured to control a train speed based on a TTSLC {Time-To-Speed-Limit Crossing, a time taken by a train from a current time to exceed an ATP (Automatic Train Protection) speed profile, which is an ATP speed limit}, and determines a control input (second speed control) configured to control the train speed based on a difference between the ATP speed profile and an actual train speed, whereby the first speed control or the second speed control is selected in response to the TTSLC and outputted to the train. |
US09517779B2 |
System and method for communicating in a vehicle consist
A system and method communicate a command message from a lead vehicle in a vehicle consist having remote vehicles and the lead vehicle. The command message includes a directive for controlling operations of the remote vehicles. The command message is received at the remote vehicles and reply messages are communicated in response thereto. The reply messages include statuses of the remote vehicles. Responsive to determining that the lead vehicle does not receive the reply message from one or more of the remote vehicles, the statuses of the one or more remote vehicles from which the reply messages are not received at the lead vehicle are sent and/or combined into an individual or concatenated relayed message. The individual or concatenated relayed messages are communicated to the lead vehicle such that the lead vehicle receives the statuses of the one or more remote vehicles. |
US09517777B2 |
Lane departure feedback system
A lane departure warning system for a vehicle includes a positional input device and a seat having an inflatable bladder therein and a vibrational unit coupled with the bladder. A controller is communicatively coupled with the positional input device and with the vibrational unit and includes electronic circuitry programmed to detect a lane departure based on a signal from the positional input device and to cause the vibrational unit to vibrate in response thereto. |
US09517773B2 |
Fuel consumption analysis in a vehicle
Method (400), calculation device (131) and display (130) for causal analysis of the fuel/energy consumption in a vehicle (100), which is driven by a driver (101): Division (401) of the vehicle's fuel/energy consumption over a number of fuel/energy consumers, calculation (402) of the subdivided (401) fuel/energy consumers' fuel/energy consumption in a calculation device (131), and visualization (403) of the subdivided (401) fuel/energy consumers' calculated (402) fuel/energy consumption, on a display (130), which is controlled by the calculation device (131). |
US09517772B1 |
Electronic speed control for locomotives
A drivetrain system for a machine includes an engine, a brake, and a controller operatively coupled to the engine and the brake. The controller is configured to generate a first speed error based on a first speed command signal and a first ground speed signal; generate a first engine speed command signal based on the first speed error; send the first engine speed command signal to the engine; compare the first speed error to an upper threshold; set a brake command signal to an engagement value when a magnitude of the first speed error is greater than a magnitude of the upper threshold; engage the brake in response to setting the brake command signal to the engagement value; and increase a speed of the engine in response to the first engine speed command signal while the brake command signal is set to the engagement value. |
US09517770B2 |
Brake control for stop/start vehicle
A vehicle is provided with an engine and a controller. The engine is adapted to shutdown and restart during a drive cycle and a controller. The controller is programmed to shutdown the engine in response to brake pressure exceeding a pressure threshold and to restart the engine in response to an accelerator pedal position exceeding a position threshold independent of brake pressure. |
US09517768B2 |
Method for object processing and vehicle supporting the same
A vehicle for supporting an object processing includes a lidar sensor configured to collect multi-layer data corresponding to sensor information for a lateral surface for each vertical interval. A controller is configured to classify objects by clustering each layer for the multi-layer data, extract contours and shapes of the objects, and then control a convergence of the objects based on a calculated value of a Mahalanobis distance between the clustered objects, and a method for an object processing. |
US09517766B2 |
Parking assistance device and parking assistance device control method
A parking assist device includes a target steering angle setting section configured to set a target value of the steering angle; a target vehicle speed setting section configured to set a target value of the vehicle speed; an automatic steering control device configured to automatically steer the steering wheel so that the sensed steering angle becomes the target steering angle; an automatic vehicle speed control device configured to automatically control the vehicle speed so that the sensed vehicle speed becomes the target vehicle speed; and a parking space recognizing section configured to recognize a parking space of the host vehicle, the host vehicle being parked within the recognized parking space by the automatic steering control device and the automatic vehicle speed device. |
US09517765B2 |
Hybrid vehicle running control apparatus
A hybrid vehicle running control apparatus that is mounted in a hybrid vehicle that has a high-voltage battery and a low-voltage battery, and is selectively controlled to drive in a first running mode in which an electric motor to which power is supplied from the high-voltage battery is used as a drive source, and a second running mode in which an engine is used as the drive source, includes a transport state determining portion that determines whether the hybrid vehicle is in transport; and a battery running inhibiting portion that inhibits the hybrid vehicle from running in the first running mode when it is determined by the transport state determining portion that the hybrid vehicle is in transport. |
US09517764B2 |
Methods and system for operating a hybrid vehicle in cruise control mode
Systems and methods for reducing driveline mode change busyness for a hybrid vehicle are presented. The systems and methods may delay a driveline mode change in response to a time since a change from a first desired vehicle speed to a second vehicle speed, or alternatively, driveline mode changes may be initiated in response to an estimated time to change from the first desired vehicle speed to the second desired vehicle speed. |
US09517755B1 |
Autonomous braking system and autonomous braking method
An autonomous braking system includes a detecting module, a tracing module, a collision path prediction module, a memory register, a collision time prediction module and a decision module. The detecting module recognizes multiple objects located ahead of a vehicle, and then the tracing module traces the moving objects. The collision path prediction module is used to obtain a possible collision range and a non-collision range. The memory register records the coordinate of the objects located within the possible collision range. When one of the objects moves out of the possible collision range, its data is instantaneously removed from the memory register. The collision time prediction module predicts a collision time between the vehicle and each of the objects. The decision module determines if a brake assist is activated in accordance with the collision time. |
US09517750B2 |
Vehicle wiper device
A wiper of a vehicle wiper device moves between a first position, which is a stop position, and a second position. A first pivot member is pivoted back and forth about a first axis by a drive force of a drive source. A second pivot member is pivotal about a second axis. A coupling pivot member is coupled to the first pivot member pivotally about a third axis and the second pivot member pivotally about a fourth axis. The wiper is coupled to and pivoted integrally with the coupling pivot member. A third position is located between the first position and the second position. A line extending through the third axis and the fourth axis is parallel to a line extending through the first axis and the second axis when the wiper is in a first movable range between the first position and the third position. |
US09517749B2 |
Vehicle body side structure
A vehicle body side structure includes a pair of left and right pillars, a center bulk, and gussets. The pair of pillars extend in an up-down direction in side parts of a vehicle body. The center bulk is disposed behind a seat of a vehicle and extends between the pillars in a vehicle width direction. The gussets are connected to the pillars and the center bulk. The gussets each include a first connecting portion connected to a corresponding one of the pillars, a second connecting portion connected to the center bulk, a retractor attachment portion provided below the first connecting portion and the second connecting portion and serving as a component attachment portion where a vehicle body component is attached, and a fragile portion provided between the second connecting portion and the retractor attachment portion. |
US09517746B2 |
Bag-in-bag safety restraint with directional inflation
An air bag system deploys from within a structural element of a vehicle. A main bag is configured for storage in a folded condition in an internal region behind a covering of the structural element, wherein the main bag has a distal end configured to rupture a tear seam in the covering. A shielding bag is disposed over an inflator and has a projection body extending away from the inflator to a remote edge within the main bag. The projection body is substantially continuous in the direction of the main bag except for at least one gas passage at the remote edge for coupling inflation gas from the inflator to the main bag. The main bag has a fold proximate to the gas passage so that inflation of the main bag begins with the unfolding of the fold in a manner that displaces the main bag toward the tear seam. |
US09517745B1 |
Airbag cushion to housing retaining feature and related methods and systems
Apparatus, methods, and systems for retaining an airbag cushion to an airbag housing. Some embodiments may comprise an airbag housing comprising an outer surface, an airbag coupling ring configured to fit over the outer surface of the airbag housing, and an airbag cushion positioned in between the airbag housing and the airbag coupling ring such that the airbag cushion is pinched between the airbag coupling ring and the outer surface of the airbag housing so as to retain the airbag cushion to the airbag housing during deployment of the airbag cushion. |
US09517741B2 |
Wheel deflector bracket and method
A vehicle wheel deflector bracket and method is provided. The bracket is attachable to a vehicle having a wheel, a door, and a body structure supporting a door hinge. The bracket is configured to deflect a force from the wheel to the body structure and away from the door hinge when the bracket is attached to the body structure. |
US09517740B2 |
Sound output device for vehicle
A loudspeaker device is installed in a space between a bumper reinforcement for reinforcing a bumper of a vehicle and a bumper absorber attached to a front side of the bumper reinforcement. An approach notification sound output from a front side of the loudspeaker device is radiated outside through a first opening provided on a driver's seat side of the bumper absorber. An approach notification sound output from a rear side of the loudspeaker device passes through a sound path between the bumper reinforcement and the bumper absorber and is then radiated outside through a second opening provided on a passenger seat side of the bumper absorber. |
US09517737B2 |
Relay control between power distribution center and body control module
Electrical devices in a vehicle engine compartment are controlled from the vehicle passenger compartment over a serial data bus that extends between a relay controller located in the engine compartment and a body control module located in the passenger compartment and which receives commands from various passenger compartment devices. A serial data link passing through the firewall couples the body control module to the relay controller. |
US09517736B2 |
Stackable automotive water shields including a channel with inwardly angled walls containing an adhesive
A stackable water shield comprising a body portion having a width and length and thickness, said body having a wet surface, said body further having a channel formed between inwardly angled walls in a portion of the body, said channel having a width and a depth sufficient to accept a sufficient amount of glue, said glue amount not extending to the wet surface of the water shield, said water shields stackable without interposing a glue protective barrier such as a release sheet between said stacked water shields. |
US09517729B2 |
Adjustable and/or repositionable bicycle mount
A repositionable mount and related methods including a method for mounting a bicycle to a bicycle rack The repositionable bicycle fork mount can include a mount for connection to a vehicle to support the bicycle fork, a bicycle fork receiver coupled to the mount, the bicycle fork receiver being configured to receive and secure the bicycle fork, and means for repositioning the mount and/or bicycle fork receiver with respect to the vehicle. Repositioning the mount and/or a bicycle fork receiver with respect to the vehicle can include a forward most position related to a relatively large bicycle and a rearward most position related to the relatively small bicycle such that a rear wheel of both the relatively large bicycle and a rear wheel of the relatively small bicycle are supported by a rear tailgate of the vehicle when attached to the properly positioned repositionable bicycle fork mount. |
US09517728B2 |
Adjustable bag hoop
A golf cart is provided with an adjustable golf bag hoop. The hoop is provided with a rod and a cam-locked collar. The collar is moveable along the length of the rod to adjust to varying heights of golf bags. |
US09517726B1 |
Vehicle cargo organiser
A cargo organizer for a vehicle includes a frame at least partially forming a floor of a cargo area of the vehicle. The cargo organizer includes one or more elongate elements extendable across an opening defined by the frame. The elongate elements are slidable with respect to the frame. |
US09517723B1 |
Illuminated tie-down cleat
A vehicle is provided that includes a pickup box defining a storage area therein with at least one cleat assembly extending into the storage area. The cleat assembly includes a base, a tie-down cleat coupled to the base, and a lock assembly. The lock assembly is configured to removably couple the tie-down cleat to the base. The lock assembly includes a translucent polymer and a first phosphor material and a key configured to operate the lock assembly. The key includes a polymeric material mixed with a second phosphor material. |
US09517722B2 |
Vehicle interior illumination device
A vehicle interior device includes a first illumination unit configured to illuminate a first region of a passenger compartment of a vehicle, a second illumination unit configured to illuminate a second region in a rear part of the vehicle more rearward than the first region and being disposed in the upper part of the passenger compartment, a third illumination unit configured to illuminate a third region in a low part of the vehicle lower than the first region and being disposed in the front part of the passenger compartment, a fourth illumination unit configured to illuminate a fourth region in the rear part and in the low part, and a controller programmed to differentiate at least one of an intensity of the first illumination unit relative to the fourth illumination unit and an intensity of the second illumination unit relative to the third illumination intensity unit. |
US09517720B2 |
Visible school stop sign apparatus
A school bus sign with increased visibility is provided. The school bus stop sign apparatus includes at least a first stop sign and a second stop sign. The first stop sign may be pivotally attached to the side of a school bus. The second stop sign is attached to and substantially parallel with the side of the school bus. The second stop sign includes an indicator that allows drivers to sense that the bus is stopped to pick up children. When activated, the first stop sign may pivot 90 degrees and may be substantially perpendicular to the side of the bus. The indicator, such as a light, may be activated on the second stop sign. Therefore, a driver may see that the bus is picking up children from the front, the rear and the side. |
US09517719B2 |
Method and device for automatic direction indication
A method for automatic direction indication for a vehicle includes the following steps: detecting a driver activity and/or a vehicle position by a Lane Keeping System and/or a Lane Departure Warning System; and automatically activating or deactivating a direction indicator of the vehicle dependent on the detected driver activity or vehicle position. |
US09517718B2 |
Automatic activation of turn signals in a vehicle
According to various embodiments, turn signals are automatically activated in response to signals received from a navigation system, based on the navigation instructions generated by the navigation system. The navigation system of a vehicle (either built into the vehicle or provided as a stand-alone unit) is communicatively coupled with or otherwise integrated with the turn signals of the vehicle. When the navigation system instructs the driver to perform a maneuver (such as making a turn), it can also cause the appropriate turn signal to be automatically activated at the appropriate time and/or distance in advance of the maneuver. When the navigation system detects that the maneuver has been made, or that the driver has ignored the system's instructions, the turn signal can be automatically deactivated. |
US09517717B2 |
Automotive lamp
A light emitting lamp according to one embodiment of the present invention includes a laser light source, a scanning unit, which scans the laser light emitted from the laser light source so as to form a visible light distribution pattern, an obstacle detector, which detects an obstacle, if any, in front of a driver's vehicle, and a control unit, which adjusts the intensity of the laser light irradiated to an obstacle existent region, according to the distance from the driver's vehicle to the obstacle, based on the detection result of the obstacle detector. |
US09517716B2 |
Light sensor
In a light sensor, an operational determination circuit determines based on first and second intensity signals respectively indicative of intensities of light irradiated from above and ahead of a vehicle whether the vehicle is positioned under a shield structure, determines whether it is necessary to turn on a light in the vehicle for the shield structure, and outputs a result of determination as a determination signal. A communication output circuit receives the first intensity signal and the determination signal, and outputs information to a control unit whether it is necessary to turn on the light for the shield structure when the vehicle is positioned under the shield structure. |
US09517709B2 |
Vehicle seat
A vehicle seat is obtained capable of suppressing the occurrence of wrinkles in natural leather employed in a cover while suppressing a reduction in seating comfort of the seat. A non-woven fabric is disposed between a foam member and a foam member, so as to cover a portion of contact with the buttocks of a seated occupant, as viewed from above. The non-woven fabric suppresses extension and contraction of natural leather at the pressed portion, thereby suppressing the occurrence of wrinkles in the natural leather at the pressed portion. By only suppressing the extension-contraction amount of the natural leather at the portion where wrinkles are liable to occur, the occurrence of wrinkles in the natural leather can be suppressed while suppressing a reduction in the seating comfort of the seat. |
US09517705B1 |
Electric vehicle driving range optimization system with dynamic feedback
A method is provided that aids the driver of an electric vehicle (EV) in optimizing their car's driving range. In response to the car's current driving range falling below a preset value, the system provides the driver with one or more recommendations as to how to increase range, recommendations such as lowering top speed, altering the temperature settings of the car's HVAC system, etc. Additionally, the system provides the driver with real time driving range feedback, thereby helping the driver to evaluate the various recommendations and determine which approach is best suited to the current conditions. |
US09517704B2 |
Apparatus for controlling rotary machine
In a control apparatus, an extractor extracts, from a rotational speed of a rotating member, a vibration component included in the rotational speed of the rotating member. A first suppressor performs first suppression to suppress the rotational speed of the rotating member from changing due to change of a speed change ratio. A mode setter switchably sets one of an enabling mode to enable the first suppression or a disabling mode to disable the first suppression in the control apparatus according to a parameter indicative of the speed change ratio. A second suppressor performs second suppression to suppress change of the vibration component generated based on switching of one of the enabling mode and the disabling mode to the other thereof. |
US09517702B2 |
Power supply system, electrically assisted system, and electric gear shift system
A power supply system is basically provided for supplying electric power to an electric component of a bicycle. The power supply system includes a first battery, a second battery, an operating unit and a power supply controller. The power supply controller is configured to transition an operating state by electric power of the second battery and supply electric power from the first battery to the electric component when the operating unit is operated in a stopped state. |
US09517698B2 |
System and method for power management during regeneration mode in hybrid electric vehicles
A system and method for recovering the optimum power level during regenerative mode is disclosed. Equations for determining the optimum regenerative power level receivable by an energy storage system, for example for any given deceleration event, are derived and disclosed. The equations consider various losses such as the efficiency of the electric motor generator in the generator mode, wind resistance, rolling resistance, transmission losses, engine losses, and losses in the energy storage system. Also disclosed is at least one embodiment of a procedure for controlling a hybrid drive system to achieve the optimum energy recovery. |
US09517696B2 |
Vehicle control system
A system includes a contactor system, a vehicle control unit, and a fault diagnostic system. The contactor system includes one or more contactors. The vehicle control unit is coupled to the contactor system via a first connection and a second connection. The vehicle control unit is configured to provide a controlling signal to the contactor system through at least one of the first connection and the second connection to control the one or more contactors. The fault diagnostic system is configured to identify faults occurring in the first connection and the second connection. A method is also provided. |
US09517694B2 |
Power hop cancellation using an electronic limited slip differential
Vehicles, systems and a method for mitigating power hop in a vehicle are provided. The vehicle, for example, may include, but is not limited to a drivetrain, an electronic limited slip differential mechanically coupled to the drivetrain, and a controller communicatively coupled to the electronic limited slip differential, wherein the controller is configured to determine when the vehicle is experiencing a power hop event or when the vehicle may experience a future power hop event, and cause, when the vehicle is experiencing the power hop event or when the vehicle may experience the future power hop event, the electronic limited slip differential to apply torque differentiation pulses to the drivetrain. |
US09517690B2 |
Vehicle driving control device
A vehicle driving control device for a vehicle includes a control unit configured to stop operation of an electric motor driving device driving an electric motor at a time a rotary element is fixed to be unable to rotate by an engagement by an engaging mechanism, and to recover the operation of the electric motor driving device at a time a predetermined condition based on a parameter relating to a driving of the vehicle is satisfied before releasing the engagement by the engaging mechanism. |
US09517689B2 |
Hybrid powertrain unit for motor vehicles with a device for transmission to a further axle of the motor vehicle
A hybrid powertrain unit comprises an engine, and a gearbox device with a primary shaft connectable to an engine shaft via a clutch. The gearbox device comprises a secondary shaft with an output pinion meshing with a first crown wheel of a differential, the casing of which is rigidly connected to the casing of the gearbox device. The unit comprises an electric machine configured to function as an electric motor and an electric generator, having a shaft connected by a transmission to a second crown wheel of the differential. In the transmission, arranged between the electric machine shaft and the second crown wheel is an engagement device that can be driven via an actuator. The electric machine shaft is connected to the engine shaft, on a side opposite to the gearbox device. The transmission includes a gear for driving a transmission shaft connected to a further axle of the vehicle. |
US09517687B2 |
Battery unit mounting structure
A battery unit mounting structure includes a pair of right and left vehicle body frame members extending in a vehicle front-rear direction, a pair of right and left side members extending in the vehicle front-rear direction, a battery unit disposed between the right and left side members, and a reinforcement. The right and left vehicle body frame members are disposed respectively at right and left outer side portions of a vehicle body in a vehicle-width direction. The right and left side members are connected respectively to inner sides of the right and left vehicle body frame members in the vehicle-width direction. The reinforcement is disposed on a bottom or top surface of the battery unit, and disposed at a position at which the reinforcement overlaps with the battery unit in a plan view. The reinforcement extending in the vehicle-width direction is longer than the battery unit in the vehicle-width direction. |
US09517684B2 |
Soft front cockpit cover
A foldable roof assembly having a soft panel top assembly for a vehicle in sealing engagement with a hard top portion of a roof. The soft panel top assembly has a fixed portion attached to the vehicle and a lightweight pivotal portion that folds back to provide the occupant a quick and easy open air effect. Two door rails of the soft panel top assembly are connected to the vehicle. Two side bows are attached to a first bow member, which is secured to a windshield frame when in a closed position, and are connected at a pivot point created with a bracket attached to the door rails to allow the pivotal portion to pivot to an open position. The soft panel top assembly includes a rear header that is a wireframe and engages with seals in the hard top roof portion to provide a weatherproof seal. |
US09517681B2 |
Apparatus and method for radiant heating and cooling for vehicles
The passenger compartment of a vehicle, e.g., an automobile or other automotive vehicle, train, aircraft or watercraft, is heated or cooled using radiant heating or radiant cooling. As another option the automobile or other vehicle is heated using a low velocity blower. |
US09517680B2 |
Vehicle air conditioning apparatus
A vehicle air conditioning apparatus is provided that can prevent temperature variations of the air after the heat exchange in a radiator to reliably control the temperature of the air supplied to the vehicle interior. During the heating operation and the heating and dehumidifying operation, target degree of supercooling SCt when target air-blowing temperature TAO is a predetermined temperature or higher is set to SCt1 that is greater than SCt2 when the target air-blowing temperature TAO is lower than the predetermined temperature. When amount of air Ga supplied from indoor fan 12 is lower than a predetermined value, the target degree of supercooling SCt is corrected, which is set such that the degree of supercooling is lower than target degree of supercooling corrected when the amount of air Ga supplied from the indoor fan 12 is a predetermined value or higher. |
US09517677B2 |
Vehicle air conditioning system
A vehicle air conditioning system includes a duct, a refrigerant evaporator, an air conditioning cooling flow passage, a heater core, a heater hot fluid flow passage, a heat exchanger, an electric heater, an electrical component cooling flow passage, a communication flow passage, a fluid temperature sensor and a flow passage selector valve. The duct provides air to a vehicle cabin interior. The cooling flow passage provides cooled refrigerant to the evaporator. The hot fluid flow passage provides hot fluid to the heater core. The heat exchanger exchanges heat between the refrigerant and the hot fluid. The heater warms the hot fluid having undergone heat exchange. The cooling flow passage cools an electrical component. The communication flow passage parallelly connects the hot fluid and electrical component flow passages. The valve allows hot fluid to flow into the cooling flow passage when the hot fluid has a high temperature. |
US09517674B2 |
Pneumatic control system for a heavy-duty vehicle
A pneumatic control system for a heavy-duty vehicle includes an air supply in fluid communication with a height control valve and an air spring. An air lock valve is in fluid communication with the height control valve and the air spring, and is also in fluid communication with a blank cavity. The air lock valve includes an “air lock off” position and an “air lock on” position. When the air lock valve is in the “air lock off” position, fluid flows from the height control valve, through the air lock valve to the air spring. When the air lock valve is in the “air lock on” position, fluid communication between the air spring, the air lock valve and the height control valve is prevented and, instead, fluid flows from the air spring, through the air lock valve to the blank cavity. |
US09517671B2 |
Vibroisolating device with a nonlinear force vs. displacement characteristic and a motor vehicle suspension system comprising such vibroisolating device
A vibroisolating device (1) comprises a substantially elastomeric core (2) configured to be connected with a first displaceable object (3) and provide with an opening (21) configured to be connected with a second displaceable object (4). In order to obtain a nonlinear force vs. displacement characteristic of the device, substantially symmetrical around a certain and adjustable nonzero displacement value, the device (1) comprises at least one Belleville spring (5) disposed on the vibration transmitting path between said first displaceable object (3) and said second displaceable object (4), which is at least partially embedded in the volume of said substantially elastomeric core (2) and surrounds said opening (21). In particular the spring (5) is preloaded while said vibroisolating device (1) is in vibrations equilibrium position. The invention also relates to a motor vehicle suspension, in particular an adjustable active suspension system, comprising such a vibroisolating device. |
US09517666B2 |
Vehicle wheel and tire information acquisition device fitting
A vehicle wheel includes a rim that extends in the wheel circumferential direction, that includes a rim hump formed in a convex form projecting to the outside in the wheel radial direction, and a through hole formed on a rim inclined face that is slanted to an inside in the wheel radial direction on an inside in a wheel width direction from a top of the rim hump. When the tire is fitted, a tire cavity region facing the rim hump is formed. The wheel includes a tire valve fitted to the through hole and a tire information acquisition device installed in the tire cavity region on the tire valve that acquires tire information on the condition of gas filling the tire cavity region. A fitting is provided between the rim inclined face and the tire information acquisition device. |
US09517660B1 |
Studded tire and method of increasing tire traction
A tire may include a tire body having an annular groove formed in a tread surface of the tire body. A plurality of spaced-apart studs may be located within the groove. |
US09517658B2 |
Axle assembly with carrier housing having increased strength and reduced mass
An axle assembly with a Salisbury-type axle housing that includes a carrier housing. The carrier housing is constructed with a system of reinforcements in selected areas. |
US09517656B2 |
Rim insert system
The invention relates to a rim insert system for a rim having at least one opening which forms a rim channel that tapers in a funnel-like manner, and at least one funnel-like rim insert releasably engaged in the opening. The rim insert has a peripheral catch edge which engage behind an internally arranged opening edge of the rim channel in an inserted position. A first catch projection is in abutment with an inclined portion of the opening edge. The inclined portion and the inner face of the rim channel are disposed at an angle of approximately from 200°-240° in cross-section. A second catch projection is substantially diametrically opposed to the first catch projection and engages behind the opening edge in a positive-locking manner. The inner face of the rim channel and the opening edge form an angle of approximately from 270° to 290°. |
US09517653B2 |
Information processing for executing pre-press and press processes
When two or more post-processing devices are designated for a print job, two or more attribute values (finished size, imposition method, finishing, etc.) of each print attributes which can be set for the print job are allowed to set. When two or more finished size attribute values are set, finished pages having a size smaller than a given finished size and register marks are sequentially laid out in a finished page having the given finished size in a nested manner. |
US09517651B2 |
Developer for thermal recording media and thermal composition media using the same
The subject invention more specifically discloses compounds which are particularly useful as a developer for thermal recording media. These compounds include p-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, m-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, o-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, p-(p-{3-[m-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, and p-(m-{3-[o-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol. The present invention also reveals a thermal recording sheet having a thermal recording layer containing a colorless or pale colored dye precursor and a color developer reactable with said dye precursor upon heating to develop a color, wherein said color developer is a compound selected from the group consisting of p-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, m-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, o-(p-{3-[p-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, p-(p-{3-[m-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol, and p-(m-{3-[o-(p-hydroxyphenoxy)phenyl]ureido}phenoxy)phenol. |
US09517645B2 |
Sheet conveyer device and inkjet recording apparatus
A conveyer device, including a chassis defining a first conveyer path and a second conveyer path; a pair of path members opposing to each other to form a part of the first conveyer path; a flapper configured to be pivotable among a first condition, wherein the flapper blocks the first conveyer path, a second condition, wherein the flapper allows the sheet conveyed in the conveying direction to pass thereby, and a third condition, wherein the flapper is separated from an opposing member; an urging member to urge the flapper; and a movable member movable between a first position, wherein the flapper in the first condition is contactless from the movable member, and a second condition, wherein the movable member contacts the flapper, is provided. The movable member separates one of the pair of path members from the other when moving from the first position to the second position. |
US09517643B2 |
Recording device and control method therefor
When a paper jam occurs while printing, the control unit of a printer 1 retracts the head carriage 59 at a slow speed (initial retraction speed V1), and retracts the head carriage 59 at the slow speed to the target retraction position if the access cover 11 is not opened. If the access cover 11 is opened during retraction, the speed of head carriage 59 movement is changed to a faster retraction speed (high retraction speed V2). If the head carriage 59 is retracted quickly when the access cover 11 is opened, there is little chance of a user that wants to quickly restore printer 1 operation catching the stuck paper P on the printhead 22 and tearing the paper P. There is therefore little chance of problems resulting from torn pieces of paper being left inside the printer 1. |
US09517642B2 |
Printing apparatus
A decision is made for each page as to whether to allow image printing on that page, by comparing the remaining sheet length DL with a length of an image about to be printed, IL. A length of a non-printed, rear-end cut sheet is also checked to determine whether the non-printed cut sheet needs to be further cut into smaller sheets. This arrangement can prevent a complete image to be printed in one page from being broken and only partly printed in the last portion of a paper roll, ensure that printed cut sheets and non-printed cut sheets are stably conveyed and discharged and enable the non-printed cut sheets to be almost equal in size so that they can be properly accommodated in the associated tray. |
US09517638B2 |
Light scanning apparatus and image forming apparatus
A light scanning apparatus, including: an optical box configured to hold a deflector and an optical member; and a cover, the optical box including: a concave-shaped cut-away portion formed from a top portion of a side wall toward a bottom portion; and a connecting wall which stands from the bottom portion of the optical box and is bent and branched from the cut-away portion to an inside of the optical box so as to cross over the cut-away portion, the cover including a dustproof member sandwiched between the cover and the side wall and between the cover and the connecting wall which a cable passes, wherein a height of a distal end of the connecting wall, which the cable passes, from the bottom portion is larger than a height of a base portion of the cut-away portion from the bottom portion. |
US09517636B2 |
Image forming method, image forming apparatus, and print material production method to form an electrostatic latent image by selective light power exposure
An image forming method forms an electrostatic latent image corresponding to an image pattern including an image portion and a non-image portion by exposing a surface of an image bearer with light according to the image pattern. The image portion includes a plurality of pixels. Among the pixels constituting the image portion, at least a group of pixels existing at a boundary with respect to the non-image portion is set as a non-exposure pixel group. Among the pixels constituting the image portion, at least a group of pixels existing at a boundary with respect to the non-exposure pixel group is set as a high power exposure pixel group where exposure is performed with light of a higher light power value than a predetermined light power value required for exposing the image portion. |
US09517631B2 |
Liquid-consuming apparatus
A liquid-consuming apparatus includes: a tank including a liquid storage chamber configured to store a liquid, an inlet through which the liquid is poured into the liquid storage chamber, and a liquid flow channel configured to let the liquid flow therethrough from the liquid storage chamber; a cap configured to be attachable to the tank to cover the inlet; a cover configured to be movable relative to the tank between a closed position where a surface, of the tank, in which the inlet is formed is covered and an open position where the surface of the tank is exposed; and a holder configured to hold the cap removed from the tank. The cover is prevented from moving to the closed position by the cap held by the holder to be positioned in a movement area of the cover moving from the open position to the closed position. |
US09517628B2 |
Printing apparatus, method, and non-transitory storage medium
A printing apparatus comprises an ink tank containing ink, a sub-tank containing the ink supplied from the ink tank, a printhead discharging the ink supplied from the sub-tank, a detection unit configured to perform a detection operation of detecting an ink remaining amount of the sub-tank, a suction unit configured to perform a suction operation of sucking the ink from the printhead, and a control unit configured to stop the suction unit from performing the suction operation when the detection unit detects that the ink remaining amount becomes smaller than a predetermined residual amount during execution of the suction operation. |
US09517626B2 |
Printed circuit board fluid ejection apparatus
In an example, a fluid ejection apparatus includes a printhead die embedded in a printed circuit board. Fluid may flow to the printhead die through a plunge-cut fluid feed slot in the printed circuit board and into the printhead die. |
US09517622B2 |
Liquid droplet forming apparatus
There is provided a liquid droplet forming apparatus comprising: a liquid holding part configured to hold a liquid including precipitating particles; a film member configured to be vibrated so as to eject the liquid held in the liquid holding unit, wherein a nozzle is formed in the film member and the liquid is ejected as a droplet from the nozzle; a vibrating unit configured to vibrate the film member; and a driving unit configured to selectively apply an ejection waveform and a stirring waveform to the vibrating unit, wherein the film member is vibrated to form the droplet in response to applying the ejection waveform and the film member is vibrated without forming the droplet in response to applying the stirring waveform. |
US09517620B2 |
Printing device and printing method
A printing device is provided and includes: a head unit and a controller. The head unit performs a main scan operation corresponding to each of a predetermined N-number of printing passes (N is an integer of three or greater) on a same area of a medium in a multi-pass mode, and the controller sets a density of printing to be performed in a k-number of last printing passes (k is an integer which is equal to or greater than 1 and is less than N), so as to be lower than a density of printing to be performed in the (N−k)-th printing pass, and sets a density of printing to be performed by a plurality of individual nozzles of the nozzle row of the head unit for ejecting ink drops in the (N−k+1)-th printing pass, so as to gradually decrease toward a head rear end side. |
US09517618B2 |
Endless flexible belt for a printing system
A flexible belt is disclosed for use in a printing system. The belt comprises an endless strip which, in use, travels along a continuous path. Formations are provided along the sides of the strip which are capable of engaging with lateral tracks to place the belt under lateral tension, the lateral tracks further serving to constrain the belt to follow the continuous path. |
US09517615B2 |
System and method for automated backing film removal
A backing film removal system including a substrate support member configured to support a substrate, where a backing film is attached to the substrate, a backing film separating member arranged operatively with respect to the substrate support member such that at least a portion of the backing film separating member is positionable between at least one portion of the substrate and backing film when the substrate is disposed on the substrate support member, a backing film holding member configured to maintain a separation between the substrate and backing film at the at least one portion of the substrate and backing film, and at least one drive unit connected to one or more of the substrate support member and the backing film separating member and operable to cause relative movement between the substrate support member and the backing film separating member. |
US09517613B2 |
Method of forming a composite structure comprising a flange
Method forming a composite structure (9) comprising a main body and a flange. The composite structure is manufactured by laying-up a preform (7) on a mold (6). The preform (7) does not have the first and second bends and comprises a first part which corresponds to the main body of the composite structure and a second part which corresponds to the flange of the composite structure. The second part of the (preform (7) has a proximal portion which corresponds to the wall portion of the flange and a distal portion which corresponds to the lip portion of the flange. The preform (7) comprises a plurality of plies and uni-directional ply material extends from the first part of the preform (7) to the distal portion of the second part of the preform (7). The flange is formed by advancing movable portion(s) (62) of the mold 6 to form the proximal portion of the second part of the preform (7) to create the first bend (81) and by forming the distal portion of the second part of the preform (7) around the advancing movable portion(s) (62) of the mold (6) to create the second bend (83). The presence of the two bends (81, 83) ensures that the ply material (78) is kept in tension during the forming operation. |
US09517610B2 |
Grippers based on opposing van der Waals adhesive pads
Novel gripping structures based on van der Waals adhesive forces are disclosed. Pads covered with fibers can be activated in pairs by opposite forces, thereby enabling control of the adhesive force in an ON or OFF state. Pads can be used in groups, each comprising a group of opposite pads. The adhesive structures enable anchoring forces that can resist adverse forces from different directions. The adhesive structures can be used to enable the operation of robots on surfaces of space vehicles. |
US09517604B2 |
Vulcanized tire vulcanization apparatus
A vulcanization apparatus provided with a vulcanization vessel for vulcanizing a green tire and a suction line for sucking out gas from inside the vulcanization vessel after the vulcanization vessel has been opened. Accordingly, oily smoke generated when vulcanized rubber has been removed from a bladder and an inner wall of a mold can be more efficiently discharged than in cases in which gas inside a vulcanization vessel is sucked out and additional air is introduced into the vulcanization vessel only prior to opening the vulcanization vessel. |
US09517603B2 |
Process and apparatus for moulding and curing tyres
An apparatus for molding and curing a green tire includes a curing mold that includes a first sidewall plate and a second sidewall plate, with a ring of circumferential sectors circumscribing a mold cavity. The first sidewall plate is capable of coming into contact with a first annular fixing structure of the green tire when the green tire is inserted into the mold. The apparatus also includes at least a first bead molding ring movable from a first contracted operating position to a second extended operating position, a second bead molding ring movable from a first contracted operating position to a second extended operating position, and an expandable bladder delimited by a membrane associated for operation with the mold to exert a pre-molding pressure which is lower than a molding pressure to bring the first annular fixing structure into contact with the first sidewall plate. |
US09517597B2 |
Methods of making ground containment liners
The present invention provides methods of making containment liners to protect the environment from spills and leaks at oil and/or gas production sites and other sites. The containment liners comprise a first felt geotextile layer and a polymeric barrier layer embedded partially into the felt geotextile layer. |
US09517595B2 |
Composite and method for making same
A composite includes a substrate having an oxide layer, a nano film formed on the oxide layer, a plastic member, the nano film has a three-dimensional network structure, the plastic member covers the nano film and penetrates into the three-dimensional network structure, the plastic member bonds with the substrate through the nano film and the oxide layer. |
US09517589B2 |
Method for mounting adjustable mechanism for motor vehicle
An adjustable mechanism for a motor vehicle is used to adjust an adjustable element in a motor vehicle, especially a seating part. The mechanism includes a spindle nut comprising an axis, the spindle nut co-operating with a thread spindle and comprising external toothing on the external surface thereof which is in contact with an additional drive element. The external toothing of the spindle nut is formed by recesses in the external surface of the spindle nut which are inwardly turned in a radial manner, the teeth depths thereof diminishing in the direction of at least one axial end of the spindle nut. |
US09517587B2 |
Method for manufacture of dry adhesive backed flooring
A dry adhesive backed flooring for being installed in a flat orientation on a subfloor, the flooring including a sheet flooring material and a double-sided sheet adhesive married to the flooring material. The installed flooring is substantially free of bubbles and wrinkles and the flooring remains substantially flat as initially applied and does not significantly rise from the subfloor, bubble or otherwise detach from the subfloor under normal use conditions for the flooring. |
US09517585B2 |
Washing machine and method of manufacturing the same
A washing machine includes: a cabinet and a tub that is installed in the cabinet and holds washing water. The tub includes a cylindrical housing, and the housing is formed by blow molding. |
US09517582B2 |
Method of molding a part
The present disclosure provides a method of molding a part. The method may include rotating a screw within a barrel to extrude a molten material through a nozzle orifice into a mold cavity to fill the mold cavity with the molten material, stopping rotation of the screw upon the mold cavity being filled with the molten material, monitoring a parameter indicative of a pressure in the mold cavity, and further rotating the screw to extrude additional molten material into the mold cavity when a drop in pressure in the mold cavity is detected. |
US09517580B2 |
Nozzle touch mechanism and injection molding machine
A nozzle touch mechanism (50) includes a base frame (6), a stationary platen (4) to which a mold (5) is to be attached, and an injection mechanism (1). The injection mechanism (1) is moved it toward the stationary platen (4) by means of a ball screw shaft (11). A motor portion (14) which applies a pressing force to the mold (5) from a nozzle (3) is connected to one end (11a) of the ball screw shaft (11). A connection mechanism (7) is provided which is connected to the other end (11b) of the ball screw shaft (11) and to the stationary platen (4) at a support located above the center of the nozzle (3). When no pressing force is applied to the mold (5) from the nozzle (3) by the motor portion (14), springs (18) can press the connection mechanism (7) in such a direction as to move it away from the stationary platen (4) with respect to the base frame (6). |
US09517578B2 |
Method for manufacturing biodegradable moldings in particular tableware and packages
Method for manufacturing biodegradable moldings, in particular tableware and packages, with application of the method of evoking the water vapor pressure inside the mold consists in that loose bran, preferably the wheat bran, of granulation from 0.01 up to 2.80 mm in the amount of 95-100% of weight containing more than 14% of water structurally bound in the form of moisture, if needed, is mixed in the dry form with additional substances in the amount of up to 5% of weight in total, and the measured amount of dry material obtained in that way is placed in one of the parts of multipart mold, then the mold is closed and the mixture is subject to the simultaneous operation of temperature and pressure of the scope 1-10 MPa. The mold is heated up to temperature above 120° C., then the mold is closed, and then is depressurized, thus forming a gap between the edges of the mold not wider than 0.5 mm, and then the mold, if needed, is closed again, and the depressurization cycles are repeated. After the last cycle the mold is opened and the number of depressurizations is at least 1, and the entire process of depressurization and closing the mold takes a few seconds and is completed according to the program of the machinery digitally controlling the mold movement depending on the expected parameters of the final product. |
US09517576B2 |
Method and apparatus for bending LED light guides
An article of manufacture includes a jig including a flat surface with a curved groove therein; a light guide located within the curved groove, the light guide including an internal groove; and a bend-aid located in the internal groove of the light guide. |
US09517575B2 |
Natural rubber initial processing machinery and method
An initial processing of natural raw rubber through an initial processing machine, comprising the steps of: (a) providing a coagulated latex which contains water and volatile compositions; (b) dewatering the coagulated latex through a screw-pressing process to remove free water; (c) forming a first pretreated latex material; (d) aging the first pretreated latex material through an aging process to remove water and volatile compositions; and (e) forming a final product of aged latex material. The screw-pressing process makes use of the temperature and pressure increase along the elongated channel structure. The aging process makes use of the further temperature and pressure increase of the rubber materials, together with the screwing effect of the screw-shaft component, the squeezing effect of the nozzle and additional heating at a particular location, which is around the mouthpiece of the nozzle to complete the aging process, which is energy saving, effective and efficient. |
US09517570B2 |
Razor cartridge
A razor cartridge is provided including a blade unit having a first side wall, a second side wall, and a pair of end walls interconnecting the first side wall and the second side wall and one or both of the side walls of the blade unit having at least one connection member. A plurality of blades secured to the blade unit with a clip positioned at each end of the blade unit adjacent to the end walls. A frame is provided having a first interior wall and a second interior wall spaced apart from first interior wall that define an opening extending completely through the frame. One or more of the interior walls of the frame include at least one connection member, the latter engaged with the at least one connection member of the blade unit so that the frame is secured to the blade unit. |
US09517569B2 |
Pocket tool, in particular a pocket knife
The invention relates to a pocket tool with a housing, a compartment region, pins (11a, 11b) and an implement (13) interchangeably mounted on one of the pins (11a, 11b) by means of a coupling mechanism (22) and which can be moved by means of a pivot bearing (18) between an inwardly pivoted transport position and an outwardly pivoted functional position, which is mounted against a spring element and can be moved relative to the pin (11a, 11b) into an uncoupling position and removed from the pocket tool. The coupling mechanism (22) has a guide track guiding the implement (13) in the uncoupling position at an angle with respect to a longitudinal axis (68) of the housing (2) during its uncoupling movement along the compartment region. The housing has oppositely lying side walls, which respectively have convex gripping cams (59) on their top face projecting out beyond the external contour of the implement (13, 14, 5) when moved into the transport position and disposed symmetrically about the longitudinal axis (68) of the housing (2), the geometry of which is dimensioned so that in the uncoupling position, a part-length of the implement (13) lies within the compartment region and is covered by the side walls. |
US09517567B2 |
Grasping apparatus
A grasping apparatus for grasping an object includes at least two grasping portions and at least two pressure sensing mechanisms disposed in the corresponding grasping portions. The pressure sensing mechanism detects a grasping force between the grasping portions while grasping the object. The pressure sensing mechanism includes two parallel metal films and an elastic portion therebetween. The elastic portion deforms to decrease the distance between the metal films for sensing the grasping force. |
US09517566B2 |
Test gripper and test method using the same
A test gripper is provided that decreases an equipment cost and increases a test precision by integrating and simplifying a jig and a test apparatus into the gripper. The test gripper is configured to align and test a component and includes a frame that has a mounting part installed on a robot arm. In addition, a plurality of pins are installed on the frame and are fitted into apertures of the component to align the component and the test gripper. A measuring sensor is also installed on the frame and is configured to test a precision of the component. |
US09517560B2 |
Robot system and calibration method of the robot system
A control apparatus calculates a calibration value based on a position in the robot coordinate system 41 and a position in the vision coordinate system 42, for at least three teaching points set within a calibration area. Markers 21 of two of the three teaching points have the same inclination in relation to an optical axis of a camera 3 as a visual sensor, and the two points are placed on different positions of the same plane normal to the optical axis. The remaining one of the three teaching points other than the two points is set such that the inclination of the marker 21 in relation to the optical axis is different from that of the two points. As a result, influence of a large quantization error in the optical axis direction as a measurement error of the camera 3 can be reduced. |
US09517559B2 |
Robot control system, robot control method and output control method
A robot control system detects a position and a direction of each user by a plurality of range image sensors provided in an exhibition hall. A central controller records an inspection action after a user attends the exhibition hall until the user leaves to generate an inspection action table. When the user attends again, the central controller reads a history of inspection action from the inspection action table. Then, the central controller chooses from an utterance content table an utterance content containing a phrase that mentions the inspection action included in the history at a time of last time attendance, determines the utterance content, and makes a robot output the determined utterance content to the user. |
US09517558B2 |
Time-optimal trajectories for robotic transfer devices
A time-optimal trajectory generation method, for a robotic manipulator having a transport path with at least one path segment, comprising generating a forward time-optimal trajectory of the manipulator along the at least one path segment from a start point of the at least one path segment towards an end point of the at least one path segment, generating a reverse time-optimal trajectory of the manipulator along the at least one path segment from the end point towards the start point of the at least one path segment, and combining the time-optimal forward and reverse trajectories to obtain a complete time-optimal trajectory, where the forward and reverse trajectories of the at least one path segment are blended together with a smoothing bridge joining the time-optimal forward and reverse trajectories in a position-velocity reference frame with substantially no discontinuity between the time-optimal forward and reverse trajectories. |
US09517557B2 |
Manipulator
A manipulator includes an elongated main portion, a distal end portion, and a bendable portion provided between the main portion and the distal end portion; a plurality of linear members that extend from the distal end portion to the main portion via the bendable portion; a power generator; a plurality of power transmitters that transmit, to proximal ends of the linear members, the power generated by the power generator as linear motion in a longitudinal direction of the main portion; and a linear-member relaxing unit that relaxes the linear members in which tension is generated between the distal end portion and the power transmitters by pushing and pulling of the linear members by the linear motion transmitted from the power transmitters. |
US09517550B2 |
Dual-head tool system with safety lock
A dual-head tool has a handle with a longitudinal bore extending longitudinally its entire length. A shaft is housed within the bore and may be slid longitudinally to expose either of its two tool heads, but not both simultaneously. A lock arm is pushed down so that it is flush with the shaft and handle and a cam on the lock arm engages a recess in the shaft so that the shaft is firmly held extending out of one side of the handle to allow use of one of the tool heads. The head of the lock arm covers the open end of the bore not in use. A piston biased by a spring engages a keyway in the shaft to prevent the shaft from being removed from the bore. |
US09517548B2 |
Device and method for holding a tool bit
A device and method for holding a bit for a tool. The holding device, which is secured to a support surface, includes a housing having a base, a first leg and a second leg. A slot is defined between the first and second legs and the shank of the bit is received through one of a plurality of differently dimensioned apertures defined along the slot between the first and second legs. An adjustment assembly is engaged with the first and second legs and is movable to a first position to clamp the shank in the selected aperture; and is movable to a second position to release the shank. When the adjustment assembly is moved from the second position to the first position, a free end of the second leg bends toward the first leg, thereby reducing the diameter of the aperture within which the shank is received. |
US09517546B2 |
Abrasive articles including abrasive particulate materials, coated abrasives using the abrasive particulate materials and methods of forming
An abrasive particulate material which is made of alumina crystals and a primary additive composition impregnated within the abrasive particulate material, the primary additive composition including a combination of Mg and Ca, wherein Mg and Ca are present in an additive ratio [Mg:Ca] within a range between about 1:1 and about 10:1, and a Ca amount is at least about 0.2 wt % Ca for the total weight of the abrasive particulate material. |
US09517543B2 |
Blade sharpening system and method of using the same
The present document describes a blade sharpening system comprising a blade sharpening device, a blade holding apparatus and a controller operatively coupled to the blade sharpening device and said blade holding apparatus to control sharpening of said blade, and methods of using the same. |
US09517538B2 |
Motor-powered machine tool, in particular a hand-held machine tool
A motor-powered machine tool includes a drum-like tool-changing magazine having tool chambers. The magazine is arranged inside a housing, and when the tool is in a change position, one of the tool chambers of the tool-changing magazine is aligned with a tubular tool holder. The tool further includes a sliding element configured to slide a tool from the tool-changing magazine into the tool holder and from the tool holder back into the tool-changing magazine. The sliding element is movable in a longitudinal direction of the tool holder. In at least one embodiment, the sliding element is coupled with a gearbox system which includes at least one toothed gear. The rotational motion of the toothed gear is translated into linear movement of the sliding element. |
US09517536B2 |
Device and method for repairing a damaged zone of an intermediate layer of a multilayer structure by way of deformable corrugated rings
A device for repairing a damaged zone in a first cavity, with a first diameter, of an intermediate layer interposed between two layers that have a second cavity with a second diameter smaller than the first diameter. The device includes a stop that forms an abutment at the interface between the first cavity and one of the second cavities, a ring having a deformable corrugated shape, an initial inside diameter, an initial outside diameter smaller than the second diameter, and being positioned in the first cavity, a deformation element having an elastically variable outside diameter initially smaller than the initial inside diameter of the ring, and a tool being able to increase the outside diameter of the deformation element so that it deforms the ring in the first cavity in order to reduce the difference between the first and second diameters. |
US09517530B2 |
Wafer producing method
A hexagonal single crystal wafer is produced from a hexagonal single crystal ingot. A separation start point is formed by setting a focal point of a laser beam inside the ingot at a predetermined depth from the upper surface of the ingot, which depth corresponds to the thickness of the wafer to be produced, and next applying the laser beam to the upper surface of the ingot while relatively moving the focal point and the ingot to thereby form a modified layer parallel to the upper surface of the ingot and form cracks extending from the modified layer along a c-plane, thus forming a separation start point. The focal point is indexed by relatively moving the focal point in the direction where an off angle is formed and the c-plane is inclined downward. |
US09517523B2 |
System and method of reducing diffusible hydrogen in weld metal
This disclosure relates generally to arc welding. In an embodiment, a welding system has a welding gas supply system configured to supply a gas flow including a shielding gas and a fluorine-containing gas to a weld pool. Furthermore, the shielding gas is configured to control an atmosphere surrounding the weld pool, the fluorine-containing gas is configured to reduce diffusible hydrogen in the weld pool, and the fluorine-containing gas is substantially free of sulfur. |
US09517520B2 |
Apparatus of mounting and removing component, method of mounting component and method of removing component
An apparatus for mounting and removing a component includes: a light source configured to radiate light toward a component supported by solder; a light sensor configured to sense displacement of the component; and a member mounted on the component, the member including a hole in a portion to be irradiated with the light of the light source. |
US09517518B2 |
Method of manufacturing the thread of a nut in a screw and nut system
A method of manufacturing a nut in a screw and nut system comprises a first material removal stage to form an internal thread of which the value of the nominal diameter is lower than a predetermined final nominal diameter value and a second plastic deformation stage of the thread formed during the first stage to obtain the predetermined final value by material displacement. |
US09517503B2 |
Process cycle including laser assisted casting and related system
Various embodiments include methods and related systems for laser-assisted casting. Some embodiments include a method including: performing laser ablation on a preliminary wax casting model to form a modified wax model including at least one additional feature absent from the preliminary wax casting model; coating the modified wax model to form a mold shape around the modified wax model; removing the modified wax model to leave a casting mold including the at least one additional feature; forming a shape from a casting material using the casting mold having the at least one additional feature; and scanning the modified wax model to image the at least one additional feature after the performing of the laser ablation. |
US09517501B2 |
Sheet forming tool and a method for the manufacture of a corrugated sheet
A sheet forming tool (1) for the manufacture of a corrugated sheet has a lower tool element (40) and an upper tool element (50), each of the upper tool element and the lower tool element having a front side (23, 33, 41) and a rear side (25, 35, 42). The lower tool element (40) comprises a first base element (2, 4, 6, 8) and a first finger element (3, 5, 7, 9) projecting from said first base element (2, 4, 6, 8). The first finger element (3, 5, 7, 9) forms a first ridge (22, 24, 26, 28) for forming a corrugation peak in the sheet. The upper tool element (50) comprises a second base element (12, 14) and a second finger element (13, 15) projecting from said second base element (12, 14), the second finger element (13, 15) forming a second ridge (32, 34) for forming a corrugation trough in said sheet. The first ridge (22, 24, 26, 28) is arranged opposite to the second ridge (32, 34) and the first ridge (22, 24, 26, 28) is offset from the second ridge (32, 34) so as to allow for an engagement of the first finger element (3, 5, 7, 9) and the second finger element (13, 15) in an engaged position. Each of the first ridge (22, 24, 26, 28) and second ridge (32, 34) comprises a main portion (20) and an end portion (11, 21) and the angle ? (36) between each of the first ridge (22, 24, 26, 28) and second ridge (32, 34) in the main portion (20) and the corresponding front side (23, 33, 41) is at least partly different from the angle between each of the first ridge (22, 24, 26, 28) and second ridge (32, 34) in the end portion (11, 21) and the corresponding front side and a space is provided between the first finger element (3, 5, 7, 9) and the neighboring second finger element (13, 15) in the engaged position. |
US09517498B2 |
Aluminum impact extruded bottle with threaded neck made from recycled aluminum and enhanced alloys
The present invention relates generally to forming a threaded neck in a metal bottle manufactured by a process known as impact extrusion. More specifically, the present invention relates to methods, apparatus and alloy compositions used in the impact extrusion manufacturing of containers and other articles with sufficient strength characteristics to allow threading the container necks to receive a threaded closure on the threaded neck. |
US09517496B2 |
Fire-tube boiler cleaner
A tube cleaning machine in which cleaning interior tube surfaces occurs by a forward non-cleaning pass of cleaning implement through work tube followed by reverse cleaning pass where implement engages and cleans interior surface. Cleaning implement has first position for forward pass producing minimum engagement of interior fire-tube surface, and a second position for reverse pass of full cleaning engagement with interior fire-tube surface. A distance indicator enables operator to select distance of forward pass of cleaning implement to correspond with tube length. |
US09517495B1 |
Automated system for flushing one or more motors
An automated flushing system includes a base having a flow inlet, flow outlets and a flow manifold, the system also including solenoid valves and a pressure switch mounted upon the manifold. The flow manifold includes a main flow channel connected to the flow inlet, and auxiliary flow channels interconnecting the main flow channel with respective ones of the flow outlets so as to provide flow communication in parallel to the flow outlets from the main flow channel. Each solenoid valve extends into a respective auxiliary flow channel and is actuatable between an activated status and a deactivated status to allow and block flow communication of liquid through the respective auxiliary flow channels to a flow outlet. The pressure switch in flow communication with the flow inlet is configured to sense that the pressure of liquid entering the flow inlet is above a preset minimum before initiation of automated flushing system operation. |
US09517489B2 |
Outer periphery coating method of honeycomb structure
An outer periphery coating method of honeycomb structure has coating steps where the honeycomb structure including a ring-like bulge portion is rotated; a coating member is brought into contact with a side surface of the honeycomb structure by pressing a side edge portion of a spatula via a rubber sheet, the coating member including the plate-like spatula in which a specific cut portion is formed in the one side edge portion and the side edge portion provided with the cut portion is an inclined surface inclined on a coating surface side, and the rubber sheet in which a cut is formed so that an end surface of the end portion is parallel to a back surface of the spatula when the end portion is bent along the side edge portion of the spatula; and a slurry coating material is supplied to the side surface of the honeycomb structure. |
US09517488B2 |
Component delivery system utilizing film bags
A dispensing apparatus includes two cylindrical sleeves, two shuttles slidingly disposed in the sleeves, push rods disposed in operable communication with the shuttles, and a piston, driven by pressurized gas, disposed in operable communication with the push rods. The cylindrical sleeves receive film pack bags having a common face plate that has an integrally formed discharge nosepiece having an internal partition that maintains separate flow streams from the film pack bags. A holder is disposed proximate a front end of the sleeves and configured to restrain the face plate during dispensing. A mixer is disposed in fluid communication with the film pack bags. A material applicator is disposed in fluid communication with the mixer. A first flexible tube is disposed upstream of and in fluid communication with the mixer. A second flexible tube is disposed in fluid communication with the material applicator for supplying atomization air to the material applicator. |
US09517485B1 |
Lawn-mower-mounted sprayers, assemblies, components, and methods
To make it easier for millions of Americans to weed their lawns, the present inventor devised, among other things, a way to carrying a lawn care sprayer on a push mower and thus relieve the burden of carrying the sprayer and eliminates the expense of purchasing a riding mower and tow-behind sprayer. One exemplary embodiment includes a holster structure and a spray tank, with the holster structure attaching to the push rails of a push mower and the spray tank mounting removably to the holster structure. This arrangement provides easy and convenient access to the sprayer function as a user mows his or her lawn, eliminating the need to make kill weeds and mow as separate tasks. Moreover, some embodiments provide a dual chamber tank, which provides further efficiency by allowing users to choose between weed killers, or other lawn or garden treatments while mowing. |
US09517480B2 |
Bottle for forming and safely housing elemental iodine and dispensing attachments
A bottle for the creation, storage, administration and dispensing of elemental iodine is disclosed. An amount of crystal iodine is safely housed at the bottom of the bottle. Water is poured into the bottle and contacts with the crystal iodine to form elemental iodine. With the crystal iodine safely secured at the bottom of the housing, the formed elemental iodine maintains contact with the crystal iodine to maintain its stability and extends is shelf life. Several dispensing device are also disclosed for dispensing or administering the elemental iodine, as needed, in order to treat internal and external areas of a human's or animal's body. |
US09517479B2 |
Portable airless sprayer
An airless spray tip comprises a body, a barrel and a needle. The body has an axial fluid passage, and a tip bore extending transversely through the axial fluid passage. The barrel extends into the tip bore and includes a tip passage fluidly connected to the axial fluid passage. The needle is disposed in the axial fluid passage to engage the tip passage. An airless spray tip comprises a barrel, a fluid passage, a spray orifice and a tip seat. The barrel extends in an axial direction. The fluid passage extends through the barrel transverse to the axial direction. The spray orifice is disposed in the fluid passage. The tip seat is disposed in the fluid passage. |
US09517478B2 |
Spray applicator
A spray assembly for dispensing a mixture is provided. The spray assembly includes a connector configured for operable engagement with a first and second source of component and a source of pressurized fluid, and a tip operably connected to the connector. The tip includes an opening and defines a mixing chamber between the connector and the opening of the tip, and an insert member configured to be received in the mixing chamber. The insert member includes a plurality of radially extending slots on at least one end of the insert. The plurality of radially extending slots is configured to mix the first and second components prior to the mixture exiting the opening in the tip. |
US09517476B2 |
Centrifuge with acceleration and deceleration time display
According to an aspect of the present invention, there is provided a centrifuge including: a driving unit which rotates a rotor on which a sample is held; an input/output unit which displays information thereon and receives an input from a user therethrough; and a control unit which controls a rotation speed of the rotor to an input set rotation speed; wherein, when the rotor is rotating, the input/output unit displays first time information corresponding to a time when the rotor has been accelerated to the set rotation speed. |
US09517474B2 |
Devices and methods for separating particles
Embodiments of the present disclosure provide for devices, methods for separating particles, and the like. In general, embodiments of the present disclosure include non-uniform magnetic field-assisted processes and devices for the separation of particles (e.g., cells) within a magnetic fluid. Under non-uniform magnetic fields, particles such as cells can experience the generated magnetic field direction to produce a magnetic buoyancy force, analogous to buoyancy force, as magnitude of the force is proportional to the volume of cell. This force can be used to spatially separate cells of different sizes. In some embodiments, devices for separating particles are provided having a magnetic device configured to direct a non-uniform magnetic force onto the magnetic fluid and the particles; and a plurality of outlets, wherein the non-uniform magnetic force causes the types of particles to be separated and flow into different outlets. |
US09517472B2 |
Device and method for processing target component in tube
The present invention provides a small and low running-cost device capable of minimizing the generation of contamination sources as much as possible while performing a series of all the desired manipulations. A device for manipulating a target component in a manipulation tube, comprising: a manipulation tube comprising a tube having an optionally-closeable open end for supplying a sample containing a target component at one end and a closed end at the other end, and a manipulation medium accommodated in the tube and having a gel layer and an aqueous liquid layer multilayered in a longitudinal direction of the tube; magnetic particles that should transport the target component; and magnetic field applying means capable of applying a magnetic field to the manipulation tube to move the magnetic particles in the longitudinal direction of the tube. |
US09517471B1 |
High reactivity lime hydrate and methods of manufacturing and uses thereof
A sorbent composition with improved acid gas reactivity comprising calcium hydroxide particles is provided. In the calcium hydroxide composition, about 90% percent of the calcium hydroxide particles are less than or equal to about 10 microns; the ratio of 90% of the calcium hydroxide particles below a specified size to the ratio of 10% of the calcium hydroxide particles above a specified size is less than about 8; and the calcium hydroxide particles have a BET surface area of about 18 m2/g or greater. |
US09517470B2 |
Agitator ball mill having wear prevention
The invention relates to an agitator ball mill having a vertically arranged container, in which there an agitator that can be rotated about a vertical axis is arranged, and having at least one wear prevention element that can be fitted to the container inner wall with the aid of a fixing system, wherein the fixing system comprises a fixing pin and a fixing cut-out, which are arranged on the container inner wall and/or the rear side of the wear prevention element in such a way that the wear prevention element can be fixed to the container inner wall by means of a movement of the wear prevention element in a direction which forms an angle α>0° with the vertical axis of the rotatable agitator, in that the fixing pin is guided into the fixing cut-out. |
US09517466B2 |
Measuring cassette and measuring device for the detection of target molecules in a liquid sample by measurement of fluorescence emission after excitation in an evanescent field
An interchangeable disposable measuring cassette for insertion into a measuring apparatus for detecting target molecules in a liquid sample by measuring fluorescence emission has a flow measurement cell in which an excitation radiation provided by the measuring apparatus produces an evanescent field in the liquid sample beyond a boundary layer for the liquid sample and the measurement cell. To be better able to ensure that no sample liquid can cross from the measurement cell into the measuring apparatus, the measuring cassette includes a body including an optically transparent material and a base in contact with the underside of the body. The measurement cell is formed by a cutout provided in the body, the base, or both. The areas on which the body and the base are on top of one another around this cutout are connected to one another directly and in fluid-tight fashion by laser welding. |
US09517465B2 |
Lateral cavity acoustic transducer based microfluidic switch
A microfluidic switching device that includes an upstream microfluidic channel configured to contain a liquid having particles therein and a plurality of outlet channels coupled to the upstream microfluidic channel at a junction. A dead-end side channel or LCAT is oriented generally perpendicular to the upstream microfluidic channel and coupled to the upstream microfluidic channel at the junction, the dead-end side channel having a gas contained therein. The device includes a transducer configured to apply an external source of acoustic energy. Actuation of the transducer effectuates symmetrical oscillation of a gas/liquid boundary at the junction. Preferably, the junction comprises a bifurcation with two outlets. Further, the LCAT has a leading edge and a trailing edge and wherein the trailing edge of the LCAT is substantially aligned with the bifurcation. |
US09517464B2 |
Dispensed liquid measurement device
A measurement device containing one or more capillaries to measure the volume of a dispensed fluid and determine the volumetric accuracy of the dispensing device. The measurement device can contain a reservoir containing the fluid to be measured and there may be an additional reservoir for a secondary fluid. A viewing window is necessary to complete a manual measurement and may include a magnifying lens. The liquid well by the capillary inlet may be shaped such that the measurement fluid is directed toward the capillary. The well may have features designed to position the dispensing device toward the capillary, or to position the well proximal to the capillary after it is filled. The well may also have surfaces or coatings which attract or do not attract various types of substances. The measurement device may interface with sensors to output measurement data. |
US09517456B2 |
Catalyzed SCR filter and emission treatment system
Provided is a catalyst article for simultaneously remediating the nitrogen oxides (NOx), particulate matter, and gaseous hydrocarbons present in diesel engine exhaust streams. The catalyst article has a soot filter coated with a material effective in the Selective Catalytic Reduction (SCR) of NOx by a reductant, e.g., ammonia. |
US09517455B2 |
Catalyzed SCR filter and emission treatment system
Provided is a catalyst article for simultaneously remediating the nitrogen oxides (NOx), particulate matter, and gaseous hydrocarbons present in diesel engine exhaust streams. The catalyst article has a soot filter coated with a material effective in the Selective Catalytic Reduction (SCR) of NOx by a reductant, e.g., ammonia. |
US09517453B2 |
Methods for enhancing the mesoporosity of zeolite-containing materials
Methods for enhancing the mesoporosity of a zeolite-containing material. Such methods may comprise contacting a composite shaped article containing at least one zeolite and at least one non-zeolitic material with at least one pH controlling agent and at least one surfactant. Such methods may be performed under conditions sufficient to increase the pore volume of at least one 10 angstrom subset of mesoporosity. |
US09517451B2 |
Preparation of propane oxidation catalysts
A process for preparing a propane oxidation catalyst, the process comprising pre-calcining the catalyst precursor in an oxygen-containing gas at a temperature of less than 330° C. until the weight of the precursor stabilizes to obtain a pre-calcined precursor; then calcining the pre-calcined precursor to obtain the catalyst. |
US09517450B2 |
Hollow metal nano particles supported on carrier
The present specification relates to hollow metal nano particles supported on a carrier. |
US09517447B1 |
Processes for removing contaminants from a dehydrogenation effluent
A process for the providing a regenerant gas stream for a regenerable adsorbent used to remove water and hydrogen sulfide from a reactor effluent in a catalytic dehydrogenation process is described. The reactor effluent is compressed in a compressor to provide a compressed effluent. The compressed effluent may be treated to remove chlorides, and then passed to a dryer zone having a regenerable adsorbent. A regenerant gas stream is used to desorb the water and hydrogen sulfide and the spent regenerant stream may be passed to a cleaning zone having a sorbent configured to remove hydrogen sulfide from the spent regenerant stream. The cleaned regenerant gas stream may be recycled to the dryer zone to desorb and/or regenerate the regenerable adsorbent. |
US09517434B2 |
Catalyst system for exhaust gas purification utilizing base metals, and controlling method therefor
A catalyst system for exhaust gas purification which comprises a first-stage base metal catalyst located upstream and a second-stage base metal catalyst located downstream, wherein the first-stage base metal catalyst comprises at least one oxide support selected from the group consisting of alumina, ceria, zirconia, yttria, and titania and Cu metal and/or a Cu oxide supported thereon, and in cases where the amount of NOx in the exhaust gas has become or exceeded an NOx criterion, the state of the exhaust gas is switched from slightly rich to rich. |
US09517432B1 |
Dehumidifier
A dehumidifier is revealed. A moisture-absorbing package comprises a pouch made of a fabric material having good breathability and hygroscopic substances filled in the pouch. A humidity-indicating unit made of a humidity sensing agent is mounted on an outer surface of the pouch, whereby upon saturation of water vapor as absorbed by the hygroscopic substances in the pouch, the humidity-indicating unit changes the color for indicating the timing of regenerating the hygroscopic substances. When the moisture-absorbing package is saturated with moisture, it is put in a box, and the box is put at an air outlet of a blowing device. The air blown from a blower of the blowing device is heated by an electric heating element and blown to the box for drying the moisture-absorbing package in the box to regenerate it. Then, the moisture-absorbing package removed from the box is put in different space to absorb moisture independently. |
US09517423B1 |
Toy construction set
A toy construction set comprises a base block and one or more rotating blocks configured for coupling to the base block, to other rotating blocks, or to both. The base block may be define by an upper surface, a lower surface, and at least one side surface. The base block may comprise a body and a plurality of projections extending outward from the body. Interior cylindrical surfaces may extend between the upper surface and the lower surface of the base block. An upper chamfer may connect the interior cylindrical surface with the upper surface, and a lower chamfer may connect the interior cylindrical surface with the lower surface. The rotating blocks may comprise a hub having a body and a grip extending upward from the upper end of the body. Optionally, the hub may also have a coupling mechanism extending downward from the lower end of the body. Structural elements may emanate from the body of the hub. In various embodiments, the structural elements may comprise a spur gear body, a picture holder support body, a fold-up toy support body, a drive wheel support body, or a driven wheel support body. |
US09517418B2 |
Conversation detection in a virtual world
Embodiments of the present invention address deficiencies of the art in respect to virtual world management and provide a method, data processing system and computer program product for conversation detection in a virtual world. In an embodiment of the invention, a method for conversation management in a virtual world data processing system can include detecting a sequence of statements from at least two avatars in a virtual world, and locating the avatars in the virtual world, computing a temporal proximity of the statements. The statements can be grouped in the virtual world if the avatars are geographically proximate to one another in the virtual world and if the statements have occurred within a threshold temporal proximity of one another. Thereafter, the grouped statements can be persisted in the virtual world as a conversation. |
US09517415B2 |
Method and system for generating augmented reality with a display of a motor vehicle
A method and system for generating augmented reality with a display of a vehicle is provided. The method comprises recording an image of an environment of the vehicle in the form of image data, determining a virtual space in three dimensions from the image data, and detecting a real object in the image data. The method further comprises determining a first coordinate range of the real object in the three dimensional virtual space, adding a virtual element to the three dimensional virtual space, and controlling the virtual element in the three dimensional virtual space based on a user input. The method further comprises outputting the environment and the controlled virtual element in combined form in an output image, modifying the output image when the first coordinate range of the real object and a second coordinate range of the controlled virtual element form an intersection area, and displaying the output image. |
US09517411B2 |
Transparent user interface game control processing method, apparatus, and medium
A user interface processing apparatus is provided. A user interface element such as a virtual controller is displayed on a display screen. When an operation to the displayed user interface element is received from a player, the application is controlled in accordance with the received operation. A learning level of the player is determined in accordance with a control state of the application, such as utilization time of the application and the number of executions of a predetermined function in the application. The transparency is increased in accordance with the determined learning level. In a case where it is detected that an operation state of the user interface element continues for a certain period of time, transparency of the user interface element to increase is determined. The user interface element is displayed with the determined transparency. |
US09517405B1 |
Facilitating content access across online games
A system and method for facilitating cross-game content access are disclosed. A set of content may be gated by a non-player character in a first online game. Access to the set of content may be granted in the first online game upon user defeating the non-player character or a character corresponding to the non-player character in a second online game. A notification may be generated in the first online game when a user encounters the non-player character in the first online game. The notification may include information indicating that the non-player character may be defeated in the second online game. In some examples, the non-player character in the first online game may share the same entity state with the corresponding character in the second online game such that they may appear as if there were the same character in the first and second online games. |
US09517404B2 |
Apparatus, system, and method for effectuating modifications to a virtual space responsive to token detection
Exemplary implementations may facilitate modifications to characters and/or virtual items within a virtual space, or to the virtual space itself, made responsive to detection of a token. In some implementations, a physical accessory may depict a character in the virtual space. By way of non-limiting example, the physical accessory may include a toy figurine resembling the character. A detectable token (i.e., a physical object) may be removably attached to the physical accessory. According to some implementations, responsive to the physical accessory being detected along with the removably attached token, a modification within the virtual space may be made to the character and/or a virtual item associated with the character. In some implementations, detection of the token alone may effectuate such a modification. |
US09517398B2 |
Extra-long air-water sandbag
An extra-long air-water sandbag includes an inner bladder and an external bag. The external bag is a bag to hold the inner bladder and covers the external of the inner bladder. The inner bladder further includes an inner and outer layer container set which includes a gas container and a liquid container, and an extension layer gas container which is a bladder for containing gas and housed at the top, bottom or top and bottom thereof to increase the total length of space of gas container of the punching bag. As the length of gas container is increased, combat training for the feet is hence achieved. |
US09517395B1 |
Putting target
An embodiment of a putting target (10) whereby a golf ball is caught utilizing a hydrogel section (16) that is affixed to a section of magnetic sheeting (12). The hydrogel section (16) provides an adhesive catch area so that a golf ball can be effectively caught with its surface. Alternate embodiments of a hydrogel section (16) affixed to magnetic sheeting (12) can be useful in various fields for activities or procedures that require the temporary adherence of a tool, device, decoration, etc., to a magnetic surface. |
US09517394B1 |
Putter-type golf club head with dampening screw
A putter-type golf club head with a dampening screw is disclosed herein. The club head comprises a body and a face insert engaged by the dampening screw. The dampening screw is threadingly positioned within an aperture of an aft wall, and has a tip section and a threaded section. The sound of the putter striking a golf ball is dampened when the top section of the dampening screw engages the interior surface of the face insert. |
US09517390B1 |
Hockey puck locker
A practice hockey puck locker which is mounted on an upstanding wall member. The locker includes a first upstanding first rectangular tube, having open upper and lower ends, a second tubular member, having upper and lower ends, extending downwardly from the lower end of the first tubular member and a third tubular member, having upper and lower ends, extending downwardly from the lower end of the third tubular member. A puck dispenser housing is secured to the lower end of the third tubular member. A key operated dead bolt is positioned on the dispenser housing which is selectively movable between locked and unlocked positions. When the dead bolt is in the locked position, the pucks cannot be dispensed from the dispenser housing. When the dead bolt is in the unlocked position, the pucks may fall from the lower end of the discharge dispenser. |
US09517388B2 |
Energy storing device and method of using the same
A ball includes a shell defining a spheroid. The shell includes an opening and a panel to close the opening. The panel has a sleeve that extends radially inward. A generation module is disposed in a cavity defined by the shell. The generation module includes a housing. A pendulum, an electric generator, and a battery are disposed in the housing. The pendulum is mechanically coupled to a rotor of the electric generator at a first axis of rotation of the pendulum and the electric generator is electrically coupled to the battery. An acceleration of the ball causes the pendulum to rotate about the first axis of rotation. The rotation of the pendulum rotates the rotor of the electric generator. The rotation of the rotor of the electric generator generates electricity, and at least a portion of the generated electricity is stored by the battery. |
US09517383B2 |
Method of displaying multimedia exercise content based on exercise amount and multimedia apparatus applying the same
A display method and a multimedia apparatus applying the same are provided. The display method includes acquiring exercise information of a user, transmitting the exercise information to a server, receiving from the server a transport stream including video data in which a screen is changed at a rate corresponding to the exercise information, and displaying the video data by processing the transport stream. Therefore, the multimedia apparatus provides active multimedia exercise content to the user using exercise information and physical information of the user. |
US09517379B2 |
Exercise machine with unstable user support
An unstable user support device designed for mounting on an exercise machine has a base or mounting bracket and an unstable user support platform configured for engagement by user and pivotally mounted on the base for pivotal movement through a limited angular range about a non-vertical pivot axis. The pivoting movement may be a side to side tilting movement. Stops between the base and the unstable user support platform control the amount of pivoting movement. This arrangement provides a degree of instability to the unstable user support platform, to provide a greater challenge to the user's core muscles in balancing the unstable user support platform while performing an exercise motion. |
US09517377B2 |
Exercise bar
An exercise bar having a cross sectional shape in the form of an octagon, and composed of a longitudinal body with stabilizer ends attached to the ends thereof. The longitudinal body has a central axis constant through its length, and can be manufactured with materials such as hard woods, plastic, certain metals, sponge rubber, or any resilient material which resists bending or deflection when used in specific exercises. The material can be selected to be lightweight to ensure persons of any strength level can use the exercise bar. The stabilizer ends are secured to the ends of the longitudinal body, and can be any type of rubber material or material that grips a smooth surface, such as laminated wood flooring, to prevent slippage of the longitudinal body. |
US09517376B2 |
Portable and attachable bicycle trainer
The invention encompasses a removable attachment for installing on a bicycle with the goal of altering the resistance to either front tire or back tire revolution. In this way, the bicycle includes enhanced physical training capabilities allowing the rider to use a bicycle on a standard trainer frame or as a regular bicycle for riding in the usual manner. In one embodiment, the attachment includes a resistance support connected to a bicycle and supporting a resistance device that engages a bicycle wheel or bicycle tire for altering the resistance to tire revolution. In this exemplary embodiment, the apparatus includes a resistance support attached to the bicycle proximate a bicycle tire along with a resistance device removably attached to the resistance support. In one embodiment, the resistance device defines a slot, and the resistance support projects through the slot to position the resistance device against the bicycle wheel or the bicycle tire. |
US09517375B2 |
Exercise machine support system
An exercise machine support system for providing increased versatility including inclination or declination of an exercise surface, a reduction in the overall length and width of the exercise machine, and an enhanced user interface which reduces the risk of injury. The exercise machine support system generally includes a cantilevered exercise machine which is adapted to have a variable angle of incline or decline with respect to a horizontal ground surface. The exercise machine will generally include a base and a support which extends between the base and the exercise machine. The upper end of the support is connected to the exercise machine by a first pivot such that the exercise machine pivots about the support. An adjustment device may be utilized to pivot the exercise machine and thus adjust its angle of incline. Various types of adjustment devices are disclosed, including an actuator, ratchet-and-pawl, gears, and cam. |
US09517374B2 |
Air straps
A fitness device for fully suspending a user in air includes at least four holds, at least four strap segments, and at least one attachment member. Each hold is configured to allow a user to interface with a hand or a foot. The four holds are configured to allow a single user to concurrently interface the four holds with a separate hand or foot. At least one strap segment is adjustable in length between the corresponding hold and a suspension point. The strap segments are configured to move independently of each other strap segment. The at least one attachment member is configured to attach to a corresponding mounting support structure to enable a user to fully suspend the user's body from a ground surface by contact with the holds. |
US09517369B2 |
Fire stop conduit
Methods and/or apparatuses having a conduit with at least one length of conductive metal wire therein along with a length of non-conductive wire therein. The length of non-conductive wire includes a heat-expandable firestop insulator material. Upon reaching a pre-defined temperature corresponding to that of a fire, the non-conductive wire expands to fill a length of the conduit. Alternatively, the firestop insulator material may be disposed in the void within the conduit that exists outside of the conductors. The expansion of the material prevents the spread of fire along the length of the conduit. |
US09517365B2 |
Portable oxygen system
A container for storing oxygen under pressure is disclosed that includes a chamber adapted to be worn around a user's waist and adapted for supplying oxygen to the user; the chamber defining a volume to contain oxygen under pressure; wherein the chamber is defined by a central portion extending between opposite side portions; wherein each of the opposite side portions has a height greater than a maximum height of the central portion that further defines a void between the side portions and above the central portion; and wherein the chamber is further defined by an exterior surface of the chamber adjacent the user. |
US09517362B1 |
Assisted rescue and personal evacuation system
An assisted-rescue and personal evacuation system preferably includes a deployment bag, an equipment tether, a stop tether, a flexible anchor strap, a descender system, at least two carabiners and a rescue hitch system. The deployment bag includes a bag portion, an end flap, a rope protector and a pair of snap hooks. The equipment tether includes a tether strap and a tether loop. The tether loop is used to retain all of the rescue components. The stop tether preferably includes a stop body, a first stop carabiner and a second stop carabiner. The descender system preferably includes a rescue rope, a descender unit, a rope carabiner and a descender carabiner. The rescue rope is inserted through the descender unit. The rescue hitch system includes a hitch strap, a micro rope grab and a hitch carabiner. A micro haul device provides a 6:1 mechanical advantage for self or assisted rescue. |
US09517357B2 |
Plasmonic nanoparticle-doped silk materials
Provided herein are silk fibroin-based photothermal elements and uses thereof. The silk fibroin-based photothermal elements comprise a plurality of plasmonic nanoparticle distributed in a silk fibroin matrix, and can generate heat when the plasmonic nanoparticles are exposed to electromagnetic radiation. The silk fibroin-based photothermal elements can be adapted to be conformable and biodegradable, and can further be integrated with various electronic components, such as a thermo-electric device for conversion of heat into electricity. The invention is useful for various in vivo applications, such as photothermal therapy, controlled drug-delivery devices or wireless powering of implanted micro-devices. |
US09517355B2 |
Near-infrared enhancement of circadian and ultradian spatiotemporal cellular coordination
A method is disclosed of providing photo-chrono-therapy to a wound site in a human or animal subject, the method including: determining or receiving subject circadian and/or ultradian cycle information indicative of a biological rhythm(s) of the subject; and based on the subject cycle information, delivering a photo-chrono-dose of infrared treatment light to the wound site with wavelengths within at least one infrared wavelength range and having a dosimetry configured to promote healing at the wound site. |
US09517354B2 |
Pocket kits and methods for retrofitting and adapting common notebook computers, laptop computers, and tablet computers, to enable each to be used as an automated external defibrillator (AED), and as a manual defibrillator
A notebook, laptop computer or tablet computer having an automated external defibrillator (AED) capability, and methods of utilizing the notebook, laptop computer or tablet computer defibrillator to treat victims of sudden cardiac arrest. Kits and methods for converting, adapting or retrofitting a common notebook, laptop computer and tablet computer to enable each to be used as an AED to treat victims of sudden cardiac arrest. A kit including an adjustable case for receiving, encompassing, adapting and converting a common notebook, laptop computer or tablet computer to enable each to be used as an AED. A kit including a slave automated external defibrillator (AED) that is joined to a common notebook, laptop computer or tablet computer to adapt, convert and enable each to be used as an AED. |
US09517345B2 |
Neuroprosthetic stimulation
The present disclosure relates to a method for determining stimulation parameters for a neuroprosthetic device performed by a processor of the device. Based on (i) a desired spatial pattern of neural activity, the processor determines stimulation parameters for an array of electrodes of the neuroprosthetic device. The processor determines the stimulation parameters such that a difference between (i) the desired spatial pattern of neural activity and (ii) an estimated spatial pattern of neural activity is optimised. The estimated spatial pattern of neural activity is an estimate of a response of a target neural tissue to being stimulated by the neuroprosthetic device based on the stimulation parameters. This method allows higher resolution stimulation and allows electrode arrays with higher electrode density to be usefully employed. |
US09517344B1 |
Systems and methods for selecting low-power, effective signal delivery parameters for an implanted pulse generator
Systems and methods for selecting low-power, effective signal delivery parameters for an implanted pulse generator are disclosed. A representative system includes a signal generator and a computer-readable medium that, for first and second signals, increases and decreases an amplitude of the signal over multiple steps from a baseline amplitude at which the patient has a baseline response. At individual step increases and decreases, the system receives a pain score based on the patient's response. The instructions compare the pain scores for the two signals and determine one of the signals for additional therapy to the patient, based on the pain scores and an expected energy consumption of the signals. |
US09517341B2 |
Lead electrode for use in an MRI-safe implantable medical device
A medical lead is configured to be implanted into a patient's body and comprises a lead body, and an electrode coupled to the lead body. The electrode comprises a first section configured to contact the patient's body, and a second section capacitively coupled to the first section and configured to be electrically coupled to the patient's body. |
US09517337B2 |
Intracardiac capsule implantable on a thin wall, including the septum wall
An intracardiac capsule comprises a cylindrical body having an atraumatic rounded surface and a helical anchoring screw integral with the cylindrical body. The helical anchoring screw is able to penetrate tissue of a wall of the heart and is configured to provide temporary attachment, in rotation and in translation, of the capsule to an implantation site. The helical anchoring screw surrounds at least a portion of the length of the cylindrical body forming a contact region intended to come into contact with the wall of the cavity of the heart. Over the length of the contact region, the external diameter of the cylindrical body is less than the inner diameter of the helical anchoring screw, so as to leave a free gap there between. The helical anchoring screw is secured to the cylindrical body near the proximal end of the contact region, and extends freely to the opposite distal end. |
US09517326B2 |
Link systems and articulation mechanisms for remote manipulation of surgical or diagnostic tools
An articulating mechanism for remote manipulation of a surgical or diagnostic tool comprises an elongate shaft having a longitudinal axis and a plurality of axially aligned links located at the distal end of the shaft. The articulating mechanism also includes an actuating element connected to and configured to cause movement of the axially aligned links and a locking mechanism located proximal of the axially aligned links. The locking mechanism including a collar mechanism through which the actuating element extends and a locking member movable between first and second positions. The collar mechanism frictionally impedes motion of the actuating element when the locking member is in the first position and the collar mechanism allows translation of the actuating element when the locking member is in the second position. |
US09517324B2 |
Extendable intravenous catheter
An intravenous catheter has a tip portion, an extendable portion and a proximal portion attached to a hub. The extendable portion has a refracted position and an extended position. A wire may be incorporated in the intravenous portion. The wire may have a receiver disposed in the tip portion. An extender tool is insertable and removable from the catheter. The extender is dimensioned to engage the receiver upon insertion into said catheter and lengthen the extendable portion of said catheter to said extended position when inserted. |
US09517323B2 |
Introducer handle notch design/concept
An improved splittable medical device introducer designed to introduce a medical device such as a lead or catheter, into a patient's vasculature without loss of blood or introduction of air is described. The introducer assembly is designed with a notch provided at the proximal end of the introducer housing. The notch, which may comprise a multitude of cross-sectional geometries, is designed to reduce the force required to separate the housing and the introducer sheath, thereby minimizing the possibility of unintentional dislodgement during separation. The notch also increases the repeatability and consistency of the amount of force required to separate the introducer housing and sheath. |
US09517322B2 |
Flowmeter
A flowmeter comprises a lower valve body (1), a throttle assembly, a flow tube assembly, an upper valve body (2), and a pressure fluctuation suppression assembly. An air inlet, an air outlet and an air flow channel connecting the air inlet and the air outlet are arranged in the lower valve body (1); a throttle assembly for adjusting the degree of opening of the air flow channel in the lower valve body (1) is further disposed on the lower valve body (1). The flow tube assembly comprises a flow tube (3), an upper base (4), a lower base (5), and a float (6); a vent hole is provided on each of axial centers of the upper base (4) and the lower base (5); the lower base (5) is arranged at the air outlet of the lower valve body (1); a vertical air flow passage and a horizontal air flow passage are arranged in the upper valve body (2); the upper base (4) is arranged at an air inlet of the vertical air flow passage in the upper valve body (2); the flow tube (3) is disposed between the upper base (4) and the lower base (5) through two ends thereof that are respectively sleeved on protruding portions of the upper base (4) and the lower base (5); the float (6) is disposed in the flow tube (3). The pressure fluctuation suppression assembly comprises a sealing gasket (7), and the sealing gasket (7) is disposed at an air outlet of the vertical air flow passage. |
US09517321B2 |
Tube for a respirator system
A tube for a ventilation system (1) for newborns is provided with a first section (7) comprising a heating wire (14), an electrical conductor (15), and a first connector (9) and a second connector (10), and with a second section (8) comprising a heating wire (16) extending over at least a certain portion of its length, an electrical line (17) extending over at least a certain portion of its length, and a first connector (11) and a second connector (12), wherein the second section (8) comprises a temperature sensor (18), wherein the electrical and pneumatic connection of the first section (7) with the second section (8) via the connection of the second connector (10) of the first section (7) is achievable by either connecting to the first connector (11) of the second section (8), so that the second section (8) is substantially heatable, or by connecting to the second connector (12) of the second section (8), so that the second section (8) is substantially not heatable. |
US09517316B2 |
Multiple-use airway mask
A flexible transparent multiple use face mask that encloses a user's face allowing the user's airway to be ventilated that includes a transparent flexible airway mask that encloses and ventilates a user's airway, an airway adaptor that directs a quantity of ventilation to the transparent flexible airway mask, a manual resuscitation bag valve that receives the airway adaptor and controls the quantity of ventilation directed to the transparent flexible airway mask and a manual resuscitation bag that produces the quantity of ventilation transmitted through the airway adaptor to the transparent flexible airway mask. The multiple-use airway mask can also be turned inside out and be used in combination with an endotracheal tube or a tracheotomy tube and also includes an attachment strap to prevent losing the transparent flexible airway mask as an added safety measure to keep the mask and bag connected. |
US09517315B2 |
Oscillating positive expiratory pressure device
A respiratory treatment device comprising at least one chamber, a chamber inlet configured to receive air into the at least one chamber, at least one chamber outlet configured to permit air to exit the at least one chamber, and a flow path defined between the chamber inlet and the at least one chamber outlet. A restrictor member positioned in the flow path is moveable between a closed position, where a flow of air along the flow path is restricted, and an open position, where the flow of air along the flow path is less restricted. A vane in fluid communication with the flow path is operatively connected to the restrictor member and is configured to reciprocate between a first position and a second position in response to the flow of air along the flow path. |
US09517312B2 |
Cap assembly for a drug delivery device
The present invention relates to a cap assembly for a drug delivery device, comprising: a cap body (12) adapted to releasably engage with a housing of the drug delivery device and being further adapted to receive a needle assembly to be releasably interconnected with said housing, an ejector unit movably arranged on the cap body at least along the body's long axis and having mechanical transmission means adapted to transfer axial movement of the ejector unit to the needle assembly for ejecting the needle assembly from the cap body. |
US09517308B2 |
Dose setting mechanism and method of setting a dose
A dose setting mechanism comprises a drug delivery device housing and a dual state track provided within the housing that is axially and rotationally fixed with respect to the housing. A dose dial component is positioned in the housing and rotatable during dose setting and dose delivery. A clutch is rotatable during dose setting and non-rotatable during dose delivery. A clutch plate is rotationally fixed relative to the housing; and a clutch blocker is in threaded engagement with the clutch plate and has a radial key engaged with the dual state track. The mechanism may comprise a biasing member positioned between the clutch blocker and clutch plate. |
US09517302B2 |
Method and system for alerting as to potential for bolus condition
A method of alerting a user to a potential unintended bolus delivery includes delivering fluid to a patient along a first fluid flow path. The method also includes transmitting a signal prior to initiation of a change in fluid delivery to the patient along a second fluid flow path connected to the first fluid flow path upstream of the patient, and detecting the signal. The method further includes actuating an alarm to alert the user to a potential unintended bolus delivery if the signal is detected. A system for carrying out the method is also provided. |
US09517301B2 |
Operating an infusion pump system
Some embodiments of a medical infusion pump system include a pump device and a removable controller device. When the pump device and the removable controller device are removably attached to one another, the components may provide a portable infusion pump unit to dispense medicine to a user. In particular embodiments, the removable controller device includes a user interface to readily provide information, for example, about the operation of the pump. |
US09517298B2 |
Low cost medical needle container and manufacturing methods therefor
Packaging is disclosed for a medical needle, such as a pen needle, having a hub with a patient end of the needle protruding from a distal end thereof. The packaging includes a tube having a first closed end into which the patient end of the needle is inserted so that the hub contacts an interior of the tube, a second closed end enclosing a proximal end of the hub, and a circumferential region disposed between the proximal end of the hub and the second closed end for opening the package to expose the proximal end of the hub. |
US09517294B2 |
Process for use with breastpump to initiate milk in breastfeeding, particularly for premature infants
The present invention provides a suction sequence which is considered to produce advantageous results, particularly for mothers with newborn infants. The sequence comprises a process of stimulation, expression, and pausing to closely mimic a newborn's sucking pattern. |
US09517292B2 |
Polymer for creating hemocompatible surface
A polymer comprising a phosphoryl choline moiety(ies), a composition comprising the polymer and optionally a bioactive agent, an implantable device such as a DES or a non-implantable device such as an angioplasty balloon comprising thereon a coating comprising the polymer and optionally a bioactive agent, and a method of using the device for the treatment of a disorder in a human being are provided. |
US09517287B2 |
Hemostatic sponge
The present invention provides a hemostatic composite sponge comprising a porous matrix of a biomaterial and a material enhancing the adherence of said sponge to the applied tissue stably associated with at least one surface of said sponge, a method of producing these sponges and their use in hemostasis. |
US09517283B2 |
Atomizing sterilization of a plurality of cleaning agents
A method for multi-agent dry fogging. The method includes pressurizing a first agent to a first range of pressure. The first agent includes a sterilant. The method also includes pressurizing a second agent to a second range of pressure. The second agent includes a non-depleting solution for protection against microorganism growth. The method also includes pressurizing a gas to a gas range of pressure. The method also includes atomizing the first agent at a nozzle to mix with the pressurized gas in a first application stage to disperse the first agent in a first dry fog within an ambient environment. The method also includes atomizing the second agent at the nozzle to mix with the pressurized gas in a second application stage to disperse the second agent in a second dry fog within the ambient environment. |
US09517279B2 |
2-alkoxy-11-hydroxyaporphine derivatives and uses thereof
The invention features 2-alkoxy-11-hydroxyaporphine derivatives that selectively bind D2high receptors. The compounds are useful for imaging D2high receptors and for the treatment of diseases, such as Parkinson's disease, sexual dysfunction, and depressive disorders. |
US09517276B2 |
Compositions and methods for conjugating activatable antibodies
The invention relates generally to compositions and methods for conjugating antibodies and activatable antibodies, and methods of partially reducing antibodies and/or activatable antibodies prior to conjugation, e.g., thiol-based conjugation, with an agent, e.g., a therapeutic and/or diagnostic agent. |
US09517275B2 |
Targeted therapy for the prevention of restenosis in the cardiovascular system
Provided herein are compositions and methods for targeted drug delivery to prevent restenosis in the cardiovascular system. In particular, provided herein are nanoscale delivery vehicles for drugs that prevent proliferation and neointimal hyperplasia. |
US09517272B2 |
Temperature dependent activation of catalytic nucleic acids for controlled active substance release
The present invention relates to an active substance release system containing two compounds. The first compound comprises a nanoparticle, combined with an oligonucleotide inhibition strand that is hybridized with a catalytically active nucleic acid. The second compound comprises a carrier, combined with a substrate molecule that is coupled to a therapeutic active substance. By means of external stimulation, the catalytically active nucleic acid of the first compound is released and specifically binds to the substrate molecule of the second compound. This leads to cleavage of the substrate molecule, whereby the active substance bound thereto is released. |
US09517269B1 |
Stable pentobarbital formulation
The present invention relates to a pentobarbital formulation with greater stability and fewer impurities. In particular, the formulation may be an aqueous formulation containing 50 mg/mL pentobarbital sodium, 50% glycol, and 10% alcohol, at a pH of 9.4. |
US09517267B2 |
Photodynamic diagnostic agent and photobleaching inhibitor
The objects of the present invention are to inhibit photobleaching of porphyrins as well as to provide a superior photodynamic diagnostic agent and a photodynamic diagnostic method employing the photobleaching inhibitor for porphyrins. The present invention provides a photodynamic diagnostic agent containing a precursor of porphyrins and a gallic acid. The present invention also provides a photobleaching inhibitor for porphyrins containing a gallic acid. |
US09517264B2 |
Human FGF receptor and β-Klotho binding proteins
The present invention provides compositions and methods relating to or derived from antigen binding proteins and antigen binding protein-FGF21 fusions that specifically bind to β-Klotho, or β-Klotho and one or more of FGFR1c, FGFR2c, FGFR3c, and FGFR4. In some embodiments the antigen binding proteins and antigen binding protein-FGF21 fusions induce FGF21-like signaling. In some embodiments, an antigen binding protein or antigen binding protein-FGF21 fusion antigen binding component is a fully human, humanized, or chimeric antibody, binding fragments and derivatives of such antibodies, and polypeptides that specifically bind to β-Klotho, or β-Klotho and one or more of FGFR1c, FGFR2c, FGFR3c, and FGFR4. Other embodiments provide nucleic acids encoding such antigen binding proteins and antigen binding protein-FGF21 fusions, and fragments and derivatives thereof, and polypeptides, cells comprising such polynucleotides, methods of making such antigen binding proteins and antigen binding protein-FGF21 fusions, and fragments and derivatives thereof, and polypeptides, and methods of using such antigen binding proteins and antigen binding protein-FGF21 fusions, fragments and derivatives thereof, and polypeptides, including methods of treating or diagnosing subjects suffering from type 2 diabetes, obesity, NASH, metabolic syndrome and related disorders or conditions. |
US09517262B2 |
Vaccine injection, preparation method and use thereof
The invention provides a vaccine injection, which includes a vaccine and a Traditional Chinese medicinal adjuvant in a mass ratio of 1:0.5-1:10, or a vaccine, a Traditional Chinese medicinal adjuvant and an aluminum adjuvant in a mass ratio of 1:0.5:2.5-1:10:20. The vaccine injection is in the form of powders, and the size of the powders is between 10 and 120 micrometers. The vaccine injection of the present invention is particularly suitable for the needle free injection technology. The invention also provides a preparation method for the vaccine injection. |
US09517258B2 |
Methods and materials for treating cancer
This document provides methods and materials for treating cancer. For example, methods and materials for identifying antigens and combinations of antigens that can be used to treat cancer as well as combinations of antigens having the ability to reduce established tumors within a mammal (e.g., a human) are provided. |
US09517257B2 |
Erythrocyte-binding therapeutics
Peptides that specifically bind erythrocytes are described. These are provided as peptidic ligands having sequences that specifically bind, or as antibodies or fragments thereof that provide specific binding, to erythrocytes. The peptides may be prepared as molecular fusions with therapeutic agents, tolerizing antigens, or targeting peptides. Immunotolerance may be created by use of the fusions and choice of an antigen on a substance for which tolerance is desired. |
US09517254B2 |
Treatment regimens
The invention further relates to compounds, pharmaceutical compositions and methods for treating all disorders of human sexual function including hypoactive sexual desire disorder (HSDD) in a subject. |
US09517252B2 |
p53 activating peptides
The present invention is directed to p53 activating peptides. The present further describes methods for generating these peptides and the use of these peptides. |
US09517249B2 |
Antioxidant dietary supplement and related method
A supplement including a blend of turmeric, quercetin and rosemary, or holy basil, wasabi, and broccoli seed extract which are present in a balanced and predetermined ratio, and which stimulate the Antioxidant Response Element (ARE), Quinone Reductase, and/or induce related gene expression, for example, heme oxygenase-1 (HMOX-1) expression. The blend of ingredients can be formed as or in a dietary supplement adapted for administration to a subject. The dietary supplement can be formulated so that the turmeric, quercetin and rosemary are present in a predetermined ratio of 1:3:5, or holy basil, wasabi, and broccoli seed extract in a predetermined ratio of 1:1:0.2. Additional ingredients can be included in the supplement. The supplement can synergistically affect natural antioxidant response pathways within cells of a subject to whom the supplement is administered. A related method of use is also provided. |
US09517248B2 |
Adherent cells from adipose or placenta tissues and use thereof in therapy
A method of treating ischemia in a subject in need thereof is disclosed. The method comprising administering to the subject a therapeutically effective amount of adherent cells of a tissue selected from the group consisting of a placenta and an adipose tissue, thereby treating the ischemia in the subject. A method of treating a medical condition requiring connective tissue regeneration and/or repair is also disclosed. |
US09517247B2 |
Encapsulated liver cell composition
Microcapsules including a capsule shell encapsulating a suspension of a therapeutically effective amount of liver cells in physical contact with a liver cell stimulating amount of erythropoietin. |
US09517245B2 |
Sorafenib-microRNA combination therapy for liver cancer
A method of treating a subject having liver cancer can include administering a synthetic oligonucleotide to a subject having liver cancer, the oligonucleotide comprising a sequence that is at least 80% identical to at least one of SEQ ID NO:1-12 (e.g., a miR-34 or miR-215 mimic); and administering sorafenib to the subject, wherein the molar ratio of sorafenib:oligonucleotide administered to the subject is in the range of about 10-2000 (e.g., a ratio that provides a superior, for example synergistic or greater than additive, effect). |
US09517243B2 |
Beta-mannosylceramide and stimulation of NKT cell anti-tumor immunity
β-mannosylceramides or salts or solvates thereof in a pharmaceutically acceptable carrier, for use as a Type I NKT cell agonist in conjunction with a therapeutically effective amount of α-galactosylceramide or a salt or a solvate thereof, and/or at least one or more T-cell co-stimulatory molecules, disclosed. Compositions comprising β-mannosylceramide, as well as methods of treatment of tumors are also provided. |
US09517241B2 |
Amelioration of intestinal fibrosis and treatment of Crohn's disease
Methods of treating patients with inflammatory bowel disease, intestinal fibrosis, or Crohn's disease involve administering a therapeutic amount of CARD-024 or related compound. |
US09517239B2 |
High-purity large-scale preparation of stannsoporfin
Large scale (bulk) compositions comprising high-purity stannsoporfin are disclosed, as well as methods of synthesizing such compositions. |
US09517232B2 |
Compounds for treatment of alzheimer's disease
The invention is directed to the use of a compound of formula I, as defined herein, to a pharmaceutically acceptable salt thereof; to a pharmaceutical composition containing a compound of formula I, and to a combination of a compound of formula I with a pharmacologically effective cholinesterase inhibitor to treat a mammal, including a human, for a disorder or condition selected from the list including Alzheimer's disease, Huntington's disease, Parkinson's disease, non-Alzheimer's dementias and ALS. |
US09517230B2 |
Small molecule RNase inhibitors and methods of use
Small molecule inhibitors of bacterial ribonuclease (e.g., RnpA) and methods for their synthesis and use are described herein. The methods of using the compounds include treating and preventing microbial infections and inhibiting bacterial ribonuclease. |
US09517217B2 |
Immune cell activation inhibitor and use thereof
The present invention provides a pharmaceutical that can be used widely for intractable neurological diseases, inflammatory diseases, etc. The immune cell activation inhibitor of the present invention contains bromovalerylurea or a derivative thereof. The immune cell activation inhibitor of the present invention can be used as a pharmaceutical for, for example: chronic neurological diseases such as Parkinson's disease and Alzheimer's disease; acute neurological diseases such as cerebral infarction and brain injury; and inflammatory diseases such as systemic inflammatory response syndromes. |
US09517216B2 |
Compositions comprising salbutamol sulphate
A pharmaceutical composition is described that is suitable for delivery from a pressurized container. The composition is free of polar excipients and comprises: (a) a propellant component that consists essentially of 1,1-difluoroethane (R-152a); (b) a surfactant component that comprises oleic acid; and (c) a drug component that consists of salbutamol sulphate. The pharmaceutical composition can be delivered using a metered dose inhaler (MDI). |
US09517215B2 |
Dermal matrix and production method thereof having synergistic effects comprising microparticles which provides tissue repair
This invention is related to dermal matrices and production method thereof, having within its structure micro particles having antioxidant agents with synergistic effects, providing speedy repair of the dermal tissue, used in chronic wound treatments, basically comprising the steps of preparing the dermal matrix system (11), forming micro particles (12), combining the micro particles with the dermal matrix system. |
US09517213B2 |
Kit containing patches and composition for insect bite treatment
A kit for treating insect bites includes a plurality of patches of different size and shape, and a container of a composition containing extracts of garlic and parsley. The patches have a pad bordered by a margin coated with a pressure sensitive adhesive. The extracts of parsley include apiol and myristicin, and the extracts of garlic include allicin. In use, the composition is deposited onto the pad and the patch is placed over an affected area and adhered to the skin with the pressure sensitive adhesive. |
US09517210B2 |
Method for producing microcapsule powder
A method for producing a microcapsule powder includes a concentration step. In the concentration step, an aqueous dispersion of a microcapsule is supplied into a cyclone, and the aqueous dispersion is then concentrated. The concentration step includes an aqueous dispersion-supplying step and a concentrated dispersion-recovering step. In the aqueous dispersion-supplying step, the aqueous dispersion is supplied into a cylindrical member inlet. In the concentrated dispersion-recovering step, a microcapsule dispersion is recovered. The microcapsule dispersion is discharged through a conical member outlet. |
US09517207B2 |
Pharmaceutical formulation containing gelling agent
Disclosed in certain embodiments is a controlled release oral dosage form comprising a therapeutically effective amount of a drug susceptible to abuse together with one or more pharmaceutically acceptable excipients; the dosage form further including a gelling agent in an effective amount to impart a viscosity unsuitable for administration selected from the group consisting of parenteral and nasal administration to a solubilized mixture formed when the dosage form is crushed and mixed with from about 0.5 to about 10 ml of an aqueous liquid; the dosage form providing a therapeutic effect for at least about 12 hours when orally administered to a human patient. |
US09517204B2 |
Pharmaceutical composition for inhalation
The present invention relates to a powder formulation which reduces side effect risk of a medicine having a side effect of drug-induced photodermatosis and increases therapeutic effect, and relates to the method for producing the same.Said powder formulation makes inhalation therapy possible by carrying out aerosolization easily, and since pharmacological effect in lung local part is increased, it is possible to decrease the dose. Skin transmigration of said medicine is controlled by a lung specific delivery technology, and photodermatosis which is a side effect can be controlled. |
US09517203B2 |
Polymer particle delivery compositions and methods of use
The present invention provides biodegradable polymer particle delivery compositions based on polymers, such as polyester amide (PEA) and polyester urethane (PEUR) polymers, that contain amino acids in the polymer. The polymer particle delivery compositions can be formulated as a liquid dispersion of polymer particles with the bioactive agents dispersed in the particle or conjugated attached to polymer molecules or particle surfaces. The bioactive agents can include drugs, polypeptides, DNA and cells for cell-based therapies using particles sized for local, mucosal or circulatory delivery. Methods of treating a disease by administering to a subject the polymer particle delivery composition, which incorporates a bioactive agent suitable for treatment of the disease, or its symptoms, are also included. |
US09517202B2 |
Phospholipid depot
The present invention is directed to phospholipid compositions and methods of preparation of phospholipid depots that are injectable through a fine needle. The phospholipid depots prepared by the methods described herein comprise nanometer-sized phospholipid particles and exhibit a higher degree of structural order compared to compositions prepared by other methods. |
US09517197B1 |
Toothpaste composition containing ganoderma lucidum component and preparation method thereof
The present invention discloses a preparation method for toothpaste composition containing ganoderma lucidum component, wherein the ganoderma lucidum component is sporoderm-broken ganoderma lucidum spore, it comprises the following steps: (1) dissolve water, sorbitol, PEG-8, propylene glycol, sodium saccharine, sodium benzoate and the extract of opuntia in a toothpaste-making pot; (2) premix calcium hydrogen phosphate, hydrated silica, sodium lauryl sulfate, cellulose gum, hydroxyethyl cellulose, sporoderm-broken ganoderma lucidum spore, Panax notoginseng powder, and radix scutellariae root powder in powder tank evenly to form a mixture; (3) stir the mixture obtained in step (2) under vacuum and inhale into the toothpaste-making pot of step (1); control the vacuum degree at minus 0.098 to minus 0.1 Mpa and stir for 15 minutes; (4) inhale the essence into the toothpaste-making pot, stir for 10 minutes, and discharge. The preparation method of the present invention is of simple technique, easy operation, and high efficiency and the obtained toothpaste composition containing ganoderma lucidum component has good using effect. |
US09517194B2 |
Oral care composition with cross-linked polymer peroxide
Oral care compositions comprising: (a) a peroxide complex comprising a peroxide component and an N-vinyl heterocyclic polymer (e.g., poly-N-vinyl polylactam, or poly-N-vinyl-polyimide); (b) a whitening agent (e.g., hydrogen peroxide); and (c) an orally acceptable carrier. In one embodiment, the carrier comprises a film forming material. Methods are also provided for making an oral care composition comprising: (a) mixing a whitening agent, silicone adhesive and carrier fluid to form a homogenous mixture; (b) adding a peroxide complex to said homogenous mixture, wherein said complex comprises hydrogen peroxide and an N-vinyl heterocyclic polymer; and (c) mixing under vacuum. |
US09517193B2 |
Antiperspirant/deodorant compositions
Antiperspirant/deodorant compositions have lower, or even zero amounts of aluminum and/or zirconium antiperspirant actives. A polymer having one or more anhydride and/or diacid moieties, such as succinic (maleic) anhydride and/or diacid. The antiperspirant/deodorant compositions comprise a polymer with a non-zero acid value and a cationic species, which may be a cationic polymer, cationic molecule, cation, and/or a cationic carrier. Product are formed for the antiperspirant/deodorant composition, as well as a method of treating perspiration. |
US09517191B2 |
Stable silk protein fragment compositions
A composition is disclosed that includes pure silk fibroin-based protein fragments that are substantially devoid of sericin, wherein the composition has an average weight average molecular weight ranging from about 17 kDa to about 38 kDa, wherein the composition has a polydispersity of between about 1.5 and about 3.0, wherein the composition is substantially homogeneous, wherein the composition between 0 ppm to about 500 ppm of inorganic residuals, and wherein the composition includes between 0 ppm to about 500 ppm of organic residuals. |
US09517187B2 |
Implant coated with net-shaped or island-shaped low-crystallized hydroxyapatite and method for coating same
The present disclosure relates to a method for coating a surface of a titanium implant with low crystalline hydroxyapatite having network- or island-like morphology and to an implant coated by such method. |
US09517185B1 |
Feeding tube system
The feeding tube system includes an elongated shaft having a proximal portion, an opposing distal portion, and a central opening or lumen extending therethrough. The proximal portion is configured to remain outside a patient's body cavity and includes a first opening through which fluids can be introduced into the lumen. The distal portion is configured for disposing within a patient's body cavity and includes a second opening for discharging fluids from the lumen into the patient's body cavity. An interior retention balloon is provided at the distal portion of the elongated shaft. An external base positioned at the proximal portion of the feeding tube can include at least one exterior base balloon extending therefrom. The interior retention balloon and the at least one exterior base balloon are inflatable. |
US09517183B2 |
Nipple abrasion protector
A nipple abrasion protector consists of a generally disc-shaped translucent polymeric adhesive film with adhesively affixed to one side of a release paper. The protector is removed from the paper and applied to the nipple to prevent chafing from contact with a shirt or other garment during extended physical activities like running and is semi-transparent or translucent and not readily detectable during activities like swimming or surfing. In addition, the protector is perforated with pores for breathablilty and has a cross-hatched surface texture to improve adhesion and flexibility. Moreover, the removable nipple protector adheres tightly to the areola and is capable of resisting protrusion of the nipple. The protector is free from materials such as latex which may incite an allergic reaction. |
US09517177B2 |
Sauna apparatus for half-body bath
A sauna apparatus for a half-body bath including a body having a concave structure surrounded with a bottom surface located horizontally on the ground and at least three surfaces connected to the bottom surface. The sauna apparatus also includes a first heating part and a seat disposed at the inside thereof. The sauna apparatus further includes a cover connected on top of the body that is movable-up and down to open and close the interior of the body. The sauna apparatus also includes a second heating part in the cover and shock absorbers to connect the body and the cover with each other. In addition, the sauna apparatus includes a seat driving part to move the seat in an advancing or opposite direction. |
US09517172B2 |
Electric bed
An electric bed includes a first driver that performs rising and lowering operation of a second frame with respect to a first frame, a controller that controls the first driver, and an input unit that instructs the controller by switch manipulation of a lowering switch of the input unit. The controller controls the first driver to lower the second frame at a basic speed when a bed height is a first predetermined height or more during depression of the lowering switch, and to lower the second frame at a first low speed slower than the basic speed when the bed height is less than the first predetermined height during the depression of the lowering switch, in case where the bed height is a height of an upper surface of the second frame. |
US09517170B1 |
Rescue basket
A rescue basket apparatus having at least one top rail extending longitudinally around the upper edge of the rescue basket defining an opening into the basket cavity, the rescue basket having a head end and a foot end, and at least two transverse crossbars affixed to the at least one top rail so as to extend down a first side, across a bottom and extending up a second side and affixed to the at least one top rail of the rescue basket. There are at least two bottom runner rails running longitudinally along the rescue basket bottom. There are two pairs of bridle attachment members spaced longitudinally apart relative to the top rail, each bridle attachment member has a bridle attachment receiving opening and the bridle attachment members are pivotally mounted to the transverse crossbars near and below the top rail. The bridle attachment members receiving opening extends inwardly into the rescue basket cavity. The bridle attachment members' pivotal movement is confined to a partial rotation about the transverse crossbars. The rescue basket may be a single piece design, or a two piece split-apart type. The two piece split-apart rescue basket has locking connectors that make the basket easy to assemble and very ridged when connected into one piece. These connectors include a secondary safety latch that prevent any undesired disconnection. |
US09517165B2 |
Method and apparatus to temporarily restrain stretchable non-woven fabric
A method for obtaining temporary non-stretchability characteristics, mainly in a machine direction, in a non-woven fabric having any level of stretchability, in order to ease converting is disclosed. The non-stretchability characteristics can be then eliminated in order to restore the original characteristics of the non-woven fabric. This technique allows the formation of final products comprising stretchable non-woven fabrics by converting machines. |
US09517164B2 |
Wound dressing with advanced fluid handling
A wound dressing for managing wound fluids includes a porous contact layer for positioning adjacent a wound. An internal open window extends through the contact layer exposing a distal side of an absorbent member. The absorbent member is disposed in a superimposed relation to the window of the contact layer and is dimensioned to extend laterally beyond the window such that a portion of the absorbent member overlaps and is secured to the contact layer. A drape layer is disposed on a proximal side of the absorbent member, and is adhesively coated to fasten the drape layer to the absorbent member. A cover layer disposed over the drape layer defines an internal open window such that the open window is adjacent the absorbent member. A distal side of the cover layer is adhesively coated to secure the cover layer to the contact layer. |
US09517162B2 |
Retinal surgery
Systems, processes, and computer program products may be used to perform retinal surgery. In particular implementations, a system, a process, and a computer program product may include the ability to inject a retina manipulation fluid into an eye through an injection/extraction system and apply negative pressure to the injection/extraction system to facilitate extraction of fluid from the eye. The system, the process, and the computer program product may also include the ability to adjust the applied negative pressure. |
US09517160B2 |
Cooling elements with bands
A kit for cooling the blood in the carotid arteries includes a cervical immobilization collar and a cooling element. The cooling element may include a body-facing panel attached on a body-facing surface to a lining layer, an outward-facing panel, and cooling material disposed between the body-facing panel and the outward facing panel. The cooling material may comprise urea and Carbamakool™ in an amount sufficient to produce a temperature of 20° F. to 35° F. within a minute of activation when measured on the body-facing surface of the body-facing panel. |
US09517159B2 |
Occlusion implant
Contraceptive and/or sterilization methods and devices are disclosed which may improve the speed of tubal occlusion and mechanisms for anchoring for a contraceptive device. In accordance with some embodiments, improvements may be made to the delivery catheter to induce trauma and create faster tubal occlusion, improvements may be made to the occlusion device to prevent migration and induce trauma, and improvements may be made to the occlusion device to reduce the total volume of in-growth required compared to conventional expansive occlusion devices. |
US09517156B2 |
Device for fixing a test person on a standing surface
The invention relates to a device for fixing a test person on a standing surface, wherein at least one rope is tensioned between a hip belt placed on the test person and a retaining plate arranged below the standing surface. |
US09517151B2 |
Control of balloon inflation rate during deployment of scaffold
An apparatus and method for controlling inflation pressure and pressurization rate of a balloon during deployment of a stent or scaffold are disclosed. The apparatus and method involve a pressure attenuator for controlling an inflation rate of the delivery balloon. |
US09517148B2 |
Devices, systems, and methods for the prevention of stroke
The disclosure of the present application provides devices, systems, and methods for the prevention of stroke. In at least one embodiment of a device of the present application, the device comprises an extension portion sized and shaped to fit within an artery extending from an aortic arch, and a flange portion sized and shaped to prevent the device from advancing into the artery extending from the aortic arch in which the device may be positioned. In at least one embodiment of a system for preventing stroke of the present application, the system comprises a hypotube, a folder coupled to a distal end of the hypotube, a sleeve positioned circumferentially around the hypotube proximal to the folder, and a stent, wherein a first part of the stent may be positioned within the folder, and wherein a second part of the stent may be positioned within the sleeve. |
US09517145B2 |
Guide alignment system and method
An orthopedic device includes a patient-specific acetabular guide that can be used for preparing an acetabulum of a patient to receive an acetabular implant and/or placement of an acetabular prosthesis. The acetabular guide has a body with an outer three-dimensional surface configured to match an acetabulum of a specific patient's hip joint designed from data of the patient's hip joint. The acetabular guide can further include a peripheral annular rim. |
US09517143B2 |
Adaptable interbody implant and methods of use
An intervertebral fusion implant comprises a body defining a longitudinal axis and extending between a first end and a second end. The body defines a first wall configured for engaging a first vertebral surface and a second wall configured for engaging a second vertebral surface. The first wall is connected to the second wall. The first wall is movable relative to the second wall such that the body is deformable from a first, initial implanted configuration such that the body is disposed between the first vertebral surface and the second vertebral surface for fixation thereof and a second configuration such that the body is deformed relative to the first configuration to adapt to an orientation of the first vertebral surface and the second vertebral surface. Methods of use are disclosed. |
US09517138B2 |
Stabilizing prosthesis support structure
A tibial support structure includes a platform portion and a medullary portion that are monolithically formed as a single piece. The medullary and platform portions of the augment component are adapted to accommodate and mechanically attach to a tibial baseplate, and are individually shaped and sized to replace damaged bone stock both within the tibia, as well at the tibial proximal surface. The monolithic formation of the tibial support structure provides a strong and stable foundation for a tibial baseplate and facilitates restoration of the anatomic joint line, even where substantial resections of the proximal tibia have been made. The tibial support structure may be made of a bone-ingrowth material which facilitates preservation and rebuilding of the proximal tibia after implantation, while also preserving the restored joint line by allowing revision surgeries to be performed without removal of the tibial support structure. |
US09517136B2 |
Variable-density implants and related methods and systems
Ceramic orthopedic implants may have one or more dense inner layers and one or more porous outer layers. Methods for manufacturing the implants may include one or more stages during which the dense inner layer(s) are partially compressed. At least one porous outer layer may include coating particles that are present at a surface of one or more inner layer(s) while pressure is applied to attach the coating particles to the inner layer(s) and to further compress one or more of the inner layer(s). Various layers may be formed until an implant, or other device, is formed having the desired density gradient and/or other properties, as disclosed herein. |
US09517133B2 |
Malleable prosthesis with enhanced concealability
A malleable penile prosthetic device for implantation within a penis of a user includes a columnar body and a plurality of malleable cores within the columnar body. The columnar body has a proximal end, a distal end, and a central axis extending from the proximal end to the distal end. Each of the plurality of malleable cores extends along the central axis, is angularly displaced about the central axis from neighboring malleable cores, and includes a bundle of wires surrounded by a sleeve. |
US09517132B2 |
Actuating device for mechanical adjustment element of surgical implant
The present invention concerns an actuating device for actuating a mechanical adjustment element of surgical implant, said mechanical adjustment element allowing to modify the functional shape and/or the functional size of the surgical implant when actuated, said actuating device comprising transmission means linked with one end to the mechanical adjustment element and able to move the mechanical adjustment element when said transmission means are actuated, connecting means (7) mounted on the other end of the transmission means and able to actuate the transmission means, said connecting means (7) comprising coupling means and driving means (24) comprising complementary shaped coupling means, said driving means (24) being designed to be removable and fitted into the coupling means for moving the mechanical adjustment element by driving into movement a movable part of the connecting means (7). |
US09517131B2 |
Cardiac valve repair device
A cardiac valve repair device has a membrane assembly and a frame. The frame has a central structure that defines a central separation, a pair of sleeves positioned below the central structure, and a pair of atrial alignment expansion beams. Each atrial alignment expansion beam has a curved section and inner section at each opposite end that defines a scissor-crossing where they overlap each other to form a separate lower expansion clip beam at each of the opposite ends thereof. The cardiac valve repair device also includes a pair of upper expansion clip beams. A V-shaped ventricular expansion curved beam extends below the two sleeves, with the membrane assembly secured to the V-shaped ventricular expansion curved beam. A pair of ventricular alignment stabilizing beams extends downwardly from the two sleeves. |
US09517129B2 |
Implant delivery and deployment system and method
An implant delivery system comprising a catheter including at least one lumen, an implant configured to be received in the lumen, and a latching mechanism configured to be received in the implant. The latching mechanism may be configured to releasably couple the implant to a delivery wire and to transmit a torque through the delivery wire to cause at least a portion of the implant to rotate. The an implant may comprise a shaft, a spacer configured to interact with at least a portion of at least one cusp of a heart valve to at least partially restrict a flow of blood through the heart valve in a closed position, a garage configured to couple the spacer to a first end region of the shaft, and at least one anchor mechanism. The garage may define a cavity configured to receive the latching mechanism and to increase rotational and translational stability of the latching mechanism. |
US09517128B2 |
Multi-functional hybrid devices/structures using 3D printing
A bioelectronic device and method of making is disclosed. The device includes a scaffold formed via 3D printing. The device also includes a biologic and an electronic device formed via 3D printing, the biologic and electronic device being interweaved with or coupled to the scaffold. The electronic component may e.g., include at least one of hard conductors, soft conductors, insulators and semiconductors. The scaffold may be formed of at least one of synthetic polymers and natural biological polymers. The biologic may include at least one of animal cells, plant cells, cellular organelles, proteins and DNA (including RNA). |
US09517122B2 |
Anti-migration micropatterned stent coating
An endoprosthesis has an expanded state and an unexpanded state, the endoprosthesis includes a stent, wherein the stent has a first end, a second end, an inner surface defining a lumen, an outer surface, and a thickness defined between the inner surface and the outer surface; and a stent end covering disposed at one of the first and second ends, the stent end covering including a polymeric coating that includes a base and a plurality of protrusions, the base including a first major surface facing the outer surface of the stent, the base further including a second major surface from which each of the plurality of protrusions extends outwardly, the first major surface opposing the second major surface, wherein the protrusions are arranged in a micropattern. Methods of making and using an endoprosthesis are provided. |
US09517119B2 |
Mouthpiece for cleaning teeth with an adjustable arc length and/or arc width
The mouthpiece includes an arcuate base assembly (12), comprising two side pieces (14, 16) and an intermediate center piece (18), the two side pieces (14, 16) being connected rotatably to opposing ends of the center piece (18), such that the rear ends of the side pieces move outwardly and inwardly. A flexible screw thread spindle (30) having two side portions and a front portion is connected at the free ends thereof (33, 35) to the rear ends of the side pieces of the base assembly, such that the flexible spindle member follows the arcuate shape of the base assembly. Two side carriages (40, 42) are mounted on opposing side portions of the spindle (30), the carriages having bristles (43) mounted thereon for cleaning teeth. A motor and gear box assembly (36) are mounted at the front of the appliance for moving the two carriages along the respective side portions of the spindle (30), which have opposing screw threads. A front carriage (48) is mounted on and moves along a front spindle by a front motor and gear box (36). |
US09517117B2 |
Fiber-reinforced composite post
A fiber-reinforced composite post having an inner core section or rod fabricated of fibers impregnated in a resin matrix and an outer sheath of fibers arranged in the form of a mesh. The outer sheath comprises an interior and an exterior surface, the exterior surface is dry and unembedded fibers, and the outer sheath is attached to the inner core. In an embodiment of the dental post, the interior surface of the mesh is embedded in the resin matrix of the inner core with the inner core fibers. |
US09517116B2 |
Method for articulator adjustment and gnathological instruments for work under this method
The method for articulator adjustment and gnathological instruments for work under this method find application in dental medicine and laboratory dental techniques. These and other goals of this invention are achieved with the measurement of the individual parameters of the patient's mandibular transversal hinge axis in the three planes: transversal, frontal and sagittal, including the following steps: measurement of inter-condylar distance; measurement of the distance between the condylar axis and the occlusal plane; measurement of the distance between the condylar axis and central incisors with a face-bow and bite-tray (FIGS. 1,10,11,12); recording of values; simultaneous fixation in the articulator in minimal gathered position of the manufactured in advance two primary working models juxtaposed in central position: a mandibular lower working model to the working plate of the lower articulator frame and a maxillary upper working model to the opposite working plate, which is connected in a telescopic way to the upper articulator frame (FIGS. 2,3,4,5,6,13); coincidence of the mandibular transversal hinge axis of a patient in terms of measured values of his individual parameters and the articulator transversal hinge axis (FIGS. 7,8,9,14); and closure of this articulator in an individual spread-out position. |
US09517115B2 |
Ampoule for storing implant capable of maintaining humidity
An ampoule for storing an implant capable of maintaining humidity includes: a container capable of airtight sealing at least momentarily or temporarily; a partition member which divides an accommodation space inside the container into two spaces, first and second spaces, and allows vaporized water molecules to be transported between the divided spaces; and a water molecule supply source which is accommodated in the first space of the two spaces divided by the partition member and supplies the vaporized water molecules. Therefore, the invention enables the construction of an environment which allows the hydrophilicity of the implant to be maintained for a long time, wherein the hydrophilicity is imparted to and protected from the surface of the implant or a coating layer formed on the surface of the implant. |
US09517112B2 |
Low profile bracket with elastomeric chain
An orthodontic appliance comprises a base portion adapted to be affixed to a patient's tooth and an upper portion including a flexible and resilient hook for forming a tubular channel for receiving an archwire. The upper portion includes a flange affixed to the hook, and is sized and shaped to connect to loops of an elastomeric power chain. |
US09517110B2 |
Matrix band retainer
A denial matrix band retainer is provided with a retractor, main body portion and a bias mechanism. The retractor includes a proximal end and a distal end, with a band engagement portion at the proximal end. The main body portion having a proximal end and a distal end, with a head portion located at the proximal end. The bias mechanism coupling the retractor to the main body portion, the bias mechanism having a static position and a fully active position, wherein in the static position the head portion is spaced apart from the band engagement portion a first distance, and in the fully active position the head portion is spaced apart from the band engagement portion a second distance which is greater than the first distance, the bias mechanism including an actuator for urging the bias mechanism towards the fully active position. |
US09517108B2 |
Medical marker, method and apparatus for producing a medical marker
The present invention relates to a method for producing a multi-part medical marker (1) comprising a marker core (2) consisting of at least two corresponding parts (2a, 2b) and comprising a detectable surface, said method comprising the following steps: —providing the parts (2a, 2b) of the marker core (2); —applying a detectable layer (4) to the surface (3) of the parts (2a, 2b) of the marker core (2); and —joining the parts (2a, 2b) of the marker core (2) together to form a marker (1). The present invention also relates to a multi-part medical marker comprising a marker core consisting of at least two corresponding parts (2a, 2b) and comprising a detectable surface, wherein the surface is substantially formed from a detectable coating (4) which is applied to the surface (3) of the parts (2a, 2b) of the marker core (2). The present invention also relates to an apparatus for producing a medical marker comprising a marker core (″2) and a detectable surface, comprising: —a first feeding device (16) for providing the marker core (2); —an application device (17) for applying a detectable layer to the surface (3) of the marker core (2); and —a transport device (18) for transporting the marker core (2) within the apparatus. |
US09517107B2 |
Surgical targeting system and method
A targeting system is used for positioning of a medical sub device with respect to a medical device. A reference body is reproducibly positioned with respect to a targeting device coupling section and reproducibly positioned with respect to a targeting unit. The targeting unit has a targeting direction and is adjustable with respect to the targeting device so that the targeting direction points toward a medical sub device receptacle of the medical device coupled to the targeting device coupling section. The imaging system is positionable with respect to the targeting device such that the imaging system is capable of imaging a single two-dimensional view of the reference body and the medical sub device receptacle. The evaluation unit generates position data of the single two-dimensional view and to determine from the position data a lateral distance between the targeting direction and a receiving direction of the medical sub device receptacle. |
US09517106B2 |
Systems and methods for commanded reconfiguration of a surgical manipulator using the null-space
Devices, systems, and methods for reconfiguring a surgical manipulator by moving the manipulator within a null-space of a kinematic Jacobian of the manipulator arm. In one aspect, in response to receiving a reconfiguration command, the system drives a first set of joints and calculates velocities of the plurality of joints to be within a null-space. The joints are driven according to the reconfiguration command and the calculated movement so as to maintain a desired state of the end effector or a remote center about which an instrument shaft pivots. In another aspect, the joints are also driven according to a calculated end effector or remote center displacing velocities within a null-perpendicular-space of the Jacobian so as to effect the desired reconfiguration concurrently with a desired movement of the end effector or remote center. |
US09517103B2 |
Medical instruments with multiple temperature sensors
According to some embodiments, a medical instrument (for example, an ablation device) comprises an elongate body having a proximal end and a distal end, an energy delivery member positioned at the distal end of the elongate body, a first plurality of temperature-measurement devices carried by or positioned within the energy delivery member, the first plurality of temperature-measurement devices being thermally insulated from the energy delivery member, and a second plurality of temperature-measurement devices positioned proximal to a proximal end of the energy delivery member, the second plurality of temperature-measurement devices being thermally insulated from the energy delivery member. |
US09517099B2 |
System for corrective spinal surgery and method of use
A pedicle screw locking system includes a reduction tube and a locking driver. The reduction tube includes an inner shaft, a pair of grips, a reduction sleeve, and a rotatable tube. The inner shaft has a threaded end and reduction arms distally extending from the threaded end. Each grip of the pair of grips has a finger configured to engage the receiver of a pedicle screw. The reduction sleeve and the rotatable tube are disposed over and coaxially aligned with the inner shaft. The rotatable tube is coupled to the reduction sleeve. The rotatable tube moves the reduction sleeve relative to the reduction arms. The locking driver includes a threaded portion and a blunt tip. The threaded portion is configured to thread into threads in the receiver of the pedicle screw until the blunt tip locks the receiver of the pedicle screw. |
US09517098B2 |
Bone fusion device
A bone fusion device includes a first anchor for insertion into a hole formed in a first phalange, and a second anchor for insertion into a hole formed in a second phalange. A rod includes a handle and a distal end, with the distal end being associated with each of the first anchor and the second anchor. The rod includes a breakaway portion between the handle and the distal end allowing the handle to be manually separated from the distal end. |
US09517097B2 |
Low-profile, high tension mesh plate for subcutaneous fracture fixation
A fixation device and method for the subcutaneous fixation of bone fragments. A fixation mesh is formed by the intersection of a plurality of linear legs that are interconnected in sagittal planes to form linear sagittal lines and a plurality of crimped legs that are interconnected in transverse planes to form transverse lines. The mesh resists expansive forces that are created in the linear sagittal lines and a compressive stress is created in the transverse lines when tensile loads are applied to the linear sagittal lines resulting in a device that minimizes the gap distance between bone fragments. |
US09517096B2 |
Method and system for longitudinal closure of dissected sternums
Systems, devices, and methods for longitudinal closure of a dissected sternum are provided. The system includes first and second reinforcing members, fasteners, and closure members. Each reinforcing member is configured to be placed on an outer surface of a respective sternum portion, such that each reinforcing member is longitudinally disposed on an opposite side of a sternum opening with respect to the other reinforcing member. Fasteners may be placed in holes defined in the reinforcing members to secure a respective reinforcing member to a corresponding sternum portion. The closure members, which may be sternal closing wires, may then be wrapped around the sternum portions and the reinforcing members transversely to close the sternum opening. Because the reinforcing members include extended regions having lateral edges that extend away from a midline of the respective reinforcing member, the closure members are moved away from the edges of the bone. |
US09517095B2 |
Method and apparatus for minimally invasive treatment of unstable pelvic ring injuries combined with hip arthroplasty
The instant invention is a novel method and apparatus for minimally invasive treatment of unstable pelvic ring injuries combined with fixation of acetabular cup assemblies for total hip arthroplasty. Fixation means and acetabular cup assemblies are affixed to the ilia and subcutaneous anteriorly bowed elongated rods/plate including possibly a subcutaneous posterior plate are connected between the fixation means. |
US09517087B2 |
Bone fixation system and methods
An intermaxillary fixation system is provided, including a bone anchorage screw having at least one of an elongated head with internal threading and an externally threaded screw extending from a head of the bone anchorage screw, a fixation system, and a rail bar. A method for the stabilization and fixation of maxillary and mandibular arches is also provided, including setting a plurality of bone anchorage screws to the maxillary and mandibular arch, each bone anchorage screw having a head, fixing one or more T-shaped bars to the bone anchorage screws, bending and connecting a rail bar to heads of the one or more T-shaped bars with orthodontic screws, and wrapping a connector between the heads of the bone anchorage screws located on the mandibular arch and the maxillary arch. |
US09517086B2 |
Fixation clamp
A fixation clamp for use in an external fixation system for holding bone fragments adjacent to each other with the help of fixation elements has at least one clamping assembly having a pair of jaws with at least two different size grooves to accommodate a bone fixation element such as a pin or rod. An alternate clamping assembly has at least three grooves wherein at least two of the grooves have a different size adapted to accommodate a correspondingly sized bone fixation element such as a bone pin. The longitudinal axes of the grooves define a polygon. The jaw pairs can be rotated about a central longitudinal axis to present different size reception cavities towards the pins or rocks depending on their diameter. |
US09517083B2 |
Apparatus for treating an organ and related methods of use
A method of treatment may include advancing a medical device to a wall of an organ having a plurality of layers of tissue. The medical device may include an elongate tube having a proximal end and a distal end, a lumen extending therebetween, and an injector disposed within the lumen. The injector may be configured to deliver a substance to a location between first and second layers of tissue of the plurality of layers of tissue within the organ wall. In addition, the method may further include delivering the substance to the location, wherein, when delivered, the substance is configured to spatially separate a portion of the first and second layers of the tissue. |
US09517082B2 |
Methods for preparing a skin graft without culturing or use of biologics
The present invention generally relates to methods for preparing a skin graft without culturing or use of biologics. |
US09517075B2 |
Drill bit and method for preparing a bone for a fixation screw
A bone fixation system includes a fixation device configured to be positioned at a target area of bone comprising two ends connected by a shaft and further comprising a bore formed through the shaft configured to receive a fixation screw. The system further includes a drill bit sized and configured to pass through the bore to prepare the surrounding bone to receive a second fixation device. At least a distal portion of the drill bit is configured to pass through the bore. The fixation device is made of a first material and wherein the distal portion of the drill bit comprises at least an outer portion made of a second material. The second material of the drill bit has a hardness that is less than the hardness of the first material of the fixation device. |
US09517073B1 |
Inflatable balloon stent
A method for confined and controlled treatment of a target area of an internal body lumen using negative pressure applied to the target area, the method permitting treatment to proceed without interrupting the flow of bodily fluid through the body lumen, the method including deploying a resilient stent having a liner to define the target area and passages within the liner connected to a catheter tube so that the negative pressure may be applied through a lumen of the catheter tube from a source connected to the catheter tube without impacting the inflated stent and without impacting the ability of body lumen fluid to flow through the stent, thereby permitting therapy to proceed without disrupting the natural flow of bodily fluids or the delivery of nutrients within the body lumen during therapy. |
US09517072B2 |
Method and apparatus for storage and/or introduction of implant for hollow anatomical structure
Apparatus for advancing a vascular implant into a blood vessel. The apparatus comprises a first elongate member, the first elongate member having sufficient column strength to function as a pusher member; and a second elongate member, the second elongate member being thinner than the first elongate member and extending to a distal end located at a first point which is at or near a distal end of the first elongate member. The elongate members form an implant retaining portion while the distal end of the second elongate member is located at the first point. The implant retaining portion is located proximal of the first point. The implant retaining portion comprises a space located between the elongate members and configured for receiving an implant portion, with the first elongate member on one side of the space and the second elongate member on another side. The implant retaining portion further comprises a proximal side and a distal side which further circumscribe the space. The proximal and distal sides are effective to prevent an implant received in the retaining portion from moving out of engagement with the retaining portion as the first elongate member is moved distally and proximally. The implant retaining portion is removable by withdrawing the second elongate member in a proximal direction with respect to the first elongate member, thereby moving the distal end of the elongate member proximally beyond the former location of the implant retaining portion. Associated methods, and other apparatus and methods, are also disclosed. |
US09517067B2 |
System and method for satellite drug delivery
The present disclosure is directed to an implantable repository including a housing comprising at least one bioactive agent and at least one attachment member coupled to the housing, the at least one attachment member configured to couple the implantable repository to at least one of a medical device and a tissue surface. |
US09517066B2 |
Directionally biased staple and method of manufacturing
In accordance with the present disclosure a cartridge for use with a surgical stapler is disclosed. The cartridge has a plurality of individual directionally biased surgical staples therein and associated pushers for ejecting the staples from the cartridge, each of the staples being supported within the cartridge in spaced relation from adjacent staples and each of the staples comprising a backspan, and a pair of deformable legs depending from the backspan. The legs are configured to come into contact with anvil pockets for formation of the staple. Each of the staples has a substantially uniform cross-section along substantially the entire length of each leg, the cross-section includes a shape that is selected from the group consisting of a trapezoid, a triangle and a semicircle. |
US09517063B2 |
Movable member for use with a tissue thickness compensator
A cutting blade for a surgical cutting and stapling instrument is disclosed therein. The cutting blade can include one or more features to direct or displace substances released from within the tissue thickness compensators used with the surgical instrument. The cutting blade may include a textured surface that can cause substances from the tissue thickness compensator to spread across the blade surface. |
US09517061B2 |
Thread anchor
A method and a device for anchoring a suture to an object includes a shuttle and a pin made of a material which can be liquefied by means of ultrasonic vibrations. A suture is attached to a rear end of the pin. The shuttle has a shuttle body, a shuttle arm and a suture reception, wherein the shuttle arm is suitable for releasably holding the pin in a predetermined position relative to the shuttle body such that the pin can be reliably introduced into a hole in an object. |
US09517060B2 |
Method and device for approximating tissue
A wound closure device including a first tissue anchor with a first suture filament fixedly coupled thereto at a proximal end and extending along a length to a free distal end, and a second tissue anchor with a second suture filament fixedly coupled thereto at a proximal end and extending along a length to a free distal end. The first suture filament is configured to form a slip knot at its proximal end substantially adjacent the first tissue anchor, and the second suture is configured to form a slip knot at its proximal end substantially adjacent the second tissue anchor. The length of the first suture filament passes through the slip knot of the second suture and the length of the second suture filament passes through the slip knot of the first suture filament. |
US09517059B2 |
Articulating surgical instruments and method of deploying the same
A surgical instrument comprises a steering mechanism. The steering mechanism comprises a handle at a proximal end of the surgical instrument. The handle includes a plurality of controls for controlling a movement of the surgical instrument. The steering mechanism also comprises a hub that rotatably mates with the handle and a housing positioned about the hub. The handle, the housing, and the hub communicate with each other to provide at least a first degree of freedom and a second degree of freedom. An articulation region is at a distal end of the surgical instrument. A movement of the steering mechanism handle in one and only one of the first or second degrees of freedom relative to at least one of the housing or the hub translates to a movement of the articulation region in a single plane of motion. |
US09517058B2 |
System and method for pelvic floor repair
A method of repairing a pelvic floor disorder and a system for carrying out the method are provided. The method is effected by positioning an imaging device in an abdominal, rectal, perianal or vaginal cavity, advancing a surgical instrument through a vaginal wall under guidance of the imaging device to thereby reach a target tissue and using the surgical instrument to attach the tissue repair device to the target tissue. |
US09517057B2 |
Shaft of a laparoscopic instrument
A shaft of a laparoscopic instrument, having a ceramic tube which extends over the main length of the shaft and has a sheath which encloses the ceramic tube in at least some regions, is situated to cover those regions of the ceramic tube that are at risk of breakage and is designed to prevent the splinters of ceramic from penetrating through the sheath. The ceramic tube forms a predetermined breaking point in the region of the sheath. |
US09517055B2 |
System and method for acquiring optoacoustic data and producing parametric maps using subband acoustic compensation
A method is disclosed for generating sinograms by sampling transducers acoustically coupled with a surface of a volume after a pulse of light, each transducer being associated with a channel in an optoacoustic imaging system, and processing at least two multi-channel sinograms, each corresponding to a different one of the at least two different predominant wavelengths, to create at least two processed sinograms. The processing step includes a step of sub-band acoustic compensation. Image reconstruction is performed based upon the processed sinograms to generate at least two optoacoustic images. Image post processing is performed on the optoacoustic images to generate post-processed images. A parametric map is generated based upon information contained in the post-processed images, and an ultrasound image is generated using the transducers. The parametric map and the ultrasound image are co-registered and a co-registered image is displayed. |
US09517053B2 |
Dual-mode piezocomposite ultrasonic transducer
A compact, high power, dual mode, emitting and receiving ultrasound transducer and method for applying ultrasonic energy within a living subject and for monitoring the effects it induces in tissue comprises a set of piezoelectric polymeric transducer elements and a set of piezoelectric ceramic elements, bonded together. The polymeric transducer elements have electrodes enabling their use for low power diagnostic imaging interrogation of the tissue and the ceramic transducer elements have electrodes enabling their use for high power therapy applications. |
US09517049B2 |
Ultrasonic probe, position display apparatus and ultrasonic diagnostic apparatus
An ultrasonic probe connected to an ultrasonic diagnostic apparatus having a display unit configured to display an ultrasonic image is provided. The ultrasonic probe includes a transducer array aligned in a predetermined direction for and configured to transmit an ultrasonic beam to a target object and receive a reflected ultrasonic beam, a probe display unit fixed to said ultrasonic probe and having a length at least as long as a length of said transducer array, and a display control unit configured to, based on a specific information specified in the ultrasonic image displayed on the image display unit, display a corresponding position of the specific information on said probe display unit. |
US09517048B2 |
Ultrasound endoscope
An ultrasound endoscope, having a cable for connecting the ultrasound endoscope to a driving apparatus, includes an insertion section insertable into a subject, a plurality of transducers provided at a distal end portion, an electrode formed in each of the transducers, a wiring section connected to the electrode to electrically connect the electrode and the cable, and matching circuits, at least one of which is provided at an end of or partway in each of the wiring section. The electrode, the wiring section, and the matching circuits are provided in each of the plurality of transducers. The cable includes a core wire and an insulating layer enwrapping the core wire and functions as a matching section that matches electric impedance of each of the transducers between the plurality of transducers and the driving apparatus by varying a thickness or quality of material of the insulating layer. |
US09517045B2 |
Radiographic imaging apparatus and a method of correcting threshold energies in a photon-counting radiographic detector
Provided are a radiographic imaging apparatus and a method of controlling the same. The radiographic imaging apparatus includes a radiographic source configured to emit radiographic rays in a discontinuous eigen energy spectrum, a radiographic detector configured to receive the radiographic rays, convert the received radiographic rays into electrical signals, and count the number of photons having energy that exceeds a threshold energy, and a controller configured to adjust the threshold energy by comparing an energy spectrum of the detected radiographic rays with the eigen energy spectrum of the emitted radiographic rays from the radiographic source. |
US09517044B2 |
System and method to automatically assist mobile image acquisition
A system and method to perform image acquisition of a subject is provided. The system includes a mobile device to move an imaging system across a floor, and a brake system that restrains movement of the mobile device. A controller includes a memory having program instructions to instruct a processor to perform the steps of: instructing movement of the mobile device in support of the imaging system to a first position for image acquisition of the subject; receiving feedback that the mobile device is located at the first position; and applying a brake force to restrain movement of the mobile device. The step of applying the brake force includes generating a vacuum in restraint of movement of the mobile device with respect to the floor. |
US09517043B2 |
Multi-source radiation generator and radiography system
A multi-source radiation generator in which plural radiation sources are arranged in series includes a control unit that controls a dose of radiation emitted from each of the radiation sources depending on positions of the radiation sources, and reduces variation in a radiation dose resulting from differences in positions of the radiation sources by changing an irradiation time, an anodic current value of each of the radiation sources depending on a distance from each of the radiation sources to a subject. |
US09517042B2 |
Systems and methods for imaging phase selection for computed tomography imaging
An imaging system includes a computed tomography (CT) acquisition unit and a processing unit. The CT acquisition unit includes an X-ray source and a CT detector configured to collect CT imaging data of an object to be imaged. The processing unit includes at least one processor operably coupled to the CT acquisition unit. The processing unit is configured to control the CT acquisition unit to collect at least one sample projection during rotation of the CT acquisition unit about the object to be imaged, compare an intensity of the at least one sample projection to an intensity of a reference projection, select a time to perform an imaging scan based on the comparison of the intensity of the at least one sample projection to the intensity of the reference projection, and control the CT acquisition unit to perform the imaging scan. |
US09517039B2 |
X-ray measurement assisting tool
This assisting tool is a multi-functional tool that is used in X-ray measurements of a subject. The multi-functionality is achieved by using the outer form and the inner structure of the tool in combination. More specifically, this assisting tool has two inclined surfaces that constitute the outer form. By inserting this assisting tool under the two legs, the two legs can be kept in a posture in which the knees are bent. The side end structure that constitutes the outer form keeps the two feet in a twisted state. A measurement chamber that constitutes the inner structure is for measuring the forearm. |
US09517036B2 |
Radiation imaging using very slow rotational technique
An imaging system includes a radiation source, a positioner configured to rotate the radiation source along an arc path at a rate less than 0.5 degree/sec, an imager in operative position relative to the radiation source, wherein the radiation source and the imager are configured to obtain a plurality of images while the radiation source is at different positions along the arc path, and a processor configured to determine a digital tomosynthesis image using a subset of the plurality of images. An imaging method includes generating a control signal to control a positioner to rotate a radiation source through an arc path at a rate less than 0.5 degree/sec, obtaining a plurality of images that are generated using radiation from the radiation source while the radiation source is at different positions along the arc path, and determining a digital tomosynthesis image using a subset of the plurality of images. |
US09517035B2 |
Distributed healthcare communication system
A graphical audio station of a nurse call system is operable to permit a user to perform one or more of the following functions: establish a two-way voice communication link with another computer device in another patient and/or with a another computer device located in another staff work area and/or with a wireless communication device carried by caregiver and/or with a telephone of the healthcare facility; broadcast a voice page to a group of other selected computer devices; compose and send a text message to a portable device that is carried by a caregiver and that has wireless communication capability; browse web pages and/or view multimedia content, such as videos, hosted on servers of the healthcare facility and/or that are accessible via the Internet; view and/or acknowledge and/or answer and/or cancel alerts or nurse calls originating in a plurality of patient rooms. |
US09517034B2 |
Healthcare communication system for programming bed alarms
A system that monitors various conditions of a plurality of hospital beds located in different rooms of a healthcare facility is provided. Alternatively or additionally, other types of equipment may be monitored by the system. Various configurations of network interface units that are coupleable to or integrated into a hospital bed are also disclosed. The system receives data from the hospital beds and/or other equipment and initiates a communication to a wireless communication device of at least one designated caregiver in response to the received data being indicative of an alarm condition. |
US09517032B2 |
Sensor over-mold shape
An implantable sensor module and medical device includes a housing having an inner shell having a thickness extending between an inner wall and an outer wall and an outer layer, wherein the inner shell and the outer layer form a substantially flat portion. A shoulder extends adjacent to a diaphragm to extend the outer layer laterally away from a central medial line extending between edges of the diaphragm. A recess portion is formed between the diaphragm and an inner side of the outer layer, and an over-fill channel is formed by the outer layer extending through the outer layer from an opening formed at the outer wall to an opening formed along the inner side of the outer layer extending along the substantially flat portion. |
US09517031B2 |
EEG hair band
The present invention relates to hair band EEGs. More particularly, the present invention relates to hair bands. |
US09517030B2 |
Nonlinear system identification techniques and devices for discovering dynamic and static tissue properties
A device for measuring a mechanical property of a tissue includes a probe configured to perturb the tissue with movement relative to a surface of the tissue, an actuator coupled to the probe to move the probe, a detector configured to measure a response of the tissue to the perturbation, and a controller coupled to the actuator and the detector. The controller drives the actuator using a stochastic sequence and determines the mechanical property of the tissue using the measured response received from the detector. The probe can be coupled to the tissue surface. The device can include a reference surface configured to contact the tissue surface. The probe may include a set of interchangeable heads, the set including a head for lateral movement of the probe and a head for perpendicular movement of the probe. The perturbation can include extension of the tissue with the probe or sliding the probe across the tissue surface and may also include indentation of the tissue with the probe. In some embodiments, the actuator includes a Lorentz force linear actuator. The mechanical property may be determined using non-linear stochastic system identification. The mechanical property may be indicative of, for example, tissue compliance and tissue elasticity. The device can further include a handle for manual application of the probe to the surface of the tissue and may include an accelerometer detecting an orientation of the probe. The device can be used to test skin tissue of an animal, plant tissue, such as fruit and vegetables, or any other biological tissue. |
US09517028B1 |
Method and system to determine anaerobic threshold of a person non-invasively from freely performed exercise and to provide feedback on training intensity
A method and system for determining anaerobic threshold intensity (AnT) of a user in a freely performed physical exercise. A physiological response of a user is measured by heart rate and measured heart rate values are recorded as heart rate data. An external workload values are recorded and are each associated with one measured heart rate values to form a plurality of data points. The data points are filtered to form accepted data points, which are classified within a plurality of heart rate segments representing a heart rate within an anaerobic threshold (AnT) of the user. A data point with highest probability is stored for each segment. A first probability factor for each accepted data point is calculated. The calculated first probability factor is compared to a stored probability factor in each segment, and the higher probability factor is retained. AnT is calculated using the stored probabilities in each segment. |
US09517022B2 |
Finger biometric sensor including magnetic field finger biometric sensing pixels and related methods
A finger biometric sensor may include a substrate and an array of magnetic field finger biometric sensing pixels carried by the substrate. The finger biometric sensor may also include processing circuitry coupled to the array of magnetic field finger biometric sensing pixels and capable of generating a magnetic field extending into a finger positioned adjacent the array of magnetic field finger biometric sensing pixels to cause eddy currents in the finger. The processing circuitry may also be capable of sensing a counter magnetic field caused by the eddy currents representative of at least one finger biometric characteristic. |
US09517017B2 |
Reconstruction of cardiac activation information based on electrical and mechanical means
An anatomical mapping system includes a plurality of mapping electrodes, a plurality of mechanical sensors, and a mapping processor associated with the plurality of mapping electrodes and mechanical sensors. The mapping electrodes are configured to detect electrical activation signals of intrinsic physiological activity within an anatomical structure. The mechanical sensors are configured to detect mechanical activity associated with the intrinsic physiological activity. The mapping processor is configured to record the detected activation signals and associate one of the plurality of mapping electrodes and mechanical sensors with each recorded activation signal. The mapping processor is further configured to determine activation times of the intrinsic physiological activity based on a correlation of corresponding electrical activation signals and mechanical activity. |
US09517016B2 |
Object information acquiring apparatus and method of controlling the same
An object information acquiring apparatus includes a light irradiating unit that radiates light to an object to generate a photoacoustic wave, a transducer that receives the photoacoustic wave, outputs a photoacoustic signal, transmits and receives an ultrasound wave beam to and from the object, and outputs an ultrasound echo signal, a determining unit that determines whether there is an object on an optical path from the light irradiating unit, and an image processor that generates internal image data of the object using the photoacoustic signal. |
US09517014B2 |
OCT probe with pivoting fiber
An OCT probe for imaging patient tissue may include an actuation system arranged to displace an optical fiber within a cannula. The actuation system may include a driver actuatable to displace a portion of the optical fiber, with the driver acting in an angled direction relative to the axis of the cannula. The actuation system also may include a pivot feature operably engaged with the optical fiber in a manner permitting the optical fiber to pivot on the pivot feature when the driver actuates to displace the portion of the optical fiber. |
US09517007B2 |
Image processing apparatus, image processing method, and storage medium
An ophthalmic apparatus determines, based on information indicating a tilt of an object in a tomographic image, a direction in which luminance information of the tomographic image is to be combined. Then, the ophthalmic apparatus combines the luminance information of the tomographic image along the determined direction, thereby generating a plane image of the object. |
US09517002B2 |
Solid state image sensor, endoscope, and endoscope system
A solid state image sensor includes: a light receiving unit where a plurality of photoelectric conversion elements storing charges according to a received light amount are arrayed; a reading unit configured to read an imaging signal based on the charges stored by the light receiving unit; and a color filter. The color filter includes filter units where each the red, green, and blue filters arrayed in four rows and four columns. The filter units are arrayed in a lattice shape. The filter unit is partitioned into read units. Each read unit includes two filters where each transmits light of the same wavelength band are adjacent to each other in one direction. The reading unit is configured to collectively read charges stored by two photoelectric conversion elements corresponding to the read unit. |
US09517001B2 |
Capsule endoscope system
A capsule endoscope system includes: a capsule endoscope configured to be introduced into a subject; a guiding unit that generates a magnetic field to guide the capsule endoscope; a guidance magnetic field control unit that switches between ON and OFF of the magnetic field; a body posture discriminating unit that discriminates a body posture of the subject; a model extracting unit that extracts a body posture model according to the body posture of the subject, from among prepared body posture models, and extracts an organ model according to the body posture of the subject, from among prepared organ models; and a display control unit configured to: superimpose the organ model according to the body posture of the subject, on the extracted body posture model when the magnetic field is ON; and display the extracted body posture model and to hide the organ model when the magnetic field is OFF. |
US09516999B2 |
Endoscope apparatus and focus control method for endoscope apparatus
An endoscope apparatus includes an imaging section that includes a phase difference detection element for implementing phase detection autofocus, and acquires a captured image, a phase difference calculation section that calculates a phase difference based on a signal output from the phase difference detection element, a lens position selection section that selects a lens position that is either a near point-side lens position or a far point-side lens position based on the phase difference, the near point-side lens position and the far point-side lens position being discrete lens positions set in advance, and a driver section that changes a lens position of the imaging section to the lens position selected by the lens position selection section. |
US09516996B2 |
Medical robotic system providing computer generated auxiliary views of a camera instrument for controlling the position and orienting of its tip
A medical robotic system includes an entry guide with surgical tools and a camera extending out of its distal end. To supplement the view provided by an image captured by the camera, an auxiliary view including articulatable arms of the surgical tools and/or camera is generated from sensed or otherwise determined information about their positions and orientations and displayed on a display screen from the perspective of a specified viewing point. Intuitive control is provided to an operator with respect to the auxiliary view while the operator controls the positioning and orienting of the camera. |
US09516995B2 |
Surgical device for performing a sphenopalatine ganglion block procedure
Methods and devices to quickly and accurately locate the sphenopalatine ganglion (SPG) while performing a sphenopalatine ganglion block procedure that introduces a medication to the SPG. The methods and devices also prevent the medication applied to the SPG from flowing down a patient's throat during the procedure. |
US09516991B2 |
Removable dishwasher utensil basket that transforms into a utensil holder for a drawer
The invention relates to a new and improved dishwasher utensil basket which eliminates the need to empty the utensil basket or tray in a dishwasher, simply transforming that basket or tray into a drawer organizer and placing it into a drawer. This removable utensil basket saves time and effort and is more sanitary as it eliminates the need to touch each and every utensil. It is also inexpensive and simple to manufacture and easy to use. |
US09516990B2 |
Cutlery tray for a dishwasher
A cutlery tray for a dishwasher includes a frame extendably disposed in a washing tub and a plurality of inserts movably disposed on the frame and adapted to hold dishware. The plurality or inserts include a first horizontally displaceable insert and at least one vertically displaceable insert. |
US09516989B2 |
Dishwasher system with a reuse tank
A method of operating a dishwasher having a wash tub and a reuse tank for storing liquid for subsequent reuse, wherein the condition of the water in the reuse tank may be monitored and/or acted upon to limit the likelihood of undesired effects associated with the growth of micro-organisms in the liquid. |
US09516986B1 |
Flash steam generator
A steam generator for use within a portable steam generating system. The steam generator is composed of a heater coil looped around an inner casing in a helical pattern with a continuous gap left between successive loops. An outer casing encloses the inner casing and heater coil, creating a channel for fluid flow in the gap between successive loops of the heater coil and the inner and outer casings. An opening allows fluid to be pumped in one end of the channel and heated as it travels along the channel. The fluid is superheated by the heater coil loops and is converted into steam and expands upon depressurization after exiting the steam nozzle. This steam generator can be disposed within a handheld housing within a steam generating system. |
US09516982B2 |
Self-righting cleaning appliance
A self-righting cleaning appliance of the cylinder type comprises a separating apparatus for separating dirt from a dirt-bearing fluid flow, and a floor-engaging rolling assembly having a recess in which the separating apparatus is received. At least a portion of the separating apparatus is visible as a portion of the outer surface of the cleaning appliance when the separating apparatus is received in the recess, and the cleaning appliance is arranged so that it is urged to return to an upright position if it is tipped onto its side. |
US09516981B1 |
Vacuum hose nozzle attachment
A vacuum cleaner hose nozzle attachment formed from two separately molded body sections. The first body section includes spaced and parallel faces, generally triangular, front and rear walls interconnected by a top wall that curves over the apexes of the first and second walls and that connects ends of the front and rear walls. An attachment opening through the rear wall has an inlet to the second body section secured and sealed thereto. The inlet to the second body section comprises a peripheral edge forming a wide-mouthed opening fitted into and sealed to the attachment opening. A funnel wall extends rearward from the top center of the peripheral edge and normal to the rear wall and has a top center straight ridge continuing from the peripheral edge to a top center ridge of a tubular discharge end. |
US09516980B2 |
Vacuum cleaner
A vacuum cleaner blows hot air to dry objects to be cleaned and prevent adhesion of the objects. The vacuum cleaner includes a first bottom air inlet, a rear air outlet, a housing having an air passage for guiding first air from the first bottom air inlet to the rear air outlet, and an electric blower fan in the air passage to suck up the first air. The housing includes a headwind inlet that inhales second air from outside and guides its flow as a headwind against the flow of the first air preventing adhesion of objects to be cleaned. A bottom air outlet discharges hot air heated when passing by the electric blower fan. A flow direction changer changes the direction of the hot air to the rear and/or bottom air outlets. A user selectively controls the flow direction of the hot air toward the objects to be cleaned, thereby drying them. A headwind blows against the flow of air inhaled into the housing and prevents adhesion of the objects to be cleaned, thereby improving usability. |
US09516970B2 |
Apparatus for creating a consumable liquid food or beverage product from frozen contents
Techniques are provided for creating a consumable liquid food or beverage product from frozen contents. A container is configured for insertion into an apparatus. The container includes a frozen content, a receptacle defining an opening and a cavity for receiving and storing the frozen content, and a closure formed over the opening of the receptacle for sealing the frozen content within the cavity of the receptacle. The receptacle is perforable, and the container is configured for insertion into an apparatus that is configured to create a consumable liquid beverage from the frozen content within the container, such that the frozen content is extracted through a perforation created in the receptacle by the apparatus. |
US09516965B2 |
Hosiery donning device
Devices and methods to assist a user in donning hosiery are provided. The device comprises an elongated flexible blade extending between a distal end and a proximal end, the blade configured to contact at least a portion of a user's foot, the blade having a textured inner surface configured to face towards the user's lower leg, and an smooth opposing outer surface relative to the textured inner surface. |
US09516964B2 |
Reusable drinking bottle lid with counter
The application discloses and claims a beverage container lid that tracks the amount of fluid consumed. The lid has a standard drinking nozzle and engagement means which includes a gasket or standard threading that sealably fit commercially available beverage containers and water bottles. The exterior of the lid has a reset button and a display window through which a display readout is visible that displays the amount of fluid consumed. The lid houses the display, a CPU, battery, sensors and internal housing through which the water flows. The internal housing has a water wheel inside of it with curved blades that are turned by the beverage as it flows out of the lid. Magnets are affixed to one or more of the blades. The CPU tracks the number of times the magnets pass the sensors and translates it into the amount of fluid consumed, which is shown on the display. |
US09516962B2 |
Butter dish with rotatable lid
A butter dish having a rotatable lid that opens to an obtuse angle to give wide access to butter stored on a base cover by the lid. The butter dish includes the base, a rear wall defining a rotational axis located above the base and toward the rear of the base and the lid is mounted to the rear wall and rotates between closed and opened positions. |
US09516961B1 |
Container with personalization system
The present invention provides a container including a system for personal identification. A series of bands are mounted between ridges formed circumferentially around the container. The bands have symbols printed in a color similar to the container. The bands can be rotated around the container to position selected symbols over a patch printed on the container in a contrasting color to make the selected symbol visible. |
US09516959B2 |
Health pillow
The present invention relates to a pillow, which aids a user to sleep soundly when the user is lying on the back, and makes breathing easier and helps stimulate the acupuncture points on the face when the user is lying on the stomach and rests the face on the pillow. To this end, the present invention comprises: a main body; a neck support part, which is formed in the longitudinal direction at the front side of the main body and has a height higher than the height of the main body; a ventilation hole, which penetrates the center of the neck support part into the center of the main body; an incline support part, which is provided on the main body in contact with the ventilation hole, and has a gradual decline towards the ventilation hole; and an acupuncture point stimulation part provided in a protruding manner on the ventilation hole side of the neck support part. The pillow of the present invention aids the user to sleep soundly by forming the ventilation hole at the head resting area, which allows for easy ventilation, ensuring the head to stay cool when the user is lying on the back. |
US09516958B1 |
Adjustable food shield
A food shield has shield panels that are location adjustable and angularly adjustable in respect of support structures (posts) that are coupled to a mounting surface, such as a surface of a buffet table or cart. For vertical or location adjustment of a shield panel in relation to a post, a bracket assembly includes outer and inner collar portions, a grip element positioned between the outer and inner collar portions, and a tightening element that tightens the connection of the assembled collar against support posts. For angular adjustment, each bracket assembly includes an indexing base, a rotatable arm assembly with an indexing hub, and a removable or retractable coupling element. Alternative bracket assemblies provide support elements that contact one face of the shield panel, in addition to having clamps that engage the shield panel at or near each of the front and rear panel edges. |
US09516956B2 |
Refrigerator and method for controlling the same
Provided is a refrigerator, which includes a refrigerating compartment, a freezing compartment, and a door assembly. The freezing compartment is adjacent to the refrigerating compartment. The door assembly selectively opens the refrigerating compartment and the freezing compartment. The door assembly includes a glass member defining a frontal exterior thereof and allowing an inside of the refrigerating compartment or the freezing compartment to be seen therethrough when the door assembly is closed, a deposition treated layer formed on a rear surface of the glass member to allow light to partially pass through the glass member, and a transparent plate spaced a predetermined distance from the glass member. Gas for insulation is injected in a space formed between the glass member and the transparent plate, and the space is sealed. |
US09516955B2 |
Refrigerator and method for controlling the same
Provided is a refrigerator, which includes a refrigerating compartment, a freezing compartment, and a door assembly. The freezing compartment is adjacent to the refrigerating compartment. The door assembly selectively opens the refrigerating compartment and the freezing compartment. The door assembly includes a glass member defining a frontal exterior thereof and allowing an inside of the refrigerating compartment or the freezing compartment to be seen therethrough when the door assembly is closed, a deposition treated layer formed on a rear surface of the glass member to allow light to partially pass through the glass member, and a transparent plate spaced a predetermined distance from the glass member. Gas for insulation is injected in a space formed between the glass member and the transparent plate, and the space is sealed. |
US09516953B1 |
Stand system for suspending a baby car seat on baby car seat sling
A stand system suspends a baby car seat on baby car seat sling in which the baby car seat may pivot freely in any direction. A mounting plate elevated above the floor by three elongated leg supports attaches to the baby car seat sling harnessing a baby car seat is used as a platform for holding the suspended baby car seat in a laying position located below the mounting plate above the floor. Each elongated leg equal in length comprise 5 dowel sections. A three-way brace across the bottom of the elongated legs interconnects the elongated leg's foot-end to a center point. The disclosed stand system which is the product invention may be easily assembled by hand for product use and disassembled for compact storage and ease of transportation. |
US09516952B2 |
Mattress bucket retention mechanism
A mattress bucket retention mechanism and device for securing a mattress on an automated bed is provided. Embodiments of the invention relate to an integrated mattress bucket retention mechanism for an adjustable bed. In one embodiment, the mattress bucket retention mechanism secures a mattress against articulating deckboard panels of an adjustable bed. In other embodiments, the mattress bucket retention mechanism provides a replaceable top surface for covering a mattress. Further, the mattress bucket retention mechanism may serve as a protective surround for the mattress. Embodiments of the mattress bucket retention mechanism include a deckboard having a deckboard edge, a mattress wrap having side panels and a top panel, and a zipper closure mechanism, which are used to create an interior compartment for securing a mattress. |
US09516948B2 |
Touch-latch device for opening and holding a furniture opening component in a closed position
A touch-latch device used in furniture especially for initial opening of an opening furniture component, comprising a housing with an axially arranged groove, in which a push element is slidingly arranged, said element being actuated by a helical spring and controllable by a dual-position guide mechanism comprising a cam groove guide and an S-pin, wherein the device comprises a push element controlled by two dual-position guide mechanisms, wherein each cam groove guide of a dual-position guide mechanism is arranged on a lateral side of the push element and the S-pin is pivoted in the lateral wall of the groove of the housing, and that the push element is provided at its free end with a regulation plug arranged by means of a bolted joint, said plug being displaceable in axial direction, wherein the axial displacement of the regulation plug is limited by an arrester arranged therein. |
US09516946B1 |
Freestanding desktop storage unit for support of a privacy panel
A desktop storage cabinet adapted to sit on a desktop and support a privacy panel. The storage cabinet includes an integrated horizontal slide pocket along its back open at least a first end of the storage element and adapted to receive and support a privacy panel which extends from within the slide pocket outwardly beyond the pocket. |
US09516944B2 |
Sterilizable platform with configurable frame and method of constructing
A free standing self sterilizable device and method of construction by connecting together a plurality of connected individual modular components. The individual modular components are provided in such manner to enable multiple configurations in frame structure shape when assembled. The device is self sterilizing by its material composition, its open smooth surface and its downward or horizontal slanting surfaces. The device herein is intended for use in the food or medical industry. |
US09516943B2 |
Laundry transfer apparatus
A laundry transfer apparatus comprising a frame within which is disposed a transfer conduit that traverses a distance between the openings of a washing machine and dryer. A plurality of upper extensions are provided to enable the apparatus to rest on the top surfaces of the washing machine and dryer and to vertically suspend the apparatus so that the conduit is appropriately positioned for each use. The conduit preferably comprises a substantially planar surface formed by individual table sections that fold out to form the conduit when the laundry transfer apparatus is in use. The conduit is slidably engaged to the frame via a railing. When use of the laundry transfer apparatus is complete, the individual sections are folded upright and pushed into a retracted position for later use. |
US09516941B1 |
Multipurpose wearable and collapsible holder
A collapsible holder has a front panel, a rear panel, a bottom panel, and two or more arms extending from the rear panel to the front panel. One or more apertures extend through the rear panel for attachment of a neck strap. The front panel, the rear panel, and the bottom panel are formed from a single piece of material, such that the rear panel and the front panel are hingedly connected to, and extend upward from, opposite ends of the bottom panel. The arms may be pivotably connected to the connectors. Additionally, a spring may be incorporated to bias the bottom panel toward the rear panel. The biasing of the bottom panel to the rear panel, combined with the hinged nature of the panels and the pivoting arms, creates lateral compression between the front panel and the rear panel. An accessory compartment may also extend from the rear panel. |
US09516935B2 |
Shoe bag
A shoe bag for transporting a pair of shoes comprising two individual compartments. The compartments are detachable from one another and include an interior protective lining. Each detachable compartment has its own opening that can be opened or closed independently from the opening for the other compartment. The detachable compartments allow more efficient packing of the shoes within the luggage's interior and also protect the shoes from each other and also prevents the shoes from soiling items packed in the luggage. |
US09516933B2 |
Shock absorber cane systems
A cane system having an adjustable shock absorber, a multi-angle handle, a straight handle, and a knob. |
US09516930B2 |
Freshening rings
A wearable freshening ring assembly comprises a fixed or flexible ring shank portion, integrally or mechanically connected to a personal care product receptacle, which is mechanically or frictionally connected to a personal care product capsule and a protective cap element. The ring shank portion is sized to fit a wearer's finger or is adjustable to fit a wearer's finger. The ring is made from formable materials such as jewelry grade metals and costume jewelry grade materials selected from non-precious metals, thermo-formable plastic resins, ceramics, leather, rubber, and flexible plastics, and include in their construction fabrics, woven materials and the like. |
US09516929B1 |
Fastening structure of jewellery
A fastening structure of jewelry has a chain, and a locking seat and a locking assembly respectively mounted on two ends of the chain. The locking seat has an insertion recess with two stop protrusions. The locking assembly has a V-shaped resilient locking element and a resilient supporting element. The resilient locking element has a connecting end and a locking end with a pressing protrusion. The resilient supporting element is mounted between the connecting end and the pressing protrusion. The fastening structure has a simplified structure and compact size. Moreover, when the resilient locking element is inserted into the insertion recess of the locking seat, an end edge on the locking end of the resilient locking element securely abuts against the stop protrusions of the locking seat. Accordingly, the jewelry with the fastening structure does not drop off and does not get lost. |
US09516928B2 |
Watch strap strip
The invention relates to a watch strap strip (1) reinforcement (2) intended to be housed in a casing (3) of the strip made from a flexible material, wherein the reinforcement includes a linking element (4) mechanically connecting: an element (10) for fixing the strip to the watch case to an element (9) for fixing the strip to a closure element. |
US09516926B2 |
Fixturing apparatus
A fixturing apparatus that includes a planar member having a first end, a second end, a front surface, and a rear surface, wherein the planar member is formed to include an aperture extending therethrough, a handle attached to the front surface adjacent the second end and extending outwardly therefrom, and a plurality of locking teeth disposed on the rear surface adjacent the second end. |
US09516924B2 |
Fastening arrangement with interlocking members
A fastening arrangement comprises a first fastening member connected to a first strap and a second fastening member connected to a second strap. The first fastening member includes a first surface comprising at least one first interlocking member. The second fastening member includes a channel positioned between a second surface and a biasing member. The channel is configured to receive the first fastening member with the first surface facing the second surface. The second surface includes at least one second interlocking member configured to engage the first interlocking member in a manner that blocks the first interlocking member from moving relative to the second interlocking member in at least one direction. The biasing member is configured to urge the first interlocking member into engagement with the second interlocking member when the first fastening member is inserted into the channel of the second fastening member. |
US09516921B2 |
Method for manufacturing inflatable footwear or bladders for use in inflatable articles
The present invention is a method for manufacturing inflatable articles, or bladders for inflatable articles, that is time-efficient, simple, inexpensive and permits the uninterrupted manufacture of numerous and even customized article or bladder configurations and sizes, without expensive configuration-specific, metal tooling. The method includes the steps of applying a barrier material to a side of a first film, providing a second film with the first film so that the barrier material is disposed between the first and second films, adhering the first film to the second film so that the films are sealed together in areas except where the barrier material has been applied to form at least one inflatable compartment and sealed peripheral edge, and cutting along the sealed peripheral edge to form an inflatable article or bladder for use in an article of manufacture. The barrier material may be a paint, ink, paper or surface treatment that effectively prevents the first film from adhering to the second. The inflatable article or bladder of the present invention may be used as or in athletic equipment, for example, including footwear. |
US09516919B2 |
Sole structure with bladder for article of footwear and method of manufacturing the same
A method of manufacturing a sole structure includes providing a plate within a cavity of a mold. The plate includes a base and a rib, and the base includes a first surface and a second surface. The first surface faces the upper, the second surface faces away from the first surface, and the rib projects from the second surface of the base. Moreover, the method includes providing a preform bladder member within the cavity of the mold, wherein the preform bladder member including a first member and a second member. The method additionally includes forming a bladder from the first and second members using the mold. Also, the method includes attaching the first member to the plate using the mold. Attaching the first member to the plate includes shaping the first member according to surfaces of the rib. |
US09516918B2 |
Sole system having movable protruding members
An article of footwear with a sole system includes a sole member and a protruding member assembly. The sole system provides tactile sensation. Protruding members of the protruding member assembly can translate through holes in the sole member to facilitate tactile sensation. |
US09516910B2 |
Helmet impact liner system
The present application discloses an impact liner system for a helmet. In one embodiment, the impact liner system comprises an impact liner configured to be installed in the interior of a helmet shell to at least partially line the front, rear, and middle portions of the helmet shell. The impact liner comprises a plurality of impact pads and forms a plurality of air channels between the impact pads when the impact liner is installed in the helmet shell. In certain embodiments, at least one insert is disposed within one or more of the plurality of air channels. The insert generally comprises a body portion having a top and vertical side walls configured to prohibit at least a portion of the air channel from collapsing when the helmet shell is installed on a user's head. |
US09516909B2 |
Biomechanics aware helmet
Protective gear includes an outer shell layer connected to a middle shell layer through an outer energy and impact transformer layer. The middle shell layer is connected to an inner shell layer through an inner energy and impact transformer layer. The outer and inner energy and impact transformer layers flexibly connect the shell layers to absorb impact forces, rotational forces, shear forces, etc., and allow the various shell layers to move and slide relative to the other shell layers. The outer and inner energy and impact transformer layers may be constructed using gels, fluids, electro-rheological elements, magneto-rheological elements, etc. The protective gear may be formed as helmets or body protection for various activities and protect users from not only impact and penetrative forces, but rotational and shear forces as well. |
US09516907B2 |
Solar-assisted garment
A solar-assisted garment is described, which includes a garment body having a rear surface panel, front surface panel and interior surface between the panels, a solar panel on the front surface panel, a heating element in electrical communication with the solar panel and a rechargeable battery so that as the solar panel generates electrical current the heating element generates heat within the interior surface, the rechargeable battery in electrical communication with the solar panel for storing energy from the solar panel, and to provide electric current to the heating element. The garment further includes a USB device for charging the battery using one or more of a laptop, PC, or AC charger adaptor to an AC mains, and a DC charging adapter plug adjacent the USB device for permitting charging of the battery via connection to a secondary DC/DC universal adapter that in turn is connected to a DC power source. |
US09516905B2 |
Bra
A brassiere includes an elastic band, a pair of cups (and a pair of elongated flexible support elements configured to come at least partly into contact with the shoulders of the user. Each of the cups includes an outer surface and an inner surface made of a first textile material which includes a plurality of first inserts in a first flexible polymeric material having a coefficient of friction with the skin greater than the first textile material. |
US09516896B2 |
Disintegratable plug wraps and their applications
A filter rod used in manufacture of a smoking article contains: (a) a rod of filter material, and (b) a plug wrap surrounding the rod of filter material. The overlapping side edges of the plug wrap are secured together with a plug wrap adhesive and the plug wrap adhesive comprises a disintegration accelerating agent. Alternatively or in addition, the plug wrap may contain perforations. |
US09516892B2 |
Use in ruminants of a food additive including a sweetener
The invention concerns the use of a food additive including a sweetener in the feed or the drink of a ruminant animal to reduce the impact of stressful conditions on intestinal mucosa quality. |
US09516889B2 |
Automated cleaning system for food processor and method
A self-contained system is provided for cleaning a food flow path in a food processor. The system can be operably engaged without requiring disassembly and reassembly of the food processor or can be operably engaged after a partial disassembly of the food processor. The system includes a control assembly for directing passage of a solution through the food processor without requiring constant operator oversight. The system can employ available positive pressure water supply, such as public utility water pressure to selectively and automatically push solutions, including rinses, backwards or forwards through a food flow path in the food processor, though typically countercurrent to the normal processing food flow. A manifold assembly includes an intake manifold and a distribution manifold, with an induction port and/or access port in the distribution manifold for introducing additives or agents into a controlled motive stream passing through the manifold assembly. |
US09516882B2 |
Cosmetic formulation
The present invention relates generally to nail polish formulations for application to natural or artificial finger- or toenails, where the nail polish formulation comprises grapefruit seed extract that imparts antifungal and other antimicrobial properties. |
US09516881B2 |
Copper-and-titanium-containing composition and production method therefor
The Cu- and Ti-containing composition of the present invention contains titanium oxide having a rutile-type titanium oxide content of 15 mol % or more, and at least one divalent copper compound represented by the following formula (1). The Cu- and Ti-containing composition production method of the present invention is characterized by including stirring a mixture containing titanium oxide having a rutile-type titanium oxide content of 15 mol % or more, a divalent copper compound raw material represented by formula (2), water, and an alkaline compound, to thereby cause precipitation. The composition of the present invention exhibits excellent anti-viral property under light and in the dark, and excellent organic compound decomposition activity under light. |
US09516880B2 |
Herbicidal and fungicidal 5-oxy-substituted 3-phenylisoxazoline-5-carboxamides and 5-oxy-substituted 3-phenylisoxazoline-5-thioamides
Herbicidally and fungicidally active 5-oxy-substituted 3-phenylisoxazoline-5-carboxamides and 5-oxy-substituted 3-phenylisoxazoline-5-thioamides of the formula (I) are described. In this formula (I), X, X2 to X6, R1 to R4 are radicals such as hydrogen, halogen and organic radicals such as substituted alkyl. A is a bond or a divalent unit. Y is a chalcogen. |
US09516871B1 |
Floating or sinking live bait container
A live bait container having at least one air chamber to provide buoyancy. It floats upright when stationary, and it floats on its back side when trolling. There is a strategically placed opening through the back or side wall of the air chamber to selectively allow air or water to enter and be trapped within the chamber. During fishing, air will remain trapped inside of the air chamber; however, when the user wants to store the container below the surface, air can be allowed to escape through the opening in the chamber by simply pushing the container below the water surface with its back side up. Air will escape the chamber to allow the container to submerge. To regain buoyancy, the user removes the container from the water and places it in a generally upright position, and the water will run out as air enters through the air chamber opening. |
US09516868B2 |
Mice that make VL binding proteins
Genetically modified mice and methods for making an using them are provided, wherein the mice comprise a replacement of all or substantially all immunoglobulin heavy chain V gene segments, D gene segments, and J gene segments with at least one light chain V gene segment and at least one light chain J gene segment. Mice that make binding proteins that comprise a light chain variable domain operably linked to a heavy chain constant region are provided. Binding proteins that contain an immunoglobulin light chain variable domain, including a somatically hypermutated light chain variable domain, fused with a heavy chain constant region, are provided. Modified cells, embryos, and mice that encode sequences for making the binding proteins are provided. |
US09516865B2 |
Method and system for enhancing growth and survivability of aquatic organisms
A method for enhancing the production of aquatic organisms under cultivation, including the steps of exposing the aquatic organisms to a submerged illumination source inside water of a rearing unit; and maintaining illumination in the rearing unit for a rearing period. |
US09516859B2 |
Bowl with anti-slip material
An anti-slip bowl is described herein. A bowl can include a rigid first shell including a base and an outer wall continuously attached to the base, a rigid second shell including a base and an outer wall continuously attached to the base, wherein the base of the rigid second shell includes a number of non-continuous openings, and an anti-slip material positioned between a lower side of the base of the rigid first shell and an upper side of the base of the rigid second shell. |
US09516854B2 |
Vision system for facilitating the automated application of disinfectant to the teats of dairy livestock
A method for determining a spray position for a spray tool includes accessing an image signal generated by a camera, the image signal corresponding to at least an udder of a dairy livestock. The method further includes processing the accessed image signal to determine a tangent to the rear and a tangent to the bottom of the udder of the dairy livestock. The method concludes by determining a spray position from which a spray tool may apply disinfectant to the teats of the dairy livestock, wherein the spray position is a position relative to the intersection of the two tangents. |
US09516851B2 |
Onion variety NUN 03010 ON
The invention relates to the field of Allium in particular to a new variety of Allium cepa L. designated NUN 3010 ON plants, seeds and bulbs thereof as well as plant breeding methods involving NUN 3010 ON. |
US09516846B1 |
Soybean variety XBP29008
A novel soybean variety, designated XBP29008 is provided. Also provided are the seeds of soybean variety XBP29008, cells from soybean variety XBP29008, plants of soybean XBP29008, and plant parts of soybean variety XBP29008. Methods provided include producing a soybean plant by crossing soybean variety XBP29008 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety XBP29008, methods for producing other soybean varieties or plant parts derived from soybean variety XBP29008, and methods of characterizing soybean variety XBP29008. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety XBP29008 are further provided. |
US09516844B2 |
Plants and seeds of sorghum variety GSV469392
The invention relates to the sorghum variety designated GSV469392. Provided by the invention are the seeds, plants and derivatives of the sorghum variety GSV469392. Also provided by the invention are tissue cultures of the sorghum variety GSV469392 and the plants regenerated therefrom. Still further provided by the invention are methods for producing sorghum plants by crossing the sorghum variety GSV469392 with itself or another sorghum variety and plants produced by such methods. |
US09516841B2 |
Soybean variety XB19S14
A novel soybean variety, designated XB19S14 is provided. Also provided are the seeds of soybean variety XB19S14, cells from soybean variety XB19S14, plants of soybean XB19S14, and plant parts of soybean variety XB19S14. Methods provided include producing a soybean plant by crossing soybean variety XB19S14 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety XB19S14, methods for producing other soybean varieties or plant parts derived from soybean variety XB19S14, and methods of characterizing soybean variety XB19S14. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety XB19S14 are further provided. |
US09516836B1 |
Maize hybrid X03F656
A novel maize variety designated X03F656 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X03F656 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X03F656 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X03F656, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X03F656. This invention further relates to methods for producing maize varieties derived from maize variety X03F656. |
US09516829B1 |
Maize hybrid X90D300
A novel maize variety designated X90D300 and seed, plants and plant parts thereof, produced by crossing Pioneer Hi-Bred International, Inc. proprietary inbred maize varieties. Methods for producing a maize plant that comprises crossing hybrid maize variety X90D300 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X90D300 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X90D300, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X90D300. This invention further relates to methods for producing maize varieties derived from maize variety X90D300. |
US09516827B2 |
Melon variety NUN 21267 MEM
The invention relates to the field of Cucumis melo, in particular to a new variety of melon designated NUN 21267 MEM as well as plants, seeds and melon fruits thereof. |
US09516825B2 |
Onion variety NUN 08003 ON
The invention relates to the field of Allium in particular to a new variety of onion. designated NUN 08003 ON as well as plants, seeds and bulbs thereof. |
US09516824B2 |
Method for modulating the number of archesporial cells in a developing anther
Certain embodiments provide a method of altering the number of archesporial cells in a developing anther of a plant in certain embodiments, the method comprises exposing the anther to redox-modulatory conditions prior to differentiation of germline cells in the anther, thereby changing the redox potential of cells in the anther and altering the number of archesporial cells in the anther. This method may be employed to increase or decrease the number of archesporial cells in a developing anther, and may be employed to produce male sterile plants. |
US09516817B2 |
Grain-moving arrangement for an agricultural combine
A grain-moving arrangement is disclosed for agricultural combines. An elevator is configured to move grain in a first direction along an elevator path, within an elevator housing, and to receive grain from a first auger at a first location on the elevator path. A grain-moving device is configured to receive power from the elevator in order to move grain received from a second auger in a second direction along a device path, within a device housing, to an outlet of the device housing. Grain moved along the device path to the outlet of the device housing passes through the outlet of the device housing to a second location on the elevator path that is upstream of the first location on the elevator path, with respect to the first direction. |
US09516811B1 |
Combine harvester grain bulk tank unloading system
A combine harvester grain bulk tank and grain unloading system includes opposed bulk tank augers and an unloading auger formed in a grain bulk tank of a combine harvester. The bulk tank augers are for receiving and conveying grain through the bulk tank to the unloading auger, and the unloading auger is for receiving grain from the bulk tank augers and conveying grain to a grain unloading spout for grain unloading. A primary drive gear is coupled to the unloading auger and to an input, a secondary drive gear is drivingly coupled to the bulk tank augers, and a clutch is coupled between the primary drive gear and the secondary drive gear, which is movable between an engaged position for transferring power from the input to the unloading auger and to the bulk tank augers, and a disengaged position for isolating the bulk tank augers from the primary drive gear. |
US09516808B2 |
Grass mower
The grass mower includes a front wheel unit having a left front wheel and a right front wheel which are mounted to a vehicle body frame, a rear wheel unit having a left rear wheel and a right rear wheel which are mounted to the vehicle body frame and a mower unit disposed between the front wheel unit and the rear wheel unit downwardly of the vehicle body frame, the mower unit including a rotary blade unit that has at least a left blade and a right blade which are disposed side by side in a vehicle body left/right direction. The rotary blade unit is configured such that a tread-on track of the left front wheel is overlapped with a rotation locus portion of the left blade from the front side to the rear side thereof and a tread-on track of the right front wheel is overlapped with a rotation locus portion of the right blade from the front side to the rear side thereof. |
US09516802B2 |
System and method for controlling an agricultural system based on soil analysis
An agricultural system includes an agricultural soil analyzer positioned forward of a ground engaging tool relative to a direction of travel of the agricultural system. The agricultural soil analyzer is configured to output a first signal indicative of a parameter of soil forward of the soil conditioner relative to the direction of travel. The agricultural system also includes a controller communicatively coupled to the agricultural soil analyzer. The controller is configured to receive the first signal from the agricultural soil analyzer. Furthermore, the controller is configured to determine a target parameter of the agricultural system based on the first signal and to output a second signal indicative of the target parameter. |
US09516796B2 |
Agricultural tillage implement wheel control
An agricultural tillage implement includes a main section including a hitch extending in a travel direction, a plurality of foldable wing sections coupled with the main section, a plurality of ground engaging tilling elements, a plurality of wheel assemblies and a control system. The tilling elements are coupled to the main section and wing sections. Each of the wheel assemblies include an actuator. The wheel assemblies include a first plurality of wheel assemblies associated with the main section and a second plurality of wheel assemblies associated with the plurality of wing sections. The actuators of the first plurality of wheel assemblies being independent of the actuators of the second plurality of wheel assemblies. The control system is configured to actuate the actuators to control a depth of tilling elements in each of the sections when the implement is in a field mode. |