Document | Document Title |
---|---|
US09896692B2 |
Sugarcane bacilliform viral enhancer-based activation tagging platform for maize, and resultant tagged populations and plants
An activation tagging construct for maize that includes one or more sugarcane bacilliform viral (SCBV) enhancer elements, and resulting tagged populations and plants, are described. In one example, an activation tagging DNA construct includes a coding sequence for a transposase, a detectable reporter (such as anthocyanin regulatory genes B-Peru and C1) and a non-autonomous transposable T-DNA cassette. For example, the transposable T-DNA cassette is inserted into the detectable reporter encoding region such that the B-Peru and C1 genes express anthocyanins in a cell containing the maize activation tagging DNA construct only upon excision of the transposable cassette. Methods of generating a tagged population of maize plants include transforming a maize plant cell or tissue with the disclosed constructs. |
US09896691B2 |
Compositions and methods for lipid production
Described herein, inter alia, are compositions, oleagnious organisms, and methods useful for producing lipids, lipid precursors, and/or oleochemicals. |
US09896690B2 |
Notch 1 specific siRNA molecule
The present invention is related to a nucleic acid molecule comprising a double-stranded structure, wherein the double-stranded structure is formed by a first strand and a second strand, wherein the first strand consist of the following nucleotide sequence 5′ acGaGcUgGaCcAcUgGuCdTsdT 3′, and the second strand consists of the following nucleotide sequence 5′ GAcCaGuGgUcCaGcUcGudTsdT 3′, wherein a minor nucleotide indicates that the nucleotide is 2′-F modified and an underlined nucleotide indicates that the nucleotide is 2′-O-methyl modified and wherein dTsdT indicates that at the 3′ end a dinucleotide is attached consisting of two dT nucleotides, wherein said two dTs are covalently linked through a phosphorothioate bond. |
US09896683B2 |
Isolating circulating microRNA (miRNA)
Methods for isolating circulating small RNAs, e.g., microRNA (miRNA), from plasma samples, e.g., that comprise using an alkaline phenol:chloroform extraction, and methods of use thereof, including for the detection, prognosis, and/or monitoring of disease in a subject. |
US09896681B2 |
Genetic regulation of bone and cells by electromagnetic stimulation fields and uses thereof
The present invention provides methods to modify the genetic regulation of mammalian tissue, bone, cells or any combination thereof by preferential activation, up-regulation and/or down-regulation. The method comprises steps of tuning the predetermined profiles of one or more time-varying stimulation fields by manipulating the B-Field magnitude, rising slew rate, rise time, falling slew rate, fall time, frequency, wavelength, and duty cycle, and exposing mammalian cells or tissues to one or more tuned time-varying stimulation fields with predetermined profiles. Examples of mammalian cells or tissues are chondrocytes, osteoblasts, osteocytes, osteoclasts, nucleus pulposus, associated tissue, or any combination. The resulted modification on gene regulation of these cells, tissues or bones may promote the retention, repair of and reduction of compromised mammalian cartilage, bone, and associated tissue. |
US09896675B2 |
Hyperthermostable endoglucanase
A hyperthermostable endoglucanase, having an endoglucanase catalytic domain including: (A) a polypeptide including the amino acid sequence represented by SEQ ID NO: 1 or 2, (B) a polypeptide including an amino acid sequence in which at least one amino acid has been deleted, substituted, or added in the amino acid sequence represented by SEQ ID NO: 1 or 2, and having hydrolysis activity against a substrate of carboxymethyl cellulose at least under conditions of 90° C. and pH 5.5, or (C) a polypeptide including an amino acid sequence having 80% or greater sequence identity with the amino acid sequence represented by SEQ ID NO: 1 or 2, and having hydrolysis activity against a substrate of carboxymethyl cellulose at least under conditions of 90° C. and pH 5.5. |
US09896673B2 |
Compositions of high stability alpha amylase variants
The present invention relates to variants of an alpha-amylase having improved stability to chelating agents relative to its parent enzyme, compositions comprising the variants, nucleic acids encoding the variants, methods of producing the variants, and methods for using the variants. |
US09896672B2 |
Composition and formulation comprising recombinant human iduronate-2-sulfatase and preparation method thereof
A composition comprising recombinant iduronate-2-sulfatase (IDS) and a method for producing a purified recombinant IDS are provided. The glycosylation pattern and formylglycine content of the IDS composition are different from those of ELAPRASE® and have superior pharmaceutical efficacy and are safer than the conventional agent and thus can be effectively used for the therapy of Hunter syndrome. |
US09896669B2 |
DNA polymerases with increased 3′-mismatch discrimination
Disclosed are mutant DNA polymerases having increased 3′-mismatch discrimination relative to a corresponding, unmodified polymerase. The mutant polymerases are useful in a variety of disclosed primer extension methods. Also disclosed are related compositions, including recombinant nucleic acids, vectors, and host cells, which are useful, e.g., for production of the mutant DNA polymerases. |
US09896668B2 |
Substrate-mimetic AKT inhibitor
Disclosed herein is a species of peptide and non-peptide inhibitors of Akt, an oncogenic protein. Beginning with a residue of Akt target substrate GSK-3, the functional domains of the GSK-3 residue were characterized. Functionally homologous non-peptide groups were substituted for the amino acids of the GSK-3 creating a hybrid peptide-non-peptide and non-peptide compounds capable of binding to Akt. The non-peptide compounds show increased stability and rigidity compared to peptide counterparts and are less susceptible to degradation. The bound non-peptide compounds exhibit an inhibitory effect on Akt, similar to peptide-based Akt inhibitors. |
US09896663B2 |
Leukaemia stem cell line, its method of production and uses thereof
Bromodomain and extra terminal protein (BET) resistant leukemic cell lines and methods for producing such cell lines are described as are methods for using such cell lines in screening assays to identify therapeutic agents. The cell lines can be generated from haematopoietic stem and progenitor cells (HSPCs) that are clonally enriched by serially exposing c-kit positive cells to a BET inhibitor. |
US09896660B2 |
Production of red blood cells and platelets from stem cells
This disclosure provides methods of making a megakaryocyte-erythroid progenitor cell (MEP), comprising differentiating a MEP precursor cell into a MEP in culture in the presence of an aryl hydrocarbon receptor (AhR) modulator. In some embodiments the AhR modulator is an AhR antagonist. In some embodiments the AhR modulator is an AhR agonist. In some embodiments the methods comprise culturing MEP precursor cells in the presence of an AHR antagonist and then culturing MEP precursor cells in the presence of an AHR agonist. In some embodiments the stem cell is a pluripotent stem cell. In some embodiments the MEP co-expresses CD41 and CD235. In some embodiments the number of MEPs produced in the culture increases exponentially. Methods of making a red blood cell (RBC) by culturing a MEP in the presence of an AhR modulator are also provided. Methods of making a megakaryocyte and/or a platelet, comprising culturing a MEP in the presence of an AhR modulator are also provided. In some embodiments the AhR modulator is an AhR antagonist. This disclosure also provides compositions comprising at least 1 million MEPs per ml and compositions in which at least 50% of the cells are MEPs, among other things. |
US09896647B2 |
Automatic dishwashing detergent with synergistic scale inhibition
Described are automatic dishwashing detergents, comprising a builder, a surfactant, a polymer having sulfonic acid moieties, and a polymer having chelating moieties, wherein the polymer having chelating moieties comprises units derived from at least one carboxylic acid monomer, their salts or esters, an aminocarboxylate selected from iminodiacetic acid (IDA) and ethylenediamine triacetic acid (ED3A), and at least one glycidyl monomer selected from AGE, GA, GMA. |
US09896645B2 |
Personal care compositions
Aerosolized compositions including a cyclic oligosaccharide; a fragrance; a volatile solvent; and a propellant; wherein the aerosolized composition is free of nonvolatile solvents are described herein. The aerosolized compositions and methods disclosed herein may provide a longer lasting fragrance. |
US09896641B2 |
Conveyor lubricants including emulsions and methods employing them
The present disclosure relates to conveyor lubricant compositions including an emulsion. The present disclosure also relates to methods of employing such lubricant compositions. In an embodiment, the methods include applying the present lubricant composition to a conveyor with a non-energized nozzle. In an embodiment, the methods include applying the present lubricant composition in a “semi-dry” mode. |
US09896637B2 |
Sliding member, method of manufacturing sliding member, and gear
In a method of manufacturing a sliding member including a polyamide resin and a filler, a compound having a carbodiimide bond is supplied during kneading of the polyamide resin and the filler. |
US09896635B2 |
Method of enhancing the dry grinding efficiency of petcoke
In a method of enhancing the dry grinding efficiency of petcoke including adding additives to the petcoke and dry grinding the petcoke together with the additives. The additives may include a combination of at least one organic additive and at least one inorganic additive. |
US09896634B2 |
Method for preventing or reducing engine knock and pre-ignition
A method for preventing or reducing engine knock or pre-ignition in an engine lubricated with a lubricating oil by using as the lubricating oil a formulated oil. The formulated oil has a composition comprising at least one ester of a non-aromatic dicarboxylic acid. The at least one ester of a non-aromatic dicarboxylic acid preferably comprises at least one adipate ester (e.g., dialkyl adipate ester). A lubricating engine oil having a composition comprising at least one ester of a non-aromatic dicarboxylic acid (e.g., adipate ester). A fuel additive composition for use in a gasoline fuel composition or a diesel fuel composition. The gasoline fuel composition or the diesel fuel composition is used in a spark ignition internal combustion engine. The fuel additive composition comprises at least one ester of a non-aromatic dicarboxylic acid (e.g., adipate ester). The lubricating oils of this disclosure are particularly advantageous as passenger vehicle engine oil products. |
US09896630B2 |
Process for hydroconverting oil feeds in fixed beds for the production of low sulphur fuels
A process for the conversion of oil feeds for the production of low sulphur fuels by fixed bed hydrodemetallization of the feed using an upstream system of fixed bed swing reactors; fixed bed hydrocracking of the hydrodemetallized effluent in the presence of a hydrocracking catalyst; separation in order to obtain a heavy fraction; hydrodesulphurization of the heavy fraction in which hydrogen is reinjected. |
US09896628B2 |
Mesoporous composite of molecular sieves for hydrocracking of heavy crude oils and residues
A hydrocracking catalyst having a support of a composite of mesoporous materials, molecular sieves and alumina, is used in the last bed of a multi-bed system for treating heavy crude oils and residues and is designed to increase the production of intermediate distillates having boiling points in a temperature range of 204° C. to 538° C., decrease the production of the heavy fraction (>538° C.), and increase the production of gasoline fraction (<204° C.). The feedstock to be processed in the last bed contains low amounts of metals and is lighter than the feedstock that is fed to the first catalytic bed. |
US09896626B1 |
Apparatus and process for efficient production of liquid fuels from gaseous hydrocarbons
An apparatus for a distributed manufacturing plant that allows direct, economical production of transportation fuels and/or chemicals at remote sites is described. The production plant employs two primary integrated systems consisting of a syngas generator and a catalytic process that are used to directly produce fuels and chemicals. The syngas generator utilizes oxygen anions, produced from a ceramic membrane system, to generate high quality syngas directly at pressures of about 100-600 psia. The tail gas and water containing hydroxyl-alkanes from the catalytic process are recycled into the syngas generator, in automatically controlled proportions, to regulate the hydrogen to carbon monoxide within the preferred H2/CO stoichiometric range of about 1.8-2.4. The primary products produced directly from the plant include reformulated gasoline blendstocks, #1 diesel fuels, and #2 diesel fuels. |
US09896616B2 |
Acrylonitrile-based sulfur scavenging agents and methods of use in oilfield operations
Composition for the removal or inactivation of hydrogen sulfide or other species comprising ionizable sulfur (e.g., mercaptans, thiols, etc.) using compositions containing acrylonitrile and/or derivatives thereof are provided. Methods for the removal or inactivation of hydrogen sulfide or other sulfur species in oilfield sites and other related applications using compositions containing acrylonitrile and/or derivatives thereof are provided. |
US09896614B2 |
Delayed acid breaker systems for filtercakes
A delayed acid breaker comprising: an inclusion compound comprising: a host molecule of cyclodextrin; and a guest molecule of an acid precursor, wherein the acid precursor hydrolyzes in water to form an acid, and wherein the acid degrades at least a portion of a filtercake located within a subterranean formation. A method of removing a filtercake from a subterranean formation comprising: introducing the delayed acid breaker into the subterranean formation; and allowing the acid precursor to form the acid after a desired amount of time has elapsed since the introduction of the delayed acid breaker into the subterranean formation. |
US09896613B2 |
Esters for drilling emulsions and metal working fluids
The present invention relates to an emulsion comprising at least (a) an organic phase, (b) a water phase and (c) an ester based on an ether carboxylic acid and an alcohol. Also within the ambit of the invention is the use of an ester as defined in (c) as emulsifier, as a thickening agent and/or as an anti-foaming agent in particular in drilling emulsions and metal working fluids. |
US09896611B2 |
Masterbatch for manufacturing a drilling fluid
An oil-based masterbatch in the form of granules containing carbon nanotubes. Also, a method for preparing an oil-based masterbatch in the form of granules containing carbon nanotubes. Also, the use of an oil-based masterbatch in the form of granules containing carbon nanotubes for manufacturing an aqueous or organic viscoelastic fluid, intended for drilling in underground formations. |
US09896610B2 |
Methods and aqueous based wellbore fluids for reducing wellbore fluid loss and filtrate loss
Embodiments disclosed herein relate to aqueous based wellbore fluids for preventing wellbore fluid loss downhole containing at least one copolymer formed from at least one natural polymer monomer and at least one latex monomer, and an aqueous base fluid. |
US09896604B2 |
Methods of polishing sapphire surfaces
Described herein are compositions, kits and methods for polishing sapphire surfaces using compositions having colloidal aluminosilicate particles in an aqueous acidic solution. In some aspects, the methods for polishing a sapphire surface may include abrading a sapphire surface with a rotating polishing pad and a polishing composition. The polishing composition may include an amount of a colloidal aluminosilicate and may have a pH of about 2.0 to about 7.0. |
US09896603B2 |
Curing accelerator for oxidative polymerization-type unsaturated resin, printing ink, and coating material
There is provided a highly versatile curing accelerator for an oxidative polymerization-type unsaturated resin. There are also provided a printing ink and a coating material that use the above curing accelerator. Specifically, the curing accelerator for an oxidative polymerization-type unsaturated resin that is used contains a fatty acid manganese salt (A) and a compound (B) represented by formula (1) below, (wherein R1 and R4 are each a hydrogen atom, a hydrocarbon group, a hydrocarbonoxy group, or an amino group, R2 and R5 are each a hydrogen atom, a hydrocarbon group, a hydrocarbonoxy group, a hydrocarbonoxycarbonyl group, a cyano group, a nitro group, or a halogen atom, R3 and R6 are each a hydrogen atom or a hydrocarbon group, and R7 is a divalent hydrocarbon group, and wherein R1 and R2 may form a ring, and R4 and R5 may form a ring). |
US09896596B2 |
Plastic film
Disclosed is a plastic film exhibiting excellent physical properties including a high level of hardness, high scratch resistance, and low reflection. Exhibiting a high level of hardness, scratch resistance, impact resistance, low reflectivity, and high transparency, the plastic film can be used as a substitute for a cover plate made of glass or reinforced glass. |
US09896595B2 |
Acrylic polymers, 1K coating compositions including the same, and multilayer coating systems including a topcoat layer formed from the 1K coating compositions
Acrylic polymers, 1K coating compositions including the same, and multilayer coating systems including a topcoat layer formed from the 1K coating compositions are provided herein. In an embodiment, a 1K coating composition includes an acrylic polymer having a nominal Tg of at least 25° C. and a melamine crosslinker. The acrylic polymer includes a free radical-polymerized backbone and pendant chains bonded thereto. A first pendant chain of the acrylic polymer includes a first segment and a second segment. The first segment includes an ester linkage and a secondary hydroxyl group. The second segment is connected to the first segment and includes an ester linkage and a branched hydrocarbon chain. A second pendant chain of the acrylic polymer includes a primary hydroxyl group or a urethane-containing group formed therefrom. |
US09896594B2 |
Cross-linking mechanism for thin organic coatings based on the Hantzsch di-hydropyridine synthesis reaction
Disclosed is cross-linking process for cross-linking polymeric chains in a coating composition. In one embodiment the process utilizes a Hantzsch dihydropyridine reaction to form reaction products including cross-linking polymeric resin chains having beta-keto ester functions using a source of aldehyde and a source of ammonia or a primary amine to form a permanent dihydropyridine bond between the beta-keto ester functions. The novel cross-linking reaction can occur at lower temperatures compared to typical cross-linking reactions and can occur in aqueous solutions that have a neutral to mildly alkaline pH of from 6 to 11. The novel cross-linking reaction provides many advantages to performing cross-linking of polymeric chains in coating resins. |
US09896592B2 |
Temporary elastomeric functional barrier membrane and method of manufacture
A fluid check valve incorporating a temporary elastomeric functional barrier membrane, the check valve having a sealing member comprising a first elastomer and a barrier membrane comprising a second elastomer, different from the first elastomer, disposed directly upon the surface of the sealing member so as to form a continuous layer over at least a seal opening of the sealing member. The barrier membrane may include a photoinitiator and coagent which aids in the ultraviolet (UV) curing of the second elastomer after application upon the first. The barrier membrane may applied as a solution of monomers, photoinitiator, and optional coagent, the solvent evaporated, and the deposited solutes exposed to ultraviolet so as to form the barrier membrane material. |
US09896589B2 |
Ink composition for inkjet recording
According to an embodiment, an ink composition for inkjet recording comprises a dispersion medium that contains water and glycol ether of which boiling point is equal to or greater than 220 degrees centigrade, a pigment and a core-shell particle that includes a core consisting of hydrophobic acrylic resin and a shell consisting of at least one of aqueous urethane resin and acrylic graft aqueous urethane resin. |
US09896588B2 |
Ink and inkjet recording method
The object is to provide an ink advantageous in that an ink film thereby formed excels in strength and adhesiveness to print media. To achieve the object, an ink according to the present invention includes: a disperse solvent; first binder resin particles (1) containing a coloring agent (3) and emulsified or suspended in the disperse solvent; and second binder resin particles (2) emulsified or suspended in the disperse solvent, wherein the second binder resin particles (2) have an average particle size smaller than an average particle size of the first binder resin particles (1). |
US09896586B2 |
Cut resistant article
The invention relates to an article comprising a cut-resistant coating which contains a polymeric matrix and a cut-resistant component distributed in the polymeric matrix characterized in that said cut-resistant component is a plurality of fibers having an average length (L) to an average diameter (D) ratio, i.e. L/D, of at least 10. |
US09896582B2 |
Micronized asphalt modifiers, methods of modifying asphalt, asphalt compositions and methods of making
An asphalt additive comprising a primary rheology modifying component and a secondary rheology modifying component, and asphalt compositions and products having such additive incorporated therein. The primary rheology modifying component is generally a polymer, and the secondary rheology modifying component may comprise a petroleum micro-wax. |
US09896578B2 |
Thermoplastically processable transparent blends of thermoplastic polyurethane and poly(meth)acrylates
The present invention relates to compositions comprising at least one thermoplastic polyurethane and at least one poly(meth)acrylate, where the at least one thermoplastic polyurethane is a polyurethane based on hexamethylene 1,6-diisocyanate (HDI), on at least one diol, and on at least one chain extender, selected from the group consisting of ethylene 1,2-glycol, 1,2-propanediol, 1,3-propanediol, 1,4-butanediol, 2,3-butanediol, 1,5-pentanediol, 1,6-hexanediol, diethylene glycol, dipropylene glycol, 1,4-cyclohexanediol, 1,4-dimethanolcyclohexane, and neopentyl glycol. The present invention further relates to moldings comprising the compositions of the invention, and also to the use of the compositions of the invention for producing a foil and for coating a molding. |
US09896577B2 |
Polypropylene blend with improved balance between sit and melting point
Polymer composite comprising propylene copolymer composition having a comonomer content in the range of 2.5 to 10 wt. -%, the comonomers are C5 to C12 α-olefins, and a low-crystalline polymer having a melting temperature of below 120° C., wherein further said polymer composite has (i) a melting temperature of at least 140° C., and (ii) a heat sealing initiation temperature (SIT) of not more than 110° C. |
US09896576B2 |
Medical tube
A medical tube that contains a polymer composition that is generally flexible and biocompatible is provided. The polymer composition contains at least one ethylene vinyl acetate polymer and at least one viscoelastic additive. By selectively controlling specific aspects of the ethylene vinyl acetate polymer (e.g., vinyl acetate content, melt flow index, density, etc.), the viscoelastic additive, and the manner in which they are blended, the resulting composition can exhibit a reduced tendency to kink when formed into the medical tube. |
US09896569B2 |
Polycarbonate resin composition and molded article
Provided are a polycarbonate resin composition containing a polycarbonate resin containing an aliphatic carbonate repeating unit (A) derived from an aliphatic dihydroxy compound and a specific glass filler, and a molded article. |
US09896567B2 |
Process for manufacturing calcium carbonate materials having a particle surface with improved adsorption properties
The invention relates to a process for manufacturing calcium carbonate materials having a particle surface with improved adsorption properties of dispersant, using at least one lithium ion-containing compound, the calcium carbonate material obtained by this process, the use of the calcium carbonate materials in paper, paints and plastics, as well as the use of the lithium ion-containing compounds in the manufacturing process. |
US09896566B2 |
Laser activatable polymer composition
A polymer composition that comprises an aromatic polyester, a laser activatable additive, and a mineral filler is provided. The mineral filler has a median size of about 35 micrometers or less and the laser activatable additive has a mean size of about 1000 nanometers or less. |
US09896561B2 |
Dendritic macroporous hydrogels prepared by crystal templating
The present invention includes a hydrogel and a method of making a porous hydrogel by preparing an aqueous mixture of an uncrosslinked polymer and a crystallizable molecule; casting the mixture into a vessel; allowing the cast mixture to dry to form an amorphous hydrogel film; seeding the cast mixture with a seed crystal of the crystallizable molecule; growing the crystallizable molecule into a crystal structure within the uncrosslinked polymer; crosslinking the polymer around the crystal structure under conditions in which the crystal structure within the crosslinked polymer is maintained; and dissolving the crystals within the crosslinked polymer to form the porous hydrogel. |
US09896559B2 |
Phenolic foam
Phenolic closed-cell foam comprises a hydrocarbon blowing agent and includes an alkali metal silicate in an amount of at least 1% by weight. The foam has an aged thermal conductivity as determined by the procedures of EN13166:2008 of less than 0.025 W/m·K. The foam is formed from a phenolic resole resin mixture having a water content of greater than 15% by weight but less than 24% by weight. |
US09896557B2 |
Silicone-based material
Surface-structured, cross-linked silicone-based material and method for making the same. Embodiments of silicone-based materials described herein are useful, for example, in applications of light capture, anti-reflection, light redirection, light diffusion, hydrophobic surfaces, hydrophilic surfaces, light guiding, light collimation, light concentration, Fresnel lens, retro-reflection, drag reduction, air bleed adhesives, release liner, abrasion resistance, and anti-fouling. |
US09896556B2 |
Process for the impregnation of polymer substrates
Process for the impregnation of a polymer substrate including at least one polymer, which comprises putting said polymer substrate in contact with at least one aqueous emulsion, preferably an aqueous microemulsion, including at least one organic additive. The impregnated polymer substrate obtained from said process can be advantageously used for obtaining polymer end-products having improved aesthetic characteristics (for example, impregnation with at least one dye) or stability characteristics (for example, impregnation with at least one stabilizer), which can be used in various fields such as, for example, the optical field (e.g., advanced optical components, laser applications), the medical field (e.g., the release of pharmaceutical substances), the agricultural field (e.g., release of pesticides), fragrances (e.g., release of fragrances). More specifically, said polymer substrate can be used in luminescent solar concentrators (LSCs) which, in their turn, can be advantageously used together, for example, with photovoltaic cells (or solar cells), or photoelectrolytic cells, in solar devices (i.e. devices for exploiting solar energy). Furthermore, said luminescent solar concentrators (LSCs) can be advantageously used together, for example, with photovoltaic cells (or solar cells), in photovoltaic windows. |
US09896552B2 |
Method for producing rubber wet master batch
In the step (I), the period (minute(s)) for dispersing the carbon black species A showing a nitrogen adsorption specific surface area (N2SA-(A)value) of 130 m2/g or less in the dispersing solvent and that minute(s)) for dispersing the carbon black species B showing an N2SA-(B) value lower than the N2SA-(A) value by 25 m2/g or more in the dispersing solvent by α(A) and α(B), respectively, and further representing the rotation number (rpm) of a rotor of a dispersing machine used in the dispersing when the carbon black species A is dispersed, and that (rpm) of a rotor of a dispersing machine used in the dispersing when the carbon black species B is dispersed by β(A) and β(B), respectively, the following expression is satisfied: 1.1α(B)×β(B)≦α(A)×β(A)≦1.5α(B)×β(B) (1). |
US09896551B2 |
Phosphaphenanthrene-based compound and related preparation method and application
Provided is a phosphaphenanthrene-based compound represented by the following chemical structure: The phosphaphenanthrene-based compound can be added in a resin composition and made into a prepreg or resin film. The prepreg or resin film made from such resin composition has low coefficient of thermal expansion, low dielectric constant and dissipation factor, and flame retardancy, thereby being suitable for copper-clad laminate or printed circuit board. |
US09896548B2 |
Method of producing polyarylene sulfide
Provided is a method of producing polyarylene sulfide (PAS) that suppresses side reactions and produces PAS with a high purity and a high molecular weight at a high yield. A method of producing PAS in which a sulfur source and a dihalo aromatic compound are polymerized in an organic amide solvent, the method of producing PAS comprising the following steps 1 to 3: step 1: a preparation step of preparing a mixture containing an organic amide solvent, a sulfur source, water, a dihalo aromatic compound, and an alkali metal hydroxide in an amount that is less than an equimolar amount relative to the sulfur source; step 2: a first-stage polymerization step of initiating a polymerization reaction by heating the mixture, and producing a prepolymer having a dihalo aromatic compound conversion rate of 50% or greater; and step 3: a second-stage polymerization step of adding from 0.11 to 0.3 mol of an alkali metal hydroxide per 1 mol of the sulfur source, and continuing the polymerization reaction. A PAS polymerization reaction solution having a low content of byproduct. PAS having an average particle diameter of 10 to 5,000 μm, a melt viscosity (temperature 310° C., shear rate 1,216 sec−1) of 0.1 to 3,000 Pa·s, and a nitrogen content of 750 ppm or less. |
US09896544B2 |
Biodegradable polyesteramide copolymers for drug delivery
The present invention relates to a poly (ester amide) (PEA) having a chemical formula described by structural formula (IV), wherein m+p varies from 0.9-0.1 and q varies from 0.1 to 0.9 m+p+q=1 whereby m or p could be 0 n is about 5 to about 300; (pref. 50-200) R1 is independently selected from the group consisting of (C2-C20 alkylene, (C2-C20) alkenylene, —(R9—CO—O—R10—O—CO—R9)—, —CHR11—O—CO—R12—COOCR11— and combinations thereof; R3 and R4 in a single backbone unit m or p, respectively, are independently selected from the group consisting of hydrogen, (C1-C6)alkyl, (C2-C6)alkenyl, (C2-C6)alkynyl, (C6-C10)aryl, (C1-C6)alkyl, —(CH2)SH, —(CH2)S(CH3), —CH2OH, —CH(OH)CH3, —(CH2)4NH3+, —(CH2)3NHC(═NH2+)NH2, —CH2COOH, —(CH2)COOH, —CH2—CO—NH2, —CH2CH2—CO—NH2, -- —CH2CH2COOH, CH3—CH2—CH(CH3)—, (CH3)2—CH—CH2—, H2N—(CH2)4—, Ph-CH2—, CH═C—CH2—, HO-p-Ph-CH2—, (CH3)2—CH—, Ph-NH—, NH—(CH2)3—C—, NH—CH═N—CH═C—CH2—. R5 is selected from the group consisting of (C2-C20)alkylene, (C2-C20)alkenylene, alkyloxy or oligoethyleneglycol R6 is selected from bicyclic-fragments of 1,4:3,6-dianhydrohexitols of structural formula (III); R7 is selected from the group consisting of (C6-C10)aryl (C1-C6)alkyl R8 is —(CH2)4-; R9 or R10 are independently selected from C2-C12 alkylene or C2-C12 alkenylene. R11 or R12 are independently selected from H, methyl, C2-C12 alkylene or C2-C12 alkenylene whereby a is at least 0.05 and b is at least 0.05 and a+b=1. |
US09896543B2 |
Composition comprising furfuryl alcohol
Composition including a first component, including furfuryl alcohol and humins and a second component including an acidic polymerization initiator. The composition can be oligomerized to a resin, which has a viscosity in the range of 0.1 to 10,000 Pa·s at 25° C., determined according to ISO3219. The resin, or a blend of furfuryl alcohol and humins as a component A and an acidic polymerization initiator as a component B, separated from each other, may form a kit for an adhesive or impregnation agent. |
US09896539B2 |
Method for synthesizing poly(butylene adipate-co-terephthalate)
A method for synthesizing poly(butylene adipate-co-terephthalate) by combination of melt and solid state polycondensation using an organic guanidine as a main catalyst. The ternary catalyst system includes a main catalyst, a first cocatalyst, and a second cocatalyst. The main catalyst is organic guanidine; the first cocatalyst is titanate ester or zirconate ester; and the second cocatalyst is metallic oxide. The method includes: 1) adding 1,4-butanediol (BDO), adipic acid (AA), terephthalic acid (TA), and a ternary catalyst system to a reaction still; conducting an oligo-polycondensation to yield a oligomer having the weight average molecular weight (Mw) of between 3.0×103 and 4.0×103; allowing the oligomer to perform a melt polycondensation (MP) to yield a prepolymer with medium Mw of between 1.5×104 and 3.0×104; and 2) crushing the solid prepolymer into granules of 30-40 meshes, and then allowing the granules to undergo solid state polycondensation to yield the final PBAT product. |
US09896533B2 |
Non-ionic associative thickeners containing cyclohexylol alkyls, formulations containing them and their uses
The present invention concerns new associative thickeners of the HEUR type (Hydrophobically modified Ethylene oxide URethane) whose hydrophobic monomer is based on alkyl cyclohexylols. These are new polyurethanes that significantly thicken an aqueous formulation with a low, medium and high shear gradient. The invention also concerns the compositions containing them and their uses in different formulations such as aqueous paints. |
US09896531B2 |
Formulation for silicone hydrogel, silicone hydrogel and method for forming silicone hydrogel
A formulation for silicone hydrogel for use in contact lens includes at least one silicone monomer having a weight percent of the total hydrogel weight in a range from about 10% to about 35%, at least one hydrophilic monomer having a weight percent of the total hydrogel weight in a range from about 15% to about 40%, at least one crosslinker, and at least one initiator. A silicone hydrogel, and a method to form silicone hydrogel are provided. |
US09896529B2 |
Method for producing polyacrylic acid (salt)-based water-absorbable resin
The present invention provides a method for producing, by adding an additive and/or gas bubbles to a monomer with high efficiency, a polyacrylic acid (salt)-based water-absorbing resin having high physical properties while high productivity is maintained. The step of preparing an aqueous monomer solution includes the steps of: preparing an aqueous solution; and adding a water-insoluble additive and/or gas bubbles. A retention time from when the water-insoluble additive and/or the gas bubbles is/are added to when polymerization starts is 1 second to 60 seconds. |
US09896528B2 |
Carboxyl-group-containing polymer composition
There is provided a carboxyl group-containing polymer composition having excellent water solubility and aqueous solution-thickening properties, having a minimal change in viscosity due to the thermal history in a drying step, and having high transparency of a neutral viscous solution obtained by mixing with water. The carboxyl group-containing polymer composition comprises (A) a carboxyl group-containing polymer obtained by copolymerization of an α,β-unsaturated carboxylic acid (a1) and a compound (a2) having at least two or more ethylenically unsaturated groups per molecule; (B) a polyhydric alcohol fatty acid ester alkylene oxide adduct; and (C) a polyoxyalkylene modified product, which is at least one of an ether (c1) of a polyoxyalkylene with a fatty alcohol, and a polyoxyalkylene fatty acid ester (c2). |
US09896526B2 |
Process for producing olefin polymer and olefin polymer
[Problem to be solved]There is provided a process for producing an olefin polymer that is capable of producing an olefin polymer having high heat resistance and high molecular weight with excellent catalytic activity.[Solution to problem]The process for producing an olefin polymer includes a step of polymerizing at least one olefin selected from ethylene and α-olefins having 4 to 30 carbon atoms in the presence of an olefin polymerization catalyst containing a transition metal compound represented by the general formula [I], the olefin polymer including constituent units derived from ethylene and α-olefins having 4 to 30 carbon atoms in a total amount between more than 50 mol % and not more than 100 mol %, [in the formula [I], R1, R3 and R5 to R16 are each independently a hydrogen atom, a hydrocarbon group or the like; R2 is a hydrocarbon group or the like; R4 is a hydrogen atom; M is a transition metal of Group IV; Q is a halogen atom or the like; and j is an integer of 1 to 4]. |
US09896521B2 |
Crosslinker-accelerator system for polyacrylates
Crosslinker-accelerator system for the thermal crosslinking of polyacrylates having functional groups capable of entering into linking reactions with epoxide groups, comprising at least one substance having at least one epoxide group as crosslinker and at least one substance of the formula R12N—CR2R3—CR4R5—(CR6R7)n—X in which the R1 independently represent hydrogen, a substituted or unsubstituted alkyl or cycloalkyl radical or together with the nitrogen atom form a 5-7-membered ring; R2, R3, R4, R5, R6 and R7 independently represent hydrogen or an alkyl radical having 1 to 8 carbon atoms or form a 5-7-membered cycloalkylene group; n is an integer from 0 to 4; and X represents —OH, —OR, —SH, —SR and —PR2, in which R independently represents C1-C18 alkyl radical, C2-C18 alkenyl radical or C2-C18 alkynyl radical, an aryl group or an aliphatic or aromatic heterocycle, as accelerator. |
US09896517B2 |
Low molecular weight glycosaminoglycan derivative, pharmaceutical composition thereof, preparation method therefor and use thereof
Provided are a low-molecular-weight fucosylated glycosaminoglycan derivative (derivative of Low molecular weight Fucosylated Glycosaminoglycan, dLFG) having anticoagulant activity, a preparation method thereof, a pharmaceutical composition comprising dLFG or a pharmaceutically acceptable salt thereof, and the use of dLFG and pharmaceutical composition thereof in preparing medicine for treating thrombotic diseases. |
US09896513B2 |
Antibodies capable of specifically binding two epitopes on tissue factor pathway inhibitor
The application discloses a combination of two monospecific TFPI antibodies, wherein one antibody is capable of specifically binding TFPI (1-181) and the other antibody is capable of specifically binding TFPI (182-276), as well as bispecific anti-TFPI antibodies derived from two such monospecific antibodies. Both the combination of the two monospecific antibodies and the bispecific antibody strongly enhance thrombin generation by neutralising full length TFPIα, even where the concentration of TFPI is abnormally elevated. |
US09896508B2 |
Antibodies reactive with B7-H3 and uses thereof
The present invention relates to antibodies that are immunoreactive to the mammalian, and more particularly, the human B7-H3 receptor and to uses thereof, particularly in the treatment of cancer and inflammation. The invention thus particularly concerns humanized B7-H3-reactive antibodies that are capable of mediating, and more preferably enhancing the activation of the immune system against cancer cells that are associated with a variety of human cancers. |
US09896506B2 |
Anti-CD79B antibodies and immunoconjugates and methods of use
The present invention is directed to compositions of matter useful for the treatment of hematopoietic tumor in mammals, including immunoconjugates comprising anti-CD79b cysteine-engineered antibody huMA79b.v28, and to methods of using those compositions of matter for the same. |
US09896504B2 |
Human anti-alpha-synuclein antibodies
Provided are human alpha-synuclein-specific autoantibodies as well as fragments, derivatives and variants thereof as well as methods related thereto. Assays, kits, and solid supports related to antibodies specific for α-synuclein are also disclosed. The antibody, immunoglobulin chain(s), as well as binding fragments, derivatives and variants thereof can be used in pharmaceutical and diagnostic compositions for α-synuclein targeted immunotherapy and diagnosis, respectively. |
US09896502B2 |
Antagonist antibodies directed against calcitonin gene-related peptide and methods using same
The invention features methods for preventing or treating CGRP associated disorders such as vasomotor symptoms and/or headaches (e.g., migraine, cluster headache, and tension headache) by administering an anti-CGRP antagonist antibody. Compositions for use in the disclosed methods are also provided. Antagonist antibody G1 and antibodies derived from G1 directed to CGRP are also described. |
US09896500B2 |
Antibody capable of binding to influenza virus
The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively. |
US09896499B2 |
Growth factor antagonists for organ transplant alloimmunity and arteriosclerosis
The present invention provides materials and methods for antagonizing the function of vascular endothelial growth factor receptors, platelet derived growth factor receptors and other receptors, to prevent, inhibit, or ameliorate allograft rejection or arteriosclerosis in organisms that receive an organ transplant. |
US09896498B2 |
Tumor vascular disrupting agent polypeptide, gene, expression vector, and use thereof
The present invention relates to a tumor vascular disrupting agent polypeptide, gene, expression vector, and use thereof. The tumor vascular disrupting agent polypeptide has the amino acid sequence as shown by SEQ ID NO: 1. The polypeptide comprises a truncated tissue factor (tTF) and a tumor-targeting molecule (pHLIP); the factor and the molecule are connected by 5 amino acids, thereby ensuring the function of each not being affected by the other; the fusion protein can be positioned to the surface of a tumor vascular endothelial cell by means of the pHLIP, and provides the blood coagulation feature of the tTF in a tumor vessel and forms a thrombus, thereby disrupting the blood supply to the tumor area and treating tumor. The polypeptide of the present invention is significant to the treatment of tumor, and can be used in medicines for treating tumors. |
US09896496B2 |
Derivative of an insulin analogue
The present invention provides a novel derivative of an analogue of human insulin, useful for the treatment of diabetes. |
US09896492B2 |
HJURP peptides and vaccines including the same
Isolated peptides derived from SEQ ID NO: 50 and fragments thereof that bind to an HLA antigen and induce cytotoxic T lymphocytes (CTL) and thus are suitable for use in the context of cancer immunotherapy, more particularly cancer vaccines are described herein. The inventive peptides encompasses both the above mentioned amino acid sequences and modified versions thereof, in which one, two, or several amino acids sequences substituted, deleted, added or inserted, provided such modified versions retain the requisite cytotoxic T cell inducibility of the original sequence. Further provided are nucleic acids encoding any of the aforementioned peptides as well as pharmaceutical agents, substances and/or compositions that include or incorporate any of the aforementioned peptides or nucleic acids. The peptides, nucleic acids, pharmaceutical agents, substances and compositions of this invention find particular utility in the treatment of cancers and tumors, including, for example, AML, bladder cancer, breast cancer, cervical cancer, cholangiocellular carcinoma, CML, colorectal cancer, esophagus cancer, Diffused-type gastric cancer, liver cancer, NSCLC, lymphoma, osteosarcoma, ovarian cancer, pancreatic cancer, prostate cancer, renal carcinoma, SCLC, soft tissue tumor and testicular tumor. |
US09896490B2 |
Semaphorin 3C variants, compositions comprising said variants and methods of use thereof
The present invention relates, according to some embodiments, to variants of Semaphorin 3C (Sema3C) having amino acid modifications at furin-like pro-protein convertase cleavage sites, rendering these sites resistant to cleavage. The invention further provides, according to certain embodiments, compositions comprising the Sema3C variants, and methods of using the compositions for suppressing the growth of tumors and/or inhibiting the development of tumor metastases. |
US09896487B2 |
Amyloidosis-inhibiting polypeptides and their use
Isolated polypeptides that possess an a-sheet structure are disclosed that can be used to treat or diagnose amyloid diseases. |
US09896486B2 |
Mutated immunoglobulin-binding polypeptides
A polypeptide with improved alkaline stability, which polypeptide comprises a mutant of a B or C domain of Staphylococcus Protein A, as specified by SEQ ID NO 1 or SEQ ID NO 2, or of Protein Z, as specified by SEQ ID NO 3, wherein at least the glutamine residue at position 9 has been mutated to an amino acid other than asparagine. The invention also discloses multimers of said polypeptide, as well as separation matrices comprising the multimers or polypeptides. |
US09896481B2 |
Modified mini-hepcidin peptides and methods of using thereof
Disclosed herein are peptides which exhibit hepcidin activity and methods of making and using thereof. |
US09896478B2 |
Antibody purification by cation exchange chromatography
A method for purifying an antibody by cation exchange chromatography is described in which a high pH wash step is used to remove of contaminants prior to eluting the desired antibody using an elution buffer with increased conductivity. |
US09896471B2 |
Salt of 1-(2-deoxy-2-fluoro-4-thio-β-D-arabinofuranosyl)cytosine
A superior antitumor agent is provided. A salt of 1-(2-deoxy-2-fluoro-4-thio-β-D-arabinofuranosyl)cytosine shows at least one or more of such characteristics as (1) it has superior antitumor activity, (2) it shows superior crystallinity, (3) it shows high water solubility, (4) it does not show deliquescent property, (5) it shows superior flowability, (6) it shows superior tableting property, (7) it can be manufactured with less environmental load, and (8) it can be manufactured in a large scale, and therefore it is useful as a bulk drug for medicaments. |
US09896466B2 |
Tamoxifen derivatives for treatment of neoplastic diseases, especially with high HER2 protein level
The subject of the invention are new mitochondrially targeted E/Z isomers of aliphatic triphenylphosphonium derivatives of tamoxifen where the aliphatic chain is alkyl or alkenyl, and their corresponding tertiary amine salts and/or their mixture (MitoTAX). Alkyl triphenylphosphonium derivatives of tamoxifen have the general formula (I), where n=8 to 12 and where Z is selected from the group of organic salts or inorganic salts. Alkenyl triphenylphosphonium derivatives of tamoxifen have the general formula IA, where n=6 to 10 and where Z has the above mentioned meaning. These compounds are applicable for the treatment of neoplastic disease, especially those with high HER2 protein levels. The drug for the treatment of neoplastic diseases according to the invention contains at least one E/Z isomer of aliphatic triphenylphosphonium derivatives of tamoxifen of the general formula (I) and/or IA or their corresponding salts of tertiary amine. |
US09896465B2 |
Phosphonium compound, preparation method thereof, epoxy resin composition including the same, and semiconductor device prepared by using the same
A phosphonium compound, a method of preparing the same, an epoxy resin composition including the same, and a semiconductor device encapsulated with the same, the compound being represented by Formula 1: |
US09896458B2 |
Compounds, compositions and methods
The present disclosure relates generally to compounds and compositions, and their use as kinase inhibitors. |
US09896453B2 |
Purinone derivative hydrochloride
The purinone derivative 6-amino-9-[(3R)-1-(2-butynoyl)-3-pyrrolidinyl]-7-(4-phenoxyphenyl)-7,9-dihydro-8H-purin-8-one hydrochloride has Btk-selective inhibitory activity and, in addition to having excellent metabolic stability, it is a compound that exhibits a high level of solubility and absorption with respect to the free base and can be crystallized, hence it can serve as a therapeutic agent for diseases involving B cells and mast cells. |
US09896452B2 |
Substituted prolines/piperidines as orexin receptor antagonists
The present invention is directed to compounds that modulate the bioactivity of an orexin receptor such as OX1 or OX2, or both; to pharmaceutical compositions and combinations comprising a compound of the invention; to methods of treatment of malconditions in patients wherein modulation of an orexin receptor is medically indicated; and to methods of preparation of compounds of the invention. For example, orexin receptor-modulatory compounds of the present invention can be used in treatment of an eating disorder, obesity, alcoholism or an alcohol-related disorder, drug abuse or addiction including addiction to cocaine, opiates, amphetamines, or nicotine, a sleep disorder, a cognitive dysfunction in a psychiatric or neurologic disorder, depression, anxiety, panic disorder, schizophrenia, Alzheimer's disease, Parkinson's disease, Huntington's chorea, headache, migraine, pain, gastrointestinal diseases, epilepsy, inflammations, immune-related diseases, endocrine-related diseases, cancer, hypertension, behavior disorder, mood disorder, manic depression, dementia, sex disorder, psychosexual disorder, or renal disease. |
US09896451B2 |
Method for producing endo-9-azabicyclo[3.3.1]nonan-3-ol derivative
A 9-azabicyclo[3.3.1]nonan-3-one derivative is reacted with a hydrogen in the presence of a catalyst composed of a ruthenium complex to obtain, at a low cost, an endo-9-azabicyclo[3.3.1]nonan-3-ol derivative useful as a production intermediate for agrochemical agents or medicines. |
US09896450B2 |
Modulators of Clavibacter michiganensis and methods of making and using thereof
The subject matter disclosed herein generally relates to modulators of Clavibacter michiganensis subsp. michiganensis, derivatives thereof, formulations thereof, coated seeds, and methods of using such compounds to treat diseases such as bacterial canker in plants. |
US09896449B2 |
Ring-fused bicyclic pyridyl derivatives as FGFR4 inhibitors
The present invention provides a compound of formula (I) or a pharmaceutically acceptable salt thereof; a method for manufacturing said compound, and its therapeutic uses. The present invention further provides a combination of pharmacologically active agents and a pharmaceutical composition comprising said compound. |
US09896444B2 |
Benzamide derivatives for inhibiting the activity of ABL1, ABL2 and BCR-ABL1
The present invention relates to compounds of formula (I): in which Y, Y1, R1, R2, R3 and R4 are defined in the Summary of the Invention; capable of inhibiting the tyrosine kinase enzymatic activity of the Abelson protein (ABL1), the Abelson-related protein (ABL2) and related chimeric proteins, in particular BCR-ABL1. The invention further provides a process for the preparation of compounds of the invention, pharmaceutical preparations comprising such compounds and methods of using such compounds in the treatment of cancers. |
US09896442B2 |
Antifungal treatment
A method of treating or preventing fungal infection, which includes identifying a plant or animal having a fungal infection and administering an effective amount of an anti-fungal composition to the plant or animal to reduce the fungal infection. In a preferred form of the present invention, the antifungal composition is compound 13 or 33 and is combined with an azole compound, such as fluconazole. |
US09896438B2 |
2,2,2-trifluoroethyl-thiadiazines
The present invention provides a compound of formula (I) having BACE1 inhibitory activity, their manufacture, pharmaceutical compositions containing them and their use as therapeutically active substances. The active compounds of the present invention are useful in the therapeutic and/or prophylactic treatment of e.g. Alzheimer's disease. |
US09896437B2 |
Diarylhydantoin compounds
The present invention relates to diarylhydantoin compounds and methods for synthesizing them and using them in the treatment of hormone refractory prostate cancer. |
US09896426B2 |
Extraction separation method of a flavone component based on graphene
The present invention refers to the technical field of flavone component extraction, and provides an extraction separation method of a flavone component based on amination graphene. The flavone components comprise flavones, flavanols, isoflavones, flavanones, flavanonols, flavanones, anthocyanidins, chalcones, and chromones etc. The extraction separation method is adsorption extraction, and amination graphene is taken as a medium of adsorption extraction. The extraction separation method of the flavone components based on amination graphene is superior in separation speed and product purity, low cost and convenient operation. |
US09896422B2 |
Tetracycline derivatives with reduced antibiotic activity and neuroprotective benefits
The present disclosure is directed to compositions and methods which utilize the tetracycline scaffold, preferably the scaffold of tetracycline or minocycline, and which significantly lack antibiotic activity. The compounds have neuroprotective attributes without interfering with the drugs capacity to pass through the blood brain barrier. These compounds have neuroprotective activity because of their inhibition of neuronal cell cycle progression. The compounds are characterized in part by a fifth ring joining positions 9 and 10. |
US09896420B2 |
N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation
The present invention relates to the NQBS class of molecules. It is based, at least in part, on the discovery that a representative group of compounds have been observed to inhibit nuclear translocation of NF-κB subunits. Without being bound by any particular theory, this inhibition of nuclear translocation may be mediated by either (i) binding of the NQBS or related compound to the C-terminus of the RHD, which specifically mediates the nuclear internalization; or (ii) NQBS-mediated stabilization of the dimer/IκB complex, disallowing dissociation of the active NF-κB monomers, and thus, inhibiting the generation of the subunits necessary to enter the nucleus. The NQBS class of molecules, and related molecules, may be used in therapeutic applications where inhibition of NF-κB translocation is beneficial, including but not limited to the treatment of cancer, autoimmune disorders, and inflammatory states. |
US09896417B2 |
Tert-butyl N-[2-{4-[6-amino-5-(2,4-difluorobenzoyl)-2-oxopyridin-1(2H)-yl]-3,5-difluorophenyl}ethyl]-L-alaninate or a salt,hydrate or solvate thereof
The present invention provides a compound which is: tert-butyl N-[2-{4-[6-amino-5-(2,4-difluorobenzoyl)-2-oxopyridin-1(2H)-yl]-3,5-difluorophenyl}ethyl)-L-alaninate or a salt, hydrate or solvate thereof. The present invention also provides a pharmaceutical composition comprising the compound together with one or more pharmaceutically acceptable carriers and/or excipients. The compound and composition are useful for inhibiting the activity of a p38 MAP kinase enzyme. As such they may be used in the treatment of a autoimmune or inflammatory disease, or a cell proliferative disease. In addition, the invention provides an acid produced by hydrolysis of the ester group of the compound of the invention. The acid is N-[2-{4-[6-amino-5-(2,4-difluorobenzoyl)-2-oxopyridin-1(2H)-yl]-3,5-difluorophenyl}ethyl)-L-alanine. |
US09896414B2 |
Covalently patterned graphene surfaces by a force accelerated cycloaddition reaction
The present invention relates generally to molecular printing techniques for use in sensors, assays, and integrated optics and electronics. Specifically, the present invention relates to covalent patterning of graphene surfaces. |
US09896412B2 |
Reagents and method for conjugating biological molecules
A compound of the general formula X-[Q-W—(CH═CH)n—(CH2)2-L]m (I) in which X represents a polymer; Q represents a linking group; W represents an electron-withdrawing group; n represents 0 or an integer of from 1 to 4; L represents a leaving group; and m represent an integer of from 1 to 8. The compounds find use in the conjugation of biological molecules. |
US09896406B2 |
Method for producing 2-methylbutyric acid having a reduced content of 3-methylbutyric acid from the secondary flows arising in the production of pentanoic acids
A process for preparing 2-methylbutyric acid having a reduced content of 3-methylbutyric acid from the secondary streams obtained in the preparation of pentanoic acids, includes generating a stream enriched with 2-methylbutanal and 3-methyl-butanal. The stream enriched with 2-methylbutanal and 3-methylbutanal of step is reacted with formaldehyde. The reaction with formaldehyde is followed by removal of the organic phase and selective hydrogenation in the presence of a hydrogenation catalyst with hydrogen at elevated temperature and elevated pressure and, after removal of the hydrogenation catalyst, treatment of the hydrogenation output obtained with an oxidizing agent. |
US09896405B2 |
Methods for the production of α,β-unsaturated carboxylic acids and salts thereof
Processes for producing an α,β-unsaturated carboxylic acid, such as acrylic acid, or a salt thereof, using treated solid oxides are disclosed. The treated solid oxides can be calcined solid oxides, metal-treated solid oxides, or metal-treated chemically-modified solid oxides, illustrative examples of which can include sodium-treated alumina, calcium-treated alumina, zinc-treated alumina, sodium-treated sulfated alumina, sodium-treated fluorided silica-coated alumina, and similar materials. |
US09896404B2 |
Bidentate diphosphoramidites with a homopiperazine group as ligands for hydroformylation
The invention relates to Rh, Ru, Co and Ir complexes comprising bidentate diphosphoramidites as ligands and to the use thereof as catalysts for the hydroformylation of olefins. The invention also relates to a process for preparing an aldehyde from an olefin using the complexes or ligands mentioned. |
US09896399B2 |
Selective hydrogenation method for phenylacetylene in the presence of cracking C8 fraction
Provided is a method for selective hydrogenation phenylacetylene (PA) in cracked C8 fraction, which adopts a hydrogenation reactor featuring an upper catalyst bed and a lower catalyst bed, and operated by the following steps: feedstock cracked C8 fraction is supplied through the lower bed while hydrogen is supplied through the gas distributor located below the lower bed and increases the bed temperature to 0-20° C., and gas distributor located below the upper bed increases the upper bed temperature to 0-15° C., the reaction effluent from the upper bed is subsequently passed through and recovered from the packing layer. The method is characterized with low loss rate of styrene after hydrogenation and high hydrogenation rate of phenylacetylene. |
US09896394B2 |
Method for improving propane dehydrogenation process
A propane dehydrogenation and propylene purification process in which a stream comprising propylene, propane, and methyl acetylene and propadiene (MAPD) is mixed with a hydrogen stream then reacted in at least three distinct reaction zones in a hydrogenation reactor system where MAPD is hydrogenated by a high-selectivity hydrogenation catalyst in a first reaction zone, and a second and a third reaction zones each have a low-selectivity hydrogenation catalyst to remove unreacted hydrogen. The outlet stream leaving the hydrogenation reactor system is MAPD-free and can be fed to a splitter column, which now mainly serves to separate propylene from propane. Various embodiments of reaction zone arrangements in a single or multiple reactors are also provided. |
US09896389B2 |
Heat-generating multi-compartment microcapsules
A multi-compartment microcapsule produces heat when subjected to a stimulus (e.g., a compressive force, a magnetic field, or combinations thereof). In some embodiments, the multi-compartment microcapsules have first and second compartments separated by an isolating structure adapted to rupture in response to the stimulus, wherein the first and second compartments contain reactants that come in contact and react to produce heat when the isolating structure ruptures. In some embodiments, the multi-compartment microcapsules are shell-in-shell microcapsules each having an inner shell contained within an outer shell, wherein the inner shell defines the isolating structure and the outer shell does not allow the heat-generating chemistry to escape the microcapsule upon rupture of the inner shell. |
US09896386B2 |
Atmospheric greenhouse gas removal
A material (such as potassium hydroxide or ammonia) capable of reacting with ambient carbon dioxide to produce fertilizer is placed in the path of ambient air movement. Desirably the material is associated with a fabric which in turn is associated with a vane of a vertical axis wind turbine, the turbine performing useful work as well as supporting the material which produces a fertilizer. A misting system controlled by a controller may automatically apply a water mist to the material if the humidity is below a predetermined level. The fabric with produced nitrogen and/or potassium fertilizer may be placed directly into contact with soil, or shredded first, or burned to produce energy and an ash (and the ash applied to the soil). The wind turbine may have a convenient, versatile mounting system with three adjustable legs supporting a central component, and the spokes of the wind turbine may be slotted for easy assembly with vanes. |
US09896383B2 |
High zirconia electrically fused cast refractory
A high zirconia electrically fused cast refractory having long time durability with less cracking during production and in the course of temperature rising, excellent in productivity, less forming zircon crystals in the refractory itself and even in contact with molten glass, excellent in bubble foamability to molten glass, less generating cracks even undergoing heat cycles during operation of a glass melting furnace. A high zirconia electrically fused cast refractory comprises, as chemical component, 85 to 95% by weight of ZrO2, 0.4 to 2.5% by weight of Al2O3, 3.5 to 10.0% by weight of SiO2, 0.05% by weight or more of Na2O, 0.05 to 0.7% by weight of Na2O and K2O in total, 0.01 to 0.04% by weight of B2O3, 0.1 to 3.0% by weight of SrO or BaO when one of BaO and SrO is contained, 0.1% by weight or more of SrO and 0.1 to 3.0% by weight of SrO and BaO in total when both of BaO and SrO are contained, 0.01 to 0.2% by weight of CaO, 0.1% by weight or less of MgO, 0.01 to 0.7% by weight of SnO2, 0.3% by weight or less of Fe2O3 and TiO2 in total, less than 0.01% by weight of P2O5, and less than 0.01% by weight of CuO. |
US09896382B2 |
Fiber-reinforced structures and processes for their manufacture
Disclosed is a structure of a matrix, reinforced with a plurality of polymeric fibers protruding from at least a portion of the structure surface, the fibers being capable of endowing (attributing) the at least a portion of the surfacewith biological or chemical resistance. In some embodiments, the polymeric fibers, as further discussed hereinbelow, contain or are coated with at least one biological or chemical agent which further contributes to the endowment of biological or chemical resistance. |
US09896380B2 |
Water-based grouting composition with an insulating material
According to an embodiment, a method for thermally insulating a portion of a tubular located inside an enclosed conduit comprises the steps of: (A) introducing a grouting composition into an annulus between the tubular and the enclosed conduit, the grouting composition comprising: (i) a water-swellable binding material comprising water-swellable clay; (ii) an aqueous liquid, wherein the aqueous liquid is the continuous phase of the grouting composition; and (iii) an insulating material; and (B) allowing the grouting composition to set after the step of introducing, wherein after setting the grouting composition has a thermal conductivity of less than 0.3 BTU/hr·ft·° F. According to another embodiment, a grouting composition for use in insulating a portion of a tubular located inside an enclosed conduit comprises: (A) a water-swellable binding material comprising water-swellable clay; (B) an aqueous liquid, wherein the aqueous liquid is the continuous phase of the grouting composition; and (C) an insulating material, wherein after the grouting composition has set, the grouting composition has a thermal conductivity of less than 0.3 BTU/hr·ft·° F. |
US09896373B2 |
Method and apparatus for large feature creation in glass and glass-ceramic articles
The disclosure provides a method for forming a hole in a glass or glass-ceramic sheets. The method includes scoring a major surface of a glass or glass-ceramic sheet to define the hole, placing the sheet on a cavity-containing receiving surface such that a peripheral edge of the cavity is positioned external to the area bounded by the first score, and fracturing the sheet along the score to break away the portion of the sheet defined by the first score. The method allows for the formation of large openings in thin glass sheets where the mother sheet is not broken or damaged by the formation of the opening. |
US09896372B2 |
Method and apparatus for scoring thin glass and scored thin glass
A method and apparatus for scoring thin glass for the purpose of score and break separation as well as an accordingly prepared scored thin glass are provided. The scoring tool is pressed onto the thin glass and drawn along the scoring line with an adjusted scoring contact pressure force as a vertical scoring force component. This permits to production of prescored ultrathin glass of Knoop hardness from 350 to 650 with a score depth from 1/20 to ⅘ of the material thickness. |
US09896368B2 |
Methods and apparatus for additive manufacturing of glass
In illustrative implementations of this invention, a crucible kiln heats glass such that the glass becomes or remains molten. A nozzle extrudes the molten glass while one or more actuators actuate movements of the nozzle, a build platform or both. A computer controls these movements such that the extruded molten glass is selectively deposited to form a 3D glass object. The selective deposition of molten glass occurs inside an annealing kiln. The annealing kiln anneals the glass after it is extruded. In some cases, the actuators actuate the crucible kiln and nozzle to move in horizontal x, y directions and actuate the build platform to move in a z-direction. In some cases, fluid flows through a cavity or tubes adjacent to the nozzle tip, in order to cool the nozzle tip and thereby reduce the amount of glass that sticks to the nozzle tip. |
US09896366B2 |
Alternative additives to enhance slurry dewatering
The invention provides methods and compositions for improving dewatering of mineral slurry. The method comprises adding an R-Succinic Compound (such as octadecenyl succinic acid, hexadecenyl succinic acid, and/or dodecenyl succinic acid) to the slurry. The R-Succinic Compound removes water that would otherwise be trapped within the filtered slurry cake. |
US09896365B2 |
Seawater desalination system and seawater desalination method
A seawater desalination system includes an intake part buried in a sand layer of the seafloor to take in seawater passed through the sand layer, an anterior filtration part filtering seawater conveyed from the intake part, and a posterior filtration part filtering seawater conveyed from the anterior filtration part, using a reverse osmosis membrane. The anterior filtration part includes a first anterior filtration line including a first ultrafiltration membrane, a second anterior filtration line including a second ultrafiltration membrane having a molecular weight cut-off less than that of the first ultrafiltration membrane, and a switching part switching a path through which seawater flows between the first and second anterior filtration lines provided in parallel with each other. The system controls the switching part in accordance with dissolved oxygen content in the seawater taken in by the intake part, thereby improving the efficiency of seawater filtration with the ultrafiltration membranes. |
US09896364B2 |
Synergistic interaction of weak cation exchange resin and magnesium oxide
The present invention relates to methods, apparatuses, and systems for treating water. The methods, apparatuses and systems reduce scaling associated with solubilized water hardness using a sequence of water treatment agents, including an inlet, one or more treatment reservoirs containing a first treatment agent that is an exhausted ionic resin that is incapable of performing ion exchange and a second treatment agent consisting of a metal oxide and/or hydroxide compound, an outlet, and a treated water delivery line. |
US09896362B2 |
Self-sinking aeration hose
Disclosed herein is an aeration hose capable of diffusing bubbles of air within a body of water, comprising a) a hose portion derived from a composition, comprising a polyvinyl chloride resin; a first rubber component; a second rubber component; at least one copolymer; at least one low temperature plasticizer; at least one filler comprising antimony trioxide; at least one heat stabilizer; at least one internal lubricant; at least one antioxidant; and at least one biofouling agent, wherein the hose portion comprises an outer hose portion, an inner hose portion and a plurality of hose apertures capable of receiving and diffusing pressurized air, wherein the hose is flexible and has no memory, wherein the hose apertures are provided therethrough the inner hose portion and the outer hose portion and proportionally spaced about the outer hose portion along a length of the hose portion. |
US09896351B2 |
Method for removal of radionuclides in liquids
A vessel for treatment of radioactive liquid. The vessel comprises a shielded housing defining an ion exchange chamber therein. The ion exchange chamber is configured to receive ion exchange media in its interior between an interior top surface and an interior bottom surface. The vessel further comprises an inlet diffuser disposed in the ion exchange chamber proximate the bottom surface and an outlet collection header disposed in the ion exchange chamber proximate the top surface. Also, the vessel comprises a process inlet in fluid communication with the inlet diffuser and a process outlet in fluid communication with the outlet collection header. |
US09896346B2 |
Synthesis method of lithium-titanium oxide using solid-state method
A method for synthesizing lithium-titanium oxide using a solid state method includes: mixing lithium oxide (Li2O) and titanium oxide (TiO2) in a solvent; separating a solid material which includes lithium oxide and titanium oxide from the solvent; drying the solid material separated from the solvent; and performing a heat treatment on the solid material. |
US09896337B2 |
Apparatus and method for generating nitric oxide in controlled and accurate amounts
A nitric oxide generator generates nitric oxide from a mixture of nitrogen and oxygen such as air treated by a pulsating electrical discharge. The desired concentration of nitric oxide is obtained by controlling at least one of a frequency of the pulsating electrical discharge and duration of each electrical discharge pulse. |
US09896332B2 |
Ammonia oxidation/decomposition catalyst
Provided is an ammonia oxidation/decomposition catalyst which can decrease the reduction temperature of a support, which is required for the catalyst to have a property of being activated at room temperature, and also can render a property of being activated at a temperature lower than room temperature. The ammonia oxidation/decomposition catalyst of the present invention is an ammonia oxidation/decomposition catalyst, comprising: a catalyst support composed of a composite oxide of cerium oxide and zirconium oxide; and at least one metal selected from the group consisting of metals of group 6A, group 7A, group 8, and group 1B as a catalytically active metal deposited thereon, characterized in that the molar concentration of zirconium oxide in the catalyst support is from 10 to 90%. |
US09896325B2 |
Vacuum vapor liquid recovery system
A vacuum vapor liquid recovery system employs a strong vacuum vessel that can withstand vacuums without damage. The vacuum vessel may be portable and configured to accept an inflow drain line for receiving waste liquid/vapors from a processing system. Additionally, at least one outflow drain line is attached to the vacuum vessel to which a vacuum truck or other similar recovery equipment can be connected in order to pump out whatever liquids/vapors have been drained into the vacuum vapor liquid recovery system. Additional features can include wheels to assist in moving and positioning the vacuum vapor liquid recovery system, tow bar, transport handles, support legs, sight port, a wash out connector, a vacuum relief, etc. |
US09896324B2 |
Apparatus and method for displacing air from wine containers
A device for preventing air from displacing wine poured from a bottle. A retainable spout assembly comprises a bottle seal, a base having a liquid channel and vent channel, and a spout. A disposable bag assembly comprises folded limp inflatable bag attached to a vent tube which is attachable to the vent channel. As wine is poured, air enters the vent tube and inflates the pliable bag. After the bottle contents are consumed, the retainable subassembly may be removed from the disposable subassembly by leaving the disposable subassembly in the bottle or container. The retainable subassembly may be cleaned, and a replacement subassembly attached to the vent channel before inserting into a new container. The air displacement device may be inserted into a bottle before or after pouring wine. A pump or manual blow tube can be used to remove air from a partially-filled bottle. |
US09896320B2 |
System and method for storing and selectively dispensing liquids
The inventive system and method advantageously enable superior preserved storage and selective dispensation of liquids by storing wine (or other liquids) in a pressurized environment to ensure that the stored liquid does not come into contact with air, and then by selectively dispensing a portion of the stored liquid, in accordance with a desired dispensing regime, by utilizing a controlled source of pressure force to apply a sufficient pressure to the pressurized environment to expel the desired volume of the liquid in a pressurized stream directed to a dispensing/pouring interface through a conduit or equivalent delivery system. In at least several novel embodiments thereof, the system and method of the present invention are configured for use with wine-in-bag (“WinB”) products. |
US09896317B2 |
Laboratory test tube handling device
The present application is directed towards the handling of laboratory test tubes. More particularly to a specialized laboratory device that enables manual opening, closing and capping of multiple test tubes with integral sealing caps. The Laboratory Test Tube Handling Device permits the user to perform multiple processes simultaneously more efficiently and rapidly than current practice. |
US09896316B2 |
End effector for a transport device for the movement of parent rolls of convolutely wound web materials
An end effector for a transport device for the movement of parent rolls of convolutely wound web materials is disclosed. The end effector comprises a frame, first and second radial members operably connected to the frame, a first core plug operably connected to the first longitudinal member, and a second core plug operably connected to the second longitudinal member. A first core plug extensible from a first position to a second position relative to the first longitudinal member and a second core plug extensible from a first position to a second position relative to the second longitudinal member are capable of cooperative and penetrating engagement with a core of the parent roll. |
US09896315B2 |
Systems, devices and methods of controlling motorized transport units in fulfilling product orders
Some embodiments include apparatuses to fulfill customer orders comprising a motorized transport unit; a product pick unit (PPU) that cooperate with the motorized transport unit; a wireless communication network; and a central computer system configured to communicate with the multiple motorized transport units and the plurality of product pick units, and comprises a control circuit and memory storing instructions executed to cause the control circuit to: communicate an instruction to the motorized transport unit and direct the motorized transport unit to transport the product pick unit to a determined first location within the shopping facility proximate to where a first product having been ordered is located; and communicate an instruction to the product pick unit cooperated with the motorized transport unit and direct the product pick unit to retrieve the first product. |
US09896312B2 |
Method and apparatus for making status reporting devices for container handlers
A mechanism and method for making status reporting devices for container handlers, including: providing a micro-controller module, and installing a program system into memory accessed by a computer directing the micro-controller module. The micro-controller module communicatively couples with means for wirelessly communicating and for sensing a state of the container handler. Means for wirelessly communicating may include means for wirelessly determining container handler location. The micro-controller module may be communicatively coupled to a separate means for determining location. An apparatus making the devices may include a second program system directing the invention's method through a second computer, which may control an assembly device in creating the micro-controller, coupled with the means for sensing and for wirelessly communicating. |
US09896309B2 |
Object detector, and method for controlling a passenger conveyor system using the same
A passenger detector (10) for use in a passenger conveyor system (12) is provided that includes a structured light source (34), a structured light detector (36), and a controller (38). The structured light source (34) is operable to project light (40) into a detection area (32) in a predetermined projected pattern. The structured light detector (36) is operable to generate reflected light signals indicative of light (40) reflected back toward the structured light detector (36) from the detection area (32). The controller (38) is operable to receive the reflected light signals from the structured light detector (36), and operable to process the reflected light signals to make a determination as to whether a passenger is disposed within a detection area (32). |
US09896307B2 |
Elevator rope and elevator apparatus that uses same
In an elevator rope, an inner layer rope includes: a plurality of steel inner layer strands; and a resin inner layer rope coating body that is coated onto an outer circumference. A plurality of outer layer strands are twisted together on an outer circumference of the inner layer rope. The outer layer strands each include: an outer layer strand fiber core; and a plurality of steel wires that are twisted together on an outer circumference of the outer layer strand fiber core. |
US09896306B2 |
Apparatus and method for dampening oscillations of an elevator car
A method and apparatus for dampening oscillations of an elevator car retains the active control of an elevator system in the presence of displacement. This active control may be maintained via the use of an actuator that tailors Lorentz force relative to the level of displacement along a non-linear continuum. |
US09896305B2 |
Personalized elevator dispatch
A routing plan for elevator passengers can be developed by a computer system, when there are a plurality of elevator users requesting service from a plurality of elevators. The routing plan can be based on user input that specifies a destination and a current location. Profile data for each user can also be used to develop the routing plan. The input and profile data is correlated with a shared resource in each elevator, and the routing plan is developed from the correlated data. The plan is then communicated to the users. |
US09896304B2 |
Security system for elevator
A method of operating an elevator system includes presenting a credential at a security panel disposed at an elevator system landing of a public area of a building. If the presented credential is correct a contact between the security panel and an elevator control system is opened. Opening of the contact allows for placement of a call via the elevator control system for an elevator car to the landing. An elevator system includes one or more elevator cars located in one or more hoistways. An elevator control system controls movement of the elevator cars. A security panel is operably connected to the elevator control system and located at an elevator system landing. Presenting a correct credential at the security panel opens a contact between the security panel and the elevator control system thus initiating a call of an elevator car of the one or more elevator cars to the landing. |
US09896303B2 |
Method for controlling elevator cars
A method for controlling elevator cars of an elevator system according to one example includes assigning free elevator cars of the elevator system to one of either general service or express priority service (EPS). A destination dispatch controller receives an express priority service (EPS) call. The EPS call can indicate a request for priority service from an EPS call originating location to an EPS call final destination. The controller can determine whether any active EPS assigned car can service the EPS call. A particular elevator car can be an active EPS car when the particular car is carrying out EPS service. When a specific active EPS car can service the EPS call, the controller assigns the specific EPS car to the EPS call. Upon completion of the EPS call, the controller unassigns the EPS car to a free car. |
US09896300B2 |
Composite reeling device
A composite reeling device for winding up and letting out cables, steel ropes and cords includes a shaft, a sleeve, two outer wheel frames and a plurality of inner wheel frames. Two fixing end plates are disposed at two opposing ends of the shaft, respectively. The sleeve is fitted around the shaft. Fixing flanges are disposed at two opposing ends of the sleeve, respectively. The fixing flanges correspond in position to the fixing end plates, respectively. The outer wheel frames are disposed at the two ends of the sleeve, respectively, and removably coupled to the fixing flanges and the fixing end plates, respectively. The inner wheel frames each have a belt, a supporting ring and spokes. The spokes each have two ends connected to corresponding ones of the belts and the supporting rings. The belts are fitted around the sleeve. |
US09896299B2 |
Endless belt flexible tube cleaning lance drive apparatus
A flexible lance drive device has at least one drive motor in a first portion of a housing and a drive axle projecting across a second portion of the housing carrying a cylindrical spline drive roller. A plurality of cylindrical guide rollers on fixed axles span across the second portion of the housing aligned parallel to the spline drive roller. An endless belt wrapped around the at least one spline drive roller and guide rollers has a generally smooth outer surface and a transverse splined inner surface having splines shaped complementary to splines on the spline drive roller. A bias member supports a plurality of follower rollers each aligned vertically above one of the at least one spline drive roller and guide rollers operable to press each follower roller toward one of rollers to frictionally grip a flexible lance hose when sandwiched between the follower rollers and the endless belt. |
US09896291B2 |
Sheet conveying apparatus and image forming apparatus
A sheet conveying apparatus includes a first conveying portion conveying a sheet, a second conveying portion including an abutment portion against which a front end of the sheet conveyed by the first conveying portion abuts and conveying the sheet, a curved guide including a curved portion and forming a curved sheet conveying path between the first and second conveying portions, and a moving portion disposed to overlap widthwise with the curved portion and movable between a projecting position where the moving portion projects to the sheet conveying path and a recede position where the moving portion recedes. The moving portion is moved to from the projecting position to the recede position by being pressed by the sheet as the sheet is conveyed by the first conveying portion in a state in which the front end of the sheet abuts against the abutment portion. |
US09896289B2 |
Automated film pickup and placement method for insulating glass units
A method of automatically mounting a sheet from a cutting table onto a spacer frame of an insulating glass unit begins with identifying a position and orientation of a specified sheet on the cutting table and moving a robotic sheet pickup apparatus to a corresponding position to that identified for the sheet. An edge of the specified sheet is lifted off of the table, beginning with mechanical suction that brings a corner of the sheet to within proximity of a primary vacuum suction of the pickup apparatus. In particular, the pickup apparatus may have a substantially planar platen with a set of channels coupled to a vacuum source. Once the sheet is fully picked up by vacuum suction, the sheet is laid upon a top surface of a tilt table, which can be simply the platen inverted. The table (or platen) is tilted to bring a corner of the sheet to abut against physical fences. Once the position and orientation of the sheet is so known, the sheet is oriented to correspond to a frame, and attached thereto. |
US09896286B2 |
Roller
There is provided a roller including: a roller body part; and a rubber part attached to the roller body part, the rubber part including: a rubber body part provided on an outer circumference of the roller body part; and a side extending part extending on a side face of the roller body part from a side face of the rubber body part, wherein the roller body part has a recess portion formed on the side face of the roller body part, and into which the side extending part is fitted. |
US09896281B2 |
Container processing machine and method for operating a container processing machine
A container-processing machine includes a rotor with processing positions formed thereon, a transfer station, and a static lifting element used by all the processing positions. Each processing position has a processing head and a container carrier. The lifting element is a static lifting element that is used by all of the processing positions. When the processing position is at the transfer station, the lifting element causes relative motion between a container carrier and a processing head of the processing position. This causes the processing position to transition between receiving and discharge states. |
US09896278B2 |
Item infeed apparatus and method for a palletizer
An infeed apparatus includes an item manipulator that orients items such as cases in a desired orientation as determined by a build menu, and a row build apparatus that is synchronized with the manipulator to space items pursuant to the build menu. The manipulator uses a pusher to push items across a friction belt to thereby orient the items, and includes sensors for determining when an item is in an incorrect orientation. The row build receives items from the pusher and is selectively advanced to locate items in a desired relative orientation so that rows of items are built correctly. |
US09896277B2 |
Component supply device
A component supply device is arranged adjacent to a mounter which mounts components on a board and supplies components to the mounter. This component supply device includes a replenishment section provided with a magazine which houses a component carrying member on which multiple components are arranged on a base material, and a conveyance section which conveys a component carrying member housed in the magazine and which is equipped with side surface number one to which the replenishment section is attached and side surface number two which is arranged adjacent to the mounter. The replenishment section is slidably attached with respect to side surface number one of the conveyance section. |
US09896275B2 |
Article transport facility
An article transport facility comprises a travel rail installed along a travel path, and a travel vehicle which is guided along the travel path with a travel wheel rolling on a travel surface of the travel rail. The travel vehicle has a distance measuring device for measuring a distance to the travel surface. And the distance measuring device includes a pair of distance sensors spaced apart from each other along a travel direction of the travel vehicle. |
US09896273B2 |
Article supply apparatus
An article supply apparatus includes an inclined passage which inclines downwardly toward a predetermined direction, a vibration imparting device which vibrates the inclined passage, an article feeding device which feeds a plurality of articles to the upper end side of the inclined passage, a visual sensor which captures images of the articles on the inclined passage and which obtains information for identification of at least a position of each of the articles on the inclined passage, and a robot arm which picks up the articles one by one from the inclined passage by using the information obtained by the visual sensor and which supplies the picked-up articles to a predetermined supply destination. |
US09896270B2 |
Flexible manual storage system
The invention relates to a flexible manual storage system comprising: a rolling track (3); piece-holding chains (1, 1′, 1″) formed by a variable number of crossbars (1a, 1b, 1c) provided with through-holes (12) form which pieces can be suspended; shock absorbing end parts (4) and carns (6) for connecting consecutive piece-holding chains (1, 1′, 1″); and rolling assemblies (2) provided with a casing (25) having a U-shaped cross-section and equipped with at least one pair of rollers (26) bearing on a guide (31) of a rolling track (3) and with a vertical shaft (21) for supporting the crossbars of a piece-holding chains. The rolling track (3) comprises at least one first segment (3a) and one second segment (3b) that can be coupled to one another and a station (8) at which successive piece-holding chains can be stopped and disconnected from one another. |
US09896268B1 |
Multitrack storage system for open crawl space
A multitrack storage system for open crawl space includes: a) different sets of tracks for guiding separate, wheeled storage bins, wherein the tracks have a proximal and a distal end; b) a bumper at the distal end of each set of tracks to prevent off track movement; c) separate, wheeled storage bins, each storage bin having a plurality of bottom wheels and a plurality of side wheels, and nests on the track base; d) a bin movement mechanism connected to at least one separate, wheeled storage bin for movement; e) a proximal end for different sets of tracks, wherein the tracks terminate adjacent one another in a predetermined pattern; f) a drop down gate for access to different sets of tracks; wherein a user may store items in the wheeled storage bins and move the storage bins along different sets of tracks away from the central terminus for storage. |
US09896266B2 |
Bag stand
A subpanel for a bag stand includes: a first side panel and a second side panel, each of the first side panel and the second side panel including a top end, a bottom end, two side ends, an inner surface, an outer surface, and a thickness defined from the inner surface to the outer surface. The first side panel additionally includes a connection finger, the connection finger connected to a first side end of the two side ends of the first side panel, the connection finger including a clearance portion and a clasp portion. The second side panel is at least indirectly connected to the first side panel and defines a connection recess in a first side end of the two side ends of the second side panel distal from the first side panel, the connection recess including a clearance portion and a lock portion. |
US09896264B2 |
Freight rack
[Problem] Provided is a freight rack that improves rigidity for supporting freight and also allows pillars and a freight mounting frame to be folded or erected on a base member without use of a machine such as a forklift.[Solution] On a base member (10), two sets of portal supports (30), (40), in which right and left pillars (31), (41) and a horizontal member (32), (42) are coupled to each other, stand with an interval in a front and rear direction, where the horizontal member is vertically shiftable along the pillars and fixed to the pillars at a selected height. A freight mounting frame (20) is supported by the horizontal member (42) of one portal support (40) so as to be rotatable in a vertical plane, and is also placed on the horizontal member (32) of the other portal support (30) so as to be movable in the front and rear direction. |
US09896262B2 |
Storage box using cushion package structure
A cushion package structure includes at least a plate and two or more blocks. The plate is disposed within a storage box and the blocks are the same and pivotable with one another. As a number of blocks are connected with one another serially with various including angle between each adjacent two, one or multiple block sets may be formed thereby. Positioning holes on the plate having substantially same contour as corresponding positioning sections on the blocks are further prepared to engage with the positioning sections as the block sets are put to be disposed on the plate, thereby forming a storage space with a specific shape within the storage box. The blocks may be removed from the plate, rearranged, and redisposed on another plate, so that a storage space with a different shape may be defined. |
US09896256B2 |
Dunnage bag arrangement
The invention discloses a dunnage bag arrangement for securing loads, includes an inflatable dunnage bag having a gastight inflatable bladder; and a hanger member connected to the dunnage bag and adapted to being supported on top of loads and adapted to support the dunnage bag in a void between loads. The dunnage bag includes a reinforcing sleeve made of at least one material ply, the sleeve having a first opening and a second opening, and the sleeve being folded and sealed and/or stitched to close off at least one of the openings. |
US09896252B2 |
Cable tie
A cable tie having a desired length of flexible belt and a buckle connected to one longitudinal end of the belt may include rack teeth that are formed in one surface of the belt and are arranged in a longitudinal direction of the belt, an engagement strip that is positioned in a through hole of the buckle and is configured to be deformed about its proximal end connected to an inner wall of the buckle, and an engagement claw that is formed in the engagement strip. The engagement strip is configured to be deformed due to contact with the belt inserted into the through hole of the buckle, so that a crossing angle is formed between the engagement surface of the engagement claw and the tooth surface of one of the rack teeth in a fastened condition in which the belt is inserted into the through hole of the buckle and is tightened. |
US09896246B2 |
Portable beverage container with self opening hinged lid
A portable beverage container (e.g., an insulated, double-walled bottle) is disclosed. The container includes a lid pivotably connected to it by a hinge. The lid is arranged to be automatically pivoted open by the spring assembly when a catch on the lid is released so that the lid opens in a controlled, non-jarring manner. The spring assembly comprises an elastomeric member and a contact surface (e.g., a recess in a cap of the bottle). The elastomeric member is arranged to cooperate with the contact surface whereupon the elastomeric member operates bi-modally to effect the automatic opening of the lid. |
US09896244B2 |
Linkable workstations
Linkable workstations are provided that define a reservoir for containing liquid. The linkable workstations can be nested together in a compact vertical space. The workstations include a plurality of high rim portions and a plurality of low rim portions. The high rim portions on a workstation are configured to overlap a low rim portion of another workstation to link workstations side to side to form custom configurations. The workstations include overflow channels that allow for the sharing of the liquid containing capacity between linked workstations, and which can be selectively sealed to prevent fluid from flowing therethrough. |
US09896241B2 |
Reclosable package or bag with scented zipper
The zipper for a reclosable package wherein the zipper includes fragrance-carrying oil within an internal zipper volume or storage volume thereby confining the scent while the zipper and the package are closed. When the zipper is opened, the scent is allowed to escape to the consumer. |
US09896240B2 |
Humidity control package
A humidity controlled package that uses a humidity sensitive valve that opens and closes an opening to control a humidity in the package. The package has a package holding area inside the package. The humidity level in the package controls the valve to open to allow air flow between an inside of the valve and an outside of the valve, and close to prevent air flow between the inside and outside of the valve. At least part of the valve is in the package. In one embodiment, the package is vented when the humidity value gets higher than a setpoint. In another embodiment, a sachet of dessicant is opened by the humidity level. |
US09896236B2 |
Frame for divided water tank
A tank has a circumferential wall defined by a plurality of separate elements in the form of vertical staves. Adjacent elements are shaped so that they are squeezed together to prevent leakage past adjacent elements. Hoops surround the wall elements. One hoop is a plurality of segments. Truss rods connect separate elements of the hoop to a support inside the tank. The truss rods of the hoop connect the hoop segments to the inside support in the tank and are tightened thereto for drawing the hoop wall elements inward to the truss rod supports, squeezing the adjacent wall elements together for preventing leakage between adjacent elements. A divider across the tank has the supports thereon for receiving the ends of the truss rods in the tank. Other staves define a divider of staves. Vertical beams support them. |
US09896234B2 |
Wraparound shipping box blank with system and method of forming blank into a shipping case
A corrugated paperboard wraparound blank for forming a shipping case is provided, including five wall panels and four sets of end flaps connected via fold lines, at least two sets of stacking tabs, and at least two corresponding sets of receiving slots for receiving the stacking tabs. The wraparound blank is formed of a heavier material than a conventional blank, which would typically be difficult for automatic packaging equipment to form into a case, but the fold lines are creased with optional perforations or scoring. An optional modification aiding folding is presented for conventional case packers. The heavier fiberboard better supports and protects an inner product, such as cartons or paper bottles of liquids and reduces damage to the cap and neck. The heavier material in combination with the stacking tabs allows an increase in stacking height, thereby reducing transportation costs. |
US09896232B2 |
Cleaning, polishing, and restoring emulsion and method of making and packaging the emulsion
A method of making a liquid or semi-liquid emulsion cleaning, waxing, and restoring product with applicability to painted motor vehicles. The emulsion removes bugs, tar and paint from other vehicles, etc. and is safe for paint, plastic, chrome and wheels. The emulsion is prepared using a unique sequence of mixing steps that result in a complete emulsification of ingredients that heretofore have been difficult or impossible to effectively combine. The emulsion may be provided in liquid or paste form or in microfiber cloths, or disposable towelettes, and other such carriers infused with the emulsion. The carrier is moistened with the emulsion and packaged in sealed individual packages. In other embodiments, multiple emulsion-soaked towels or towelettes may be packaged in reclosable cylinders from which individual towels may be extracted and the cylinder reclosed. These pre-soaked towelettes may be used to easily clean and wax vehicles or other similar surfaces. |
US09896231B2 |
Packaging station system and related methods
Implementations of the present invention relate to systems and methods for processing paperboard and similar fanfold materials into packaging templates and packaging orders using the packaging templates. More specifically, the described embodiments relate to methods of processing orders available for packaging, such as to reduce the time and cost of producing custom-size packaging templates, building custom-sized packaging boxes, and packaging orders in the boxes. |
US09896229B1 |
Stretch wrapping apparatus and method
A stretch wrapping apparatus for use with an automated palletizing machine to securely stabilize loads. A stretch wrapping head feeds pre-stretched wrapping film toward the rotating load and air jets blow the tail of the film onto the load. Relative rotational movement is created between the wrapping head and the load and the free end of the film is unsupported by any mechanical structure and is directed toward the load only with air from the jets. The film attaches to an outer surface the load. Film is dispensed at a rate to provide payout of film that is consistent with the demand as each load corner transitions through its relative distance change from the dispensing point based on calculations intervals. A sensor detects changes in the optical character of the film to determine an out of bounds condition such as a film break. |
US09896224B2 |
Form, fill and seal apparatus and methods for applying one-way valves to flexible packages
Disclosed are apparatus and methods for producing bags filled with a flowable particulate material from a continuous tube of flexible material. The apparatus includes a one-way valve application station having a valve applicator mechanism and a cutting and heating mechanism configured for movement with the bag through the apparatus. The valve applicator mechanism holds a one-way valve for insertion within the bag as the bag is moved through the apparatus. The cutting and heating mechanism is configured to be moved in unison with the valve applicator mechanism to cooperate with it to cut a vent hole in the bag at the valve and to weld the valve to the bag. Then the valve applicator mechanism and the cutting and heating mechanism are moved to apply another one-way valve to another filled bag and the bag with the valve secured thereto is sealed. The resulting sealed bag is suitable for stable palletization. |
US09896223B2 |
Pump systems for controlling pressure loads
A pump system for controlling a pressure load delivered to an aircraft interface included in the pump system is disclosed. The pump system includes a pump circuit, a pump, and a valve system. The pump is coupled with the conduits and is configured to provide a pressure load to the aircraft interface to move fuel from a fuel reservoir through the conduits toward the aircraft interface in a fueling mode and to move fuel from the aircraft interface through the conduits toward the fuel reservoir in a defueling mode. The valve system is coupled to the conduits and configured to control the pressure load delivered to the aircraft interface to block the pressure load from exceeding either of a high-pressure threshold and a delta-pressure threshold. |
US09896220B2 |
Aircraft antenna cover, aircraft member cover, aircraft, and rain erosion boot for aircraft
An antenna cover of an aircraft including: a cover that protects an antenna mounted in the aircraft; a conductive layer having conductivity that is provided on an outer side of the cover; and a rain erosion boot that covers one region of the conductive layer, wherein the rain erosion boot includes a main material having an insulating property, is given conductivity, and is grounded to an airframe via the conductive layer, or the rain erosion boot includes a main material having an insulating property, and is given hydrophilicity. |
US09896219B2 |
Flow inlet
An apparatus is formed of a cowl and a flow inlet formed on an interior surface of the cowl. The flow inlet has a supersonic compression section attached to a subsonic diffusion section at a throat. The supersonic compression section includes an at least partially elliptical compression ramp which extends along an approximately 180 degree arc along the interior surface. The flow inlet may form part of an aircraft. A method of air flow using the flow inlet is also disclosed. |
US09896218B2 |
Aircraft vapour trail control system
The invention concerns an aircraft propulsion control system in which multiple gas turbine engines (10) are under the control of a controller (30). One or more sensor is arranged to sense a condition indicative of vapor trail formation by an exhaust flow from one or more of the engines. The controller (30) is arranged to be responsive to a thrust demand (51) for the aircraft and to control the thrust produced by each of the engines (10) concurrently so as to alter the efficiency of the engines upon sensing of the vapor trail formation condition, while satisfying the aircraft thrust demand. The controller (30) may output a separate throttle control signal (35) to each engine (10). |
US09896212B2 |
Integrated centerline lavatory galley monument
A monument configured to be positioned in the interior of an aircraft that includes first, second, third and fourth sides and first and second lavatories spaced apart from one another by at least a portion of a galley storage section that is open to the first side. The first and second sides are opposite to one another and the third and fourth sides are opposite to one another. The first lavatory defines a first lavatory interior and includes a first toilet therein and the second lavatory defines a second lavatory interior and includes a second toilet therein. |
US09896211B2 |
Control device, lighting system, mobile object
The control device individually controls operations of the two or more lighting devices. Each lighting device includes a light source, a sensor for measuring light intensity of the light source, and a controller circuit for controlling the light source. The control device includes a replacement detector circuit, and the replacement detector circuit determines whether any of the lighting devices has been replaced, and obtains a determination result distinguishing a replacement lighting device from remaining lighting device(s). When the replacement detector circuit has obtained the determination result, the control device controls at least one of the lighting devices based on the measurement value outputted from the sensor of the replacement lighting device and the measurement value(s) outputted from the sensor(s) of the remaining lighting device(s), so that a difference between light intensity of the replacement lighting device and light intensity derived from the remaining lighting device(s) falls within a predetermined range. |
US09896205B1 |
Unmanned aerial vehicle with parallax disparity detection offset from horizontal
This disclosure relates to unmanned aerial vehicles with parallax disparity detection offset from horizontal. The unmanned aerial vehicles use two optical elements, which are arranged to be separated by a horizontal distance and a vertical distance when the unmanned aerial vehicles operate leveled with respect to ground, to determine parallax disparity of an object. |
US09896202B2 |
Systems and methods for reliable relative navigation and autonomous following between unmanned aerial vehicle and a target object
A method for navigating an airborne device relative to a target comprises detecting, at an optical detector on the airborne device, an optical signal generated by one or more LEDs on the target. The method also comprises comparing, by a processor on the airborne device, the detected optical signal with a previously-detected optical signal. The method further comprises determining, by the processor based on the comparison, a change in location of at least one of the airborne device or the target. The method also comprises adjusting a position of the airborne device based on the determined change in location. The method also comprises predicting, by the processor, a movement of the target based on information indicative of at least one of a position, a rotation, an orientation, an acceleration, a velocity, or an altitude of the target, wherein the position of the airborne device is adjusted based on the predicted movement of the target. The method also comprises detecting an obstacle in a flight path associated with the airborne device and adjusting a position of the airborne device is further based, at least in part, on detected obstacle information. |
US09896201B2 |
Kite configuration and flight strategy for flight in high wind speeds
An airborne tethered flight system including a base unit, a tether having a first end attached to the base unit and a second end attached to a kite, wherein the kite comprises a main wing, a tail wing, and a tail boom attached to said main wing on a first end, said tail boom coupled to said tail wing on a second end, a plurality of vertical pylons attached to the main wing, said pylons comprising vertical airfoils adapted to provide lift, turbine driven generators mounted on the vertical airfoils attached to the main wing, and an additional vertical airfoil extending between the tail boom and tail wing. |
US09896199B2 |
Rotor hub for a rotorcraft
A rotor hub can include a yoke, a mast, and one or more radially oriented actuators. The first radial actuator and the second radial actuator each have a piston configured to impart a translation of the yoke relative to the mast. The radial actuators are configured to attenuate in-plane whirling vibrations. The rotor hub can also have actuators coupled between the mast and the yoke for attenuating flapping and vertical vibrations. |
US09896192B2 |
Minimally intrusive wingtip vortex wake mitigation using microvane arrays
An airfoil tip vortex mitigation arrangement comprising one or more flow directors configured and positioned to re-direct freestream air over a low pressure surface of an airfoil in such a way as to displace and weaken a main tip vortex generated at a tip of the airfoil. |
US09896191B2 |
Fluid-vectoring system
A jet aircraft includes an aircraft integrated, fluid vectoring, exhaust nozzle system. Implementation of this disclosure may eliminate or reduce the size of the aircraft vertical stabilizer and rudder assembly, thereby potentially improving aircraft survivability and increasing aircraft thrust-to-weight ratio. |
US09896187B2 |
Connector between two aircraft components, such as a wing and wing tip device
An aircraft structure comprising a wing tip device connected to a wing by a plurality of connectors, wherein each connector comprises a spigot associated with the wing tip device or the wing, and a lug associated with the other of the wing tip device or wing. The lug has a hole for receiving the respective spigot. The spigot of each connector is moveably mounted, relative to said wing tip device or wing, about a central position, such that during movement of the connectors from a dis-engaged configuration to an engaged configuration, each spigot can move away from the central position to align itself with the hole of the respective lug. |
US09896186B2 |
Braided composite spar
A braided composite spar or preform for a braided composite spar with a plurality of tubular plies of braided fibers. Each ply has a first set of fibers which wind in a clockwise direction in a first series of turns with a pitch between each adjacent pair of turns, and a second set of fibers which wind in an anti-clockwise direction in a second series of turns with a pitch between each adjacent pair of turns. The first and second sets of fibers in each ply are intertwined to form a braided structure. The spar or preform extends lengthwise from a root to a tip and has a tapered portion which tapers inwardly towards the tip. Each ply has a circumference in the tapered portion which reduces as it tapers inwardly. For at least one of the plies the pitches of the first and second sets of fibers increase continuously as the ply tapers inwardly in the tapered portion. The spar or preform can be used to provide a tubular main spar for a winglet. The winglet also has a front spar with a front spar web, an upper front spar cap, and a lower front spar cap. An upper skin of the winglet is joined to the braided spar and the upper front spar cap. A lower skin of the winglet is joined to the braided spar and the lower front spar cap. |
US09896184B2 |
Locking apparatus and method
An aircraft fuselage (4) comprising: an aircraft door or access panel (2) comprising a receiving element (14); and locking apparatus for securing the aircraft door/panel (2) in an opening of aircraft fuselage (4), the locking apparatus comprising: a shaft (8); a mounting member (10) for mounting the shaft (8) to the fuselage (4); securing means (12) fixedly mounted to the shaft (8) and arranged such that rotation of the shaft (8) about its longitudinal axis moves the securing means (12) from being not coupled to a receiving element (14) to being coupled to a receiving element (14) or vice versa; a locking member (52) for coupling to the shaft (8) such that rotation of the shaft (8) causes movement of the locking member (52); and fixing means for fixedly attaching the locking member (52) to the aircraft fuselage (4) thereby preventing rotation of the shaft (8). |
US09896183B2 |
Airframe component with electrically bonded connections
An airframe component is provided and includes first and second components having respective first and second opposite surfaces and edge portions, the first component defining a plane and the second component being attachable to the first surface of the first component as a protrusion from the plane, a first conductive layer disposed to wrap around the edge portion of the first component from the first surface to the second surface, a second conductive layer disposed on the first surface of the second component to extend beyond the edge portion and an insulation layer interposable between the first and second conductive layers and between a periphery of the first surface of the second component and the second conductive layer. |
US09896182B1 |
Systems and methods for maneuvering a package following in-flight release from an unmanned aerial vehicle (UAV)
A package delivery system can be implemented to forcefully propel a package from an unmanned aerial vehicle (UAV), while the UAV is in motion. The UAV can apply a force onto the package that alters its descent trajectory from a parabolic path to a vertical descent path. The package delivery system can apply the force onto the package in a number of different ways. For example, pneumatic actuators, electromagnets, spring coils, and parachutes can generate the force that establishes the vertical descent path of the package. Further, the package delivery system can also monitor the package during its vertical descent. The package can be equipped with one or more control surfaces. Instructions can be transmitted from the UAV via an RF module that cause the one or more controls surfaces to alter the vertical descent path of the package to avoid obstructions or to regain a stable orientation. |
US09896181B2 |
Aircraft rear structure
An aircraft rear structure that comprises a rear pressure bulkhead, and a lifting surface located at both sides of the fuselage of the aircraft. The lifting surface comprises spars extending in the longitudinal direction of the lifting surface. The pressure bulkhead is aligned with one of the spars of the lifting surface. |
US09896178B1 |
Methods and systems of controlling engine RPM
A method of controlling engine RPM in a marine propulsion device having an engine that effectuates rotation of a propulsor through a gear system that shifts amongst a forward gear position, a reverse gear position, and a neutral position, includes determining that a coolant temperature is below a temperature threshold or that a battery voltage is below a voltage threshold, and then increasing an engine RPM setpoint by a compensation RPM amount while the engines remains in an idle state in order to increase the coolant temperature or the battery voltage. When a shift instruction is detected to transition the gear system from the reverse gear position to the neutral position or from the forward gear position to the neutral position, the engine RPM setpoint is reduced by a shift RPM reduction amount during transition of the gear system, and the engine is controlled according to the engine RPM setpoint. |
US09896175B2 |
Outboard motor and methods of use thereof
An outboard motor and methods of use thereof in general, includes a powerhead removeably affixed to the transom of a boat, and a gear case rotationally connected to a propeller shaft, the outboard motor including a telescopic drive shaft, the telescopic drive shaft having a first drive shaft section rotationally connected to the motor and a second drive shaft section rotationally connected to the gear case, and a telescopic drive shaft housing, the telescopic drive shaft housing configured to support the telescopic drive shaft internally therethrough, whereby the telescopic drive shaft and the telescopic drive shaft housing are configured to provide depth adjustment for the gear case and the propeller shaft, and thus enable the propeller to be raised and lowered during propulsion to improve propulsion efficiency. |
US09896174B1 |
System and method for controlling trim position of propulsion device on a marine vessel
A method of controlling trim position for a propulsion device on a marine vessel includes receiving a running trim position for the propulsion device, receiving at least one of a steering input value or a roll angle of the marine vessel, and determining a magnitude of the steering input value or a magnitude of the roll angle of the marine vessel. The method further includes determining an adjusted trim position based on the magnitude of the steering input value or the magnitude of the roll angle of the marine vessel, and operating a trim actuator based on the adjusted trim position to decrease the trim angle of the propulsion device below the running trim position while the marine vessel is turning. |
US09896167B2 |
Subsea wellbore operations vessel
A vessel (1) adapted to perform subsea wellbore related operations involving a riser string between the subsea wellbore and the vessel, e.g. drilling and/or wellbore intervention. The vessel (1) has a hull (2) and a riser storage (40) adapted to store therein of multiple risers in horizontal orientation. The riser storage (40) is adapted to store therein, or has stored therein, multiple pre-assembled riser stands (60), e.g. at least 25 riser stands, each riser stand being assembled from multiple riser sections (60, 61) connected end-to-end, e.g. each riser stand (62) consisting of two riser sections (60, 61), each riser section comprising a riser pipe and optionally one or more satellite pipes on the outside of and along the riser pipe, each riser section (60, 61) comprising a connector fitting arrangement at each end thereof, and each riser section (60, 61) comprising preferably one or more buoyancy members, wherein in a riser stand the connector fitting arrangement of one riser section is connected to a connector fitting arrangement of another riser section. |
US09896162B2 |
Submersible vessel having retractable wing and keel assemblies
A submersible vessel having wing and keel assemblies that are extendable for wind-powered surface operation and retractable to reduce drag for submerged operation or to place the vessel in a more compact configuration. A deployment mechanism including an actuator and linkage pivots the wing and keel assemblies simultaneously between the deployed and retracted configuration. The vessel may have first and second pressure hulls flanking the wing and keel assemblies. A drive mechanism including a motor and a gear train employing pulley-and-cable assemblies rotates either the wing and flap together such that the flap angle relative to the wing is constant, or to change the flap angle relative to the wing with the wing angle of incidence held constant. The invention also provides a retractable wind-powered propulsion apparatus that is mountable to the hull assembly of a submersible or non-submersible vessel. |
US09896161B2 |
Locking device for a damping apparatus for a moon pool
Provided is a locking apparatus for a damping device of a moonpool, which can automatically lock and unlock an opened state of the damping device of the moonpool. The locking apparatus includes: one or more first locking members installed in a sidewall of the moonpool; one or more second locking members installed in a side of the damping device; and a holding unit separably holding the first locking members and the second locking members when the damping devices are in the opened state. |
US09896158B2 |
Universal hydrofoil connector system and method of attachment
A universal hydrofoil comprises a hydrofoil assembly, a universal mount assembly and a plurality of lateral connectors. The hydrofoil assembly has a longitudinal axis and includes a centerfoil having first and second longitudinal ends. A foil assembly is disposed at the centerfoil second end and includes a fuselage, a wing at a fuselage first end and a tail at a fuselage second end. The universal mount assembly comprises a base having first and second mounting surfaces. The second mounting surface defines a mounting interface configured to reversibly mate with the centerfoil first end. Lateral supports having a pair of arms projecting from a central beam are selectively engageable with the base. The lateral connectors are adjustably secured within the lateral channel and configured to engage a structural feature of a craft. |
US09896152B2 |
Bicycle transmission system
A bicycle transmission system comprises a first input device, a transmission, an assist device, and a controller. The first input device is configured to receive a first input operation from a user. The transmission is configured to transmit a pedaling torque to a wheel at a current gear ratio among a plurality of gear ratios. The assist device is configured to assist a rotation of the wheel at a current assist ratio among a plurality of assist ratios. The controller is configured to change the current gear ratio into a predetermined gear ratio without changing the current assist ratio based on the first input operation in a first condition. The controller is configured to change the current gear ratio into a predetermined gear ratio and change the current assist ratio into a predetermined assist ratio based on the first input operation in a second condition. |
US09896149B2 |
Handlebar-mounted switch device for a saddle-type vehicle, and vehicle including same
A handlebar-mounted switch control device includes switch activation buttons which respectively correspond to specific switches, and which are arranged on surfaces of a switch case adjacent to a grip in an end portion of a handlebar. Two switch activation buttons are disposed on a front outer surface of the switch case. The two switch activation buttons are configured and placed in such a way so that a rider can easily recognize which of the two switch activation buttons the rider touches. The second switch activation button is placed above the first switch activation button, and inward of the first switch activation button in a vehicle width direction. A guide surface inclining to extend inward in the vehicle width direction toward an upper side is formed on a side surface of the switch case which is above the first switch activation button, and which faces the grip. |
US09896146B2 |
Two-axle vehicle balance scooter
The two-axle vehicle balance scooter includes an upper shell, lower shell, pedal, pressure sensors, brackets, wheels, press block, shaft, chip, and battery pack. The brackets include a pedal bracket, hardware support, battery support and chip support. The press block includes a wheel pressure block and an axial compression block, from bottom to top on the housing gasket installed the pedal bracket and pedals. Both sides of the body are disposed around a middle section that is a battery holder below which a battery is installed. Accordingly, the scooter is symmetrical thus providing better stability, easier handling, easy installation and removal of a battery and other benefits. |
US09896143B2 |
Pannier mounting structure in saddle-riding type vehicle
In a pannier mounting structure, a pannier is mounted on a side portion in a vehicle widthwise direction of a motorcycle through a pannier stay. The pannier stay includes a first retaining portion and a second retaining portion beneath the first retaining portion. The pannier has a rear surface provided with a first retaining bag that opens downwards and a second retaining bag that is positioned below the first retaining bag and opens upwards. While the first retaining portion is inserted into the first retaining bag through an opening in a lower portion thereof, the second retaining portion is inserted into the second retaining bag through an opening in an upper portion thereof and is engaged within the second retaining bag. |
US09896140B1 |
Suspension for a bicycle saddle
A seat apparatus includes a rigid base adapted for selectively mounting on a seat post of a bicycle and includes an armature mount. A rigid armature has a rear end, a front end, and a central mounting portion adapted for fixing with the armature mount of the base. A saddle has a top side, a bottom side, a front end, and a rear end, the top side being adapted for receiving a person thereon in a seated position. A connecting element is fixed between the bottom side of the saddle and with the front end of the armature. A cushion is fixed between the bottom side of the saddle and the rear end of the armature and includes a top membrane, a bottom membrane, and at least one peripheral membrane all capturing a cushioning substance therebetween. The cushion maintains a minimum height when under compression. |
US09896134B2 |
Utility vehicle
A utility vehicle includes a main frame, a front grille, and right and left headlight assemblies each provided between the front grille and a portion of the main frame facing the front grille in an anteroposterior direction of the utility vehicle, and including a front end attached to a rear side of the front grille and a rear end attached to the portion of the main frame. |
US09896131B2 |
Vehicle floor portion structure
A vehicle floor portion structure that includes: a pair of rockers extending in a vehicle front-and-rear direction; a tunnel extending in the vehicle front-and-rear direction, and the tunnel including a first upper wall portion, and a pair of first side wall portions; cross-members that link the rockers with the tunnel in the vehicle width direction; a tunnel upper reinforcement provided above the tunnel, the tunnel upper reinforcement partially overlapping with the cross-members in side view and being joined together with the cross-members; and a tunnel lower reinforcement disposed in the tunnel, a closed cross section portion being formed between the tunnel lower reinforcement and the first upper wall portion and the pair of first side wall portions, and the tunnel lower reinforcement overlapping with the cross-members in side view and being joined together with the cross-members. |
US09896130B2 |
Guidance system for a vehicle reversing a trailer along an intended backing path
A guidance system for a vehicle reversing a trailer is provided. The system includes a display and a controller configured to generate a steering icon on the display. The steering icon recommends a steering direction and a steering magnitude related to a steering device of the vehicle in order to correct a deviation from an intended backing path. |
US09896129B2 |
Driving assistant system of vehicle and method for controlling the same
Disclosed herein are a driving assistant system of a vehicle and a driving assistant method. The driving assistant system includes an image acquisition unit that acquires a front image of the vehicle, an obstacle detection unit that detects an obstacle at lateral and rear sides of the vehicle, a determination unit that determines whether a current vehicle is located at a junction road based on the acquired image, and a control unit that automatically changes a lane of the vehicle when it is determined that the current vehicle is located at the junction road and the obstacle is not detected at the lateral or rear side of the vehicle. |
US09896126B2 |
Jackknife detection for vehicle reversing a trailer
A backup assist system for a vehicle reversing a trailer includes a hitch angle sensor providing a measured hitch angle of the trailer. The system also includes a controller determining a position of the measured hitch angle in relation to an unknown jackknife angle by monitoring a predetermined dynamic hitch angle characteristic derived from the measured hitch angle for a corresponding jackknife indicating characteristic. |
US09896124B2 |
Steering control apparatus
A steering control apparatus is obtained which includes an assist instruction-value correction device for calculating, based on a result of a friction transition-state determination device, an assist correction value in order to obtain an assist instruction-value after its correction being made by correcting a basic assist instruction-value so that a hysteresis width of steering torque increases at the time of turn-back steering, and an electric current driving device for driving a motor so that an electric current of the motor is coincident with an electric current instruction-value therefor after its correction being made on the basis of the assist instruction-value after its correction being made; and the friction transition-state determination device determines the friction transition-state by integrating a differential value of steering-shaft reaction torque using an integrator having a limiting function to an upper or lower limit value defined in advance. |
US09896123B2 |
Systems and methods for detecting steering wheel contact
Disclosed herein are systems and methods that describe systems and method for detecting operator contact with a steering wheel of a vehicle. The system can include: a steering wheel, a drive motor coupled to the steering wheel, and a drive motor controller that controls the operation of the drive motor. The drive motor controller can detect contact between the operator and the steering wheel. In one aspect, the systems and methods can be used to alert the operator of the vehicle when operator contact with the steering wheel is not detected. |
US09896115B2 |
System and method for coordinating terminal operations with line of road movements
A terminal operating system includes one or more processors configured to obtain one or more parameters of non-propulsion-generating cargo vehicles and to determine which of the non-propulsion-generating cargo vehicles are to be included in a vehicle system assembled in a terminal or yard based on the one or more parameters. The one or more parameters include one or more of an earliest time of availability at which cargo equipment will be available in the terminal or yard, a safety operational characteristic, an efficiency operational characteristic of the one or more non-propulsion-generating cargo vehicles, and/or a priority parameter of the one or more non-propulsion-generating cargo vehicles. The one or more processors are configured to automatically direct equipment within the terminal or yard to assemble the vehicle system based on the one or more parameters. |
US09896110B2 |
Control method for carrying out a gear shift in a transmission provided with a dual-clutch gearbox
A control method for carrying out a gear shift in a transmission provided with a dual-clutch gearbox, so as to shift from a current gear to a following gear; the control method comprises the steps of: receiving a gear shift command; opening a first clutch associated with the current gear; closing a second clutch associated with the following gear; determining whether a driving style is a comfort driving style, an energy efficiency driving style, a sports driving style or a racing driving style; and in case of upshifting, controlling the second clutch after the complete closing of the second clutch, so as to allow said second clutch to temporarily transmit a torque that is greater than the torque to be transmitted by the second clutch immediately after the gear shift and than the torque transmitted by the first clutch immediately before the gear shift, only in case of energy efficiency or racing driving style. |
US09896095B2 |
Collision avoidance support device
When a host vehicle travels while being decelerated by an intervention of automatic braking, a support ECU calculates a collision prediction speed at a collision prediction position and determines whether or not the collision prediction speed exceeds a collision prediction speed threshold. The support ECU allows an automatic steering for collision avoidance to intervene only in a case where the collision prediction speed is determined to be equal to or less than the collision prediction speed threshold and prohibits the intervention of the automatic steering in a case where the collision prediction speed is determined to exceed the collision prediction speed threshold. |
US09896093B2 |
Vehicle control system
A technique is provided in which detection of an impending collision results in the vehicle's control system taking steps to minimize damage to the passenger cabin, thereby increasing passenger safety. In particular, once an object is detected in the vehicle's pathway, the on-board controller determines whether or not a collision with the object (e.g., an on-coming car or a stationary object) is imminent. Once the system determines that a collision is imminent, the controller (i) deactivates the car's anti-lock braking system, (ii) locks-up the wheels, and (iii) rotates the front wheels to minimize intrusion of the wheels into the passenger cabin. The system may be configured to tailor the response to an imminent collision based on (i) vehicle speed, and (ii) probable impact area. |
US09896086B2 |
Moving assist apparatus and method
A moving assist apparatus for assisting a vehicle to move from current position to destination includes a mode planning unit for, for each section obtained by dividing traveling route, planning one traveling mode from first mode of not maintaining a charge storage amount of the secondary battery and second mode of maintaining the charge storage amount of the secondary battery, based on a traveling load associated with the section. If the charge storage amount of the battery is above a first threshold, the mode planning unit takes a section after which the charge storage amount of the battery that is predicted with assumption of traveling with the first mode is below a second threshold less than the first threshold by taking the section being traveled by the vehicle or the next section as a reference, as a first mode priority section in which the first mode is planned in priority. |
US09896085B2 |
Vehicle information processor
In the first mode, the vehicle gives priority to traveling in which only the motor is driven. In the second mode, the vehicle drives at least one of the internal combustion engine and the motor to sustain a stored power amount of the storage battery. At least one of a plurality of zones includes a load unknown portion, in which the travel load cannot be calculated. The planning unit is configured to set a zone including the load unknown portion to the first mode. |
US09896084B2 |
Control system for hybrid vehicle
A control system for a hybrid vehicle to start an engine without causing a torque drop is provided. A combined planetary gear unit is configured in such a manner that an input element connected to the engine and an output element are situated between a reaction element connected to a first motor and a fixed element connected to a brake in a nomographic diagram. The first motor is selectively connected to the engine by a clutch. A controller is configured to start the engine by the first motor while engaging the brake to restrict rotation of the fixed element and engaging the clutch. |
US09896082B2 |
Vehicle driving support control device
There is provided a structure in a driving support system of a vehicle equipped with a steering assist mechanism and a torque vectoring mechanism of right and left wheels, the system capable of reducing an occurrence of a driver's sense of incongruity as much as possible also during the operation of a control based on a machine input and reflecting a driver's steering in the control. The inventive device comprises a steering assist torque controller which controls a steering assist torque given by the steering assist mechanism, a right and left braking-driving force difference controller which controls the braking-driving force difference between the right and left wheels given by the torque vectoring mechanism and a control target value determiner which determines the target values of the steering assist torque and braking-driving force difference for driving support control, based on the steering torque by the driver. |
US09896076B2 |
Traction-slip controlled brake system of a motor vehicle approaching stops
A control device for controlling a brake system of a vehicle comprises a first output for controlling a first solenoid valve; a second output for controlling a valve device; an input for receiving a requested brake pressure; and a port for receiving messages on a databus. The control device is capable of receiving an automatic brake request on the databus; determining a desired brake pressure in response to the automatic brake request; receiving a requested brake pressure in response to a driver actuating a service brake valve; comparing the desired brake pressure to the requested brake pressure; transmitting a control signal to close the first solenoid valve and transmitting a control signal to change the valve device to a first operating position in response to the requested brake pressure being less than the desired brake pressure in order to provide pressure to at least one brake actuator. |
US09896075B2 |
Pulsation damping device of hydraulic brake system
Disclosed herein is a pulsation damping device of a hydraulic brake system. The pulsation damping device of a hydraulic brake system which attenuates a pressure pulsation of brake oil discharged from a pump comprise a sleeve inserted into a bore which communicates with an inport into which the brake oil is introduced and an outport through which the brake oil is discharged, wherein one end of the sleeve is open and the other end is closed, a damping member accommodated in the sleeve and hollowed to form a damping space therein, and a stopper member configured to block one open end of the bore and coupled to an opening of the sleeve. |
US09896071B2 |
Automatic brake hold with low speed maneuverability
A transportation vehicle has an autohold selector, such as a push button switch or other human-machine interface (HMI). A gear selector in the vehicle includes forward and reverse gear positions. A brake pedal can be depressed by a driver to actuate a brake actuator when slowing or stopping the vehicle. A control circuit is configured to initiate a brake hold event of the brake actuator in response to predetermined conditions including the autohold selector being on and the vehicle braking to a stop with the brake pedal depressed, wherein initiating the brake hold event is prevented if the gear selector is in the reverse position. If a brake hold event is in progress, then shifting the gear selector to reverse terminates the brake hold event. Low speed maneuvers, such as parking the vehicle, can be performed without a need for manually canceling the autohold feature. |
US09896067B2 |
Jack assembly
A jack assembly is shown and describe. The jack assembly may include a first tube having first and second end portions and a central portion between the first and second end portions, and a second tube positioned within the first tube and movable with respect to the first tube. The jack assembly may also include an expanded portion on the first tube, the expanded portion having a larger inner diameter than an inner diameter of the central portion, and a bushing attached to the expanded portion, where the bushing generally prevents contact between the first and second tubes. |
US09896065B2 |
Heating device for a wiper blade of a vehicle and wiper blade comprising same
The heating device is suitable for assembly with an element (3) supporting a wiper blade and comprises an element of longitudinal main axis (4) suitable for mounting inside a housing (5) of the support element (3) so as to form a spine. A heating element (13) is positioned on a bottom face of the spine-forming element (4). The spine-forming element (4) comprises at least one bushing (20) for the passage of electrical conduction means (19) in order to provide an electrical power supply for the heating element (13). |
US09896063B2 |
Remote vehicle access systems for fleet vehicles
The present disclosure provides a wireless communications system for a fleet of automotive vehicle comprising: a server in communication with a wireless wide area network and including a database; a fob including a memory storing a unique fob identifier, the fob in communication with a wireless local area network; and a control unit in the automotive vehicle including a memory storing a vehicle identifier. The control unit is in communication with the server via the wireless wide area network and with the fob via the wireless local area network, wherein the server stores data correlating the fob identifier to the vehicle identifier in the database, and when the fob transmits a communication to the vehicle through the local area network the vehicle accesses the database to validate the key fob. |
US09896060B2 |
Wireless seatbelt attaching detection device
There are provided a buckle switch that detects an insertion of a tongue into a buckle of a seatbelt and an ejection of the tongue from the buckle, a signal transmitting section that wirelessly transmits a signal showing a state of the buckle switch, and an attaching detection control unit that controls the signal transmitting section such that the signal transmitting section transmits different signals that correspond to a first time lasting from the insertion of the tongue into the buckle until the ejection of the tongue from the buckle or a second time lasting from the ejection of the tongue from the buckle until the insertion of the tongue into the buckle. |
US09896057B2 |
Method for folding an airbag and airbag
A method of folding an airbag (10) includes the following steps: the airbag (10) is flatly spread, a first section (16) adjacent to a first border (14) is folded at least once, the folded first section (16) is folded in U-shape, and a second section (18) adjacent to the first section (16) is rolled around the folded first section (16). |
US09896053B2 |
Side airbag apparatus
A side airbag apparatus is provided between a vehicle body and a back seat, and includes a base housing configured to house an airbag and an inflator, a base member having upper and lower base attachment portions provided to sandwich the base housing in an upper-to-lower direction and attached to a portion of the vehicle body, and a retainer member configured to hold the base housing from a vehicle back side. Right and left engagement claws at an upper end of a back wall of the retainer member are arranged to engage respectively with engagement holes provided at a portion of the vehicle body on the vehicle back side. A virtual plane passing through the upper and lower base attachment portions and extending along a vehicle front-to-back direction passes between the right and left engagement claws. |
US09896052B2 |
Cargo bed and utility vehicle with the cargo bed
A cargo bed of a utility vehicle includes a front wall, a left wall, a right wall, a rear wall, and a partition member configured to partition a storage space that is surrounded by the front wall, the left wall, the right wall, and the rear wall. The left wall and the right wall are each provided with a first groove configured to be engaged with the partition member to fix the same, and a second groove configured to store the partition member. |
US09896048B2 |
Power supply unit for supplying power to an on-board electrical network of a vehicle
The invention relates to a power supply unit (3) for supplying power to an on-board electrical network of a vehicle, including: at least two DC-to-DC converters (9A, 9B) which are interleaved and reversible between an opera-ting mode for lowering voltage and an operating mode for raising voltage, the converters (9A, 9B) being intended for being connected to a power storage device (ST2) and being capable of supplying current to the on-board network; and a switch (K) enabling a power source (STI) to supply power to the on-board network when the switch (K) is in a first state, and enabling the power storage device (ST2) to supply power to the on-board network when the switch (K) is in a second state. The unit is characterized in that the converters (9A, 9B) are variable-frequency converters, and in that the power supply unit (3) also includes a synchronization unit (200) configured such as to synchronize the operation of the converters (9A, 9B) operating at variable frequencies and the current generation of the converters. |
US09896044B2 |
System and method for vehicle range extension on detection of a low fuel condition
The technology described herein provides a system and method for automatically increasing the remaining driving range of a vehicle when a low fuel or other condition is detected by altering the operating parameters of one or more vehicle systems to improve propulsion system efficiency and thereby lower fuel consumption. The vehicle range extending system is capable of altering the operating parameters of any vehicle system, including for example variable displacement settings, start-stop technology settings, and HVAC operation. The disclosed technology can also provide information to the driver, suggesting which system operating parameters should be altered to reduce the fuel consumption rate. |
US09896042B2 |
Grommet and wire harness
A grommet includes a bellows portion and a movable-member-side fitting portion connected with an end of the bellows portion. The movable-member-side fitting portion has an outer surface connected with the bellows portion and an inner surface formed on the opposite side of the outer surface. On the outer surface, the bellows portion is connected to the movable-member-side fitting portion with unequal distances from an axial center of the bellows portion to the outer edge of the movable-member-side fitting portion. Furthermore, on the outer surface, a first outer rib is formed that extends along a direction having a maximum distance from the axial center to the outer edge with an outer peripheral surface of the bellows portion serving as its base. |
US09896041B2 |
Interior trim element for a motor vehicle
An interior trim element (1) for a motor vehicle, comprising a main part (2), more particularly a trough-shaped main part, that defines an interior space (5), and comprising at least one clip element (7a, 7b), wherein the at least one clip element (7a, 7b) is pivotally hinged to the main part (2) via at least one film hinge (8a, 8b), wherein the film hinge (8a, 8b) is formed on a shoulder (11) created on an edge portion (4a) of the main part (2) that partially delimits the interior space (5), the shoulder (11) being offset with respect to the free end of the edge portion (4a). |
US09896039B2 |
Vehicle vision system with forward viewing camera
A vehicle vision system includes a camera module configured to attach at an in-cabin surface of a windshield of a vehicle equipped with the vision system. The camera module includes a housing and an imager assembly. The imager assembly includes a structure and an imager and a lens. The imager is disposed at an imager circuit board of the imager assembly. A thermal element is configured to attach at the structure of the imager assembly and includes a support element and a thermal pad disposed at least partially along the support element. With the thermal element attached at the structure of the imager assembly, a first portion of the thermal pad is engaged with the imager circuit board, and wherein, with the imager assembly disposed at the housing of the camera module, a second portion of the thermal pad is engaged with the housing. |
US09896037B2 |
Ski carrier clamp
A ski carrier clamp mountable on a cross bar of a vehicle roof carrier includes an elongate base part having a first end portion and a second end portion, an elongate top part having a first end portion and a second end portion, and a hinge mechanism having a guiding portion coupled to the elongate base part and a guided element slidably disposed in the guiding portion. The hinge mechanism couples the first end portion of the elongate base part to the first end portion of the elongate top part. The first end portion of the elongate base part and the first end portion of the elongate top part are configured to move with respect to each other. |
US09896035B2 |
Utility vehicle cowl assembly
The present disclosure provides a utility vehicle front body cowl assembly. The cowl assembly generally comprises a front body cowl and a cargo rack disposed within a reservoir of the front body cowl. More particularly, the front body cowl is connectable to at least a portion of a utility vehicle chassis forward of a passenger compartment dash console of the vehicle, and comprises a pair of opposing shoulders and a rack reservoir or recess provided between the shoulders. The cargo rack is disposed within the reservoir/recess such that the cargo rack and any gear disposed with cargo rack create little or no impedance to a line-of-sight an operator of the vehicle 10. Accordingly, the front cowl assembly provides good visibility and a substantially unimpeded field-of-view for the vehicle operator. |
US09896034B2 |
Cargo accessory modular adapter
A cargo mounting system is shown and described. The cargo mounting system may include a rail having first and second portions and a length, the first portion being opposite the second portion, a first engaging member positioned on the first portion of the rail, and a second engaging member positioned on the second portion of the rail. The cargo mounting system may also include at least one vehicle attaching member selectively attached to and positionable on the second engaging member of the rail, the at least one vehicle attaching member selectively attachable to a vehicle, and at least one accessory mounting member selectively attached to and positionable on at least one of the first and second engaging members, where the at least one accessory mounting member is capable of carrying an item. |
US09896033B2 |
Vehicle and semi-automatic foot-pedal device thereof
A semi-automatic foot-pedal device is provided, which includes a panel and a pedal-connecting component connected with the panel. The pedal-connecting component includes an upper bracket, a left bracket, a lower bracket, a right bracket and an elastic unit; when the pedal-connecting component is in a closed state, the panel moves away from the upper bracket to transform the pedal-connecting component into an elastically spread state under a force on the panel in a downward direction and the elastic unit generates pushing force toward its two opposite directions; when the pedal-connecting component is in a spread state, the panel moves towards the upper bracket to transform the pedal-connecting component into an elastically closed state under a force on the panel in an obliquely-upward direction and the elastic unit generates pushing force toward its two opposite directions. |
US09896028B1 |
Light assembly for attachment to a vehicle
A light assembly for attachment to a vehicle such as a truck wherein the light assembly includes a rigid support member having a first end, a second end, a first side edge, a second side edge, a first side and a second side. In a first embodiment, a plurality of spaced-apart light members are secured to the support member. In a second embodiment, an elongated light bar is secured to the support member. In both embodiments, an L-shaped channel member is provided at one of the side edges of the support member thereof to not only strengthen the support member but to provide a channel for partially receiving the electrical wires of the light members. |
US09896027B2 |
Illuminated vehicle socket
An electrical socket is described, which is configured to be mounted on a towing vehicle. The electrical socket comprises a socket body, a plug receiver mounted in the socket body and configured to receive a vehicle electrical plug from a towed vehicle, an illuminated closure mounted on the socket body and movable between a closed position in which the plug receiver is closed and an open position in which the plug receiver is accessible to receive the vehicle electrical plug, the illuminated closure comprising a lens and a light source mounted adjacent the lens and configured to direct light through the lens toward the towed vehicle when it is connected to the towing vehicle wherein the light source is also configured to illuminate the plug receiver when the closure is in the open position. |
US09896026B2 |
Slider window assembly with integrated lighting
A rear window assembly for a vehicle includes a fixed window panel. The rear window assembly may be a rear slider window assembly and may include a frame portion having an upper rail and a lower rail, with the fixed window panel fixed relative to the frame portion and defining an opening, and with a movable window panel movable along the upper rail and the lower rail so as to be movable between a closed position and an opened position. A lighting device is disposed at an inner surface of the fixed window panel. The lighting device is operable to emit light that passes through the fixed window panel so as to be viewable by a person viewing the slider window assembly from exterior and rearward of the vehicle. |
US09896024B1 |
Tamper resistant and theft resistant vehicle light assembly
A tamper resistant and theft resistant light assembly for a tractor trailer or other vehicle that can be easily installed on the vehicle but cannot be removed without being broken. The light assembly may have one or more flexible projection fingers that deform to allow the light assembly to be mounted on the vehicle body plate by pushing the light assembly into an opening therein, but prevent the light assembly from being removed from the opening. The light assembly has a mounting ring that breaks away from the light assembly if an attempt is made to pry the light assembly out of the opening. |
US09896023B1 |
Vehicle rear lighting assembly
A backup lamp is provided herein. The backup lamp includes a housing and a lens. A plurality of light sources is disposed in upper and lower positions of the housing. The plurality of light sources in the upper position are angularly offset from the plurality of light sources in the lower position. A plurality of reflectors surround each light source and have a focal axis that is offset from each of the remaining reflectors. A controller is configured to selectively illuminate the light sources in a plurality of illumination patterns. |
US09896019B2 |
Cargo stop block
A cargo stop for use with a tie down strap with attachment members attachable to anchors in a floor of a cargo compartment usable for carrying cargo. The cargo stop having an elongated cargo engagement wall member portion with a rearward facing elongated engagement wall sized for engagement with cargo to resist forward movement of cargo engaging the engagement wall beyond the engagement wall, an elongated backing member portion rigidly connected to the cargo engagement wall member portion and projecting forward beyond the cargo engagement wall member portion, and an elongated strap receiving recess sized to receive the tie down strap. The length of the engagement wall being sized to position the left end portion of the engagement wall in proximity with a starboard wall of the cargo compartment and the right end portion of the engagement wall in proximity with a port wall of the cargo compartment. |
US09896013B2 |
Vehicle automatic hoist system and method
Systems and methods for controlling a hoist apparatus on a vehicle to automatically load and unload a container. The vehicle includes a chassis, a hoist apparatus coupled with the chassis, and at least one lift mechanism operative to move the hoist apparatus with respect to the chassis in response to the flow of hydraulic fluid along a fluid flow path. The vehicle also includes at least one valve in fluid communication with the at least one lift mechanism, a control system in electronic communication with the at least one valve, and a transceiver in electronic communication with the control system. The control system is operative to receive, via the transceiver, an initiation signal from a remote control unit. Further, the control system is operative to selectively actuate the at least one valve in response to the initiation signal to move the hoist apparatus. |
US09896011B2 |
Foldable table assembly for vehicles
A foldable table assembly for vehicles includes a base bracket, a first rotary arm provided with one end connected with the base bracket and elastically rotatable upwards about the end by a first elastic member, a second rotary arm provided with one end hinged to the base bracket and to be rotated in accordance with rotation of the first rotary arm, and a table connected with the other ends of the first and second rotary arms. The table includes base plates hinged to the other ends of the first and second rotary arms, an intermediate support plate connected with the base plate to be rotatable when a bearing member is interposed between the intermediate support plate and the base plate, and table plates connected with the intermediate support plate to be slidably movable when sliding members are interposed between the table plates and the intermediate support plate. |
US09896009B2 |
Seat cushion of vehicle
The present disclosure provides a seat cushion of a vehicle, the seat cushion including: a body coupled to a seat cushion; an extension disposed ahead of the body and being movable forward and backward; and an elastic member disposed in a space between the body and the extension and filling in the space between the body and the extension when the extension moves forward. |
US09896007B2 |
Occupant protection device
The present disclosure provides an occupant protection device including: side support sections pair provided at a seat width direction left and right of a seatback; an outside bag body, provided inside an outside side support section out of the side support sections pair which is disposed at a window section side, that displaces the outside side support section by gas being supplied to and inflating an interior portion of the outside bag body; an inside bag body, provided inside an inside side support section out of the side support sections pair which is disposed at opposite side of the outside side support section, that displaces the inside side support section by gas being supplied to and inflating an interior portion of the inside bag body; and a communicating connection member that places the outside bag body and the inside bag body in communication. |
US09896005B2 |
Vehicle seat
A seat back pad 70 has a groove 73 for tucking a skin material therein, formed at borders between a central portion 71 and side portions 72. A hole (slot hole 74) is formed in a bottom of the groove 73 along the groove 73. A tuck-in wire 76 for tucking the skin material in includes a plurality of tuck-in portions 76A provided along the groove 73, and a connecting portion (detour portion 76B) detouring around the hole and connecting the tuck-in portions 76A. With this configuration, when an upper body of an occupant P subsides into a seat back S2 in a rear-end collision of a vehicle, the central portion 71, defined by the groove 73 as a border, is easily and sufficiently moved rearward relative to the left and right side portions 72. Furthermore, the tuck-in wire 76 is not exposed through the hole, and thus adhesion between the seat back pad 70 and the tuck-in wire 76 can be improved. |
US09896004B1 |
Telescoping tailgate with fourbar linkage for elevation drop
A tailgate of a vehicle including a back portion and a seat portion, a telescopic mechanism including a first link, a second link, and a slotted link with a slot connected to the back portion of the tailgate allowing the tailgate to slide and pivot, and a four-bar mechanism including a third link and a fourth link hingedly connected to the back portion and the seat portion of the tailgate, wherein the telescopic mechanism and the four-bar mechanism allow the tailgate to transition between a first position, a second position, and a third position. |
US09895989B2 |
Safety system, a method of operating a safety system and a method of building a safety system
The invention relates to a safety system for an inductive power transfer system for transferring power to a vehicle on a surface of a route, wherein the primary unit comprises at least one primary winding for generating an electromagnetic primary field for the inductive power transfer, wherein a charging surface of the route is assigned to the primary winding. The safety system comprises at least one capacitive sensing system, wherein the capacitive sensing system comprises multiple detection capacitors, wherein the multiple detection capacitors are arranged in an array structure, and wherein the array structure covers the charging surface at least partially. A method of operating the safety system and a method of building the safety system is proposed. |
US09895984B2 |
Vehicle including power storage unit
Deterioration of a power storage unit included in a vehicle is prevented or the power storage unit that has deteriorated is repaired, and the charge and discharge performance of the power storage unit is maximized to be maintained for a long time. Attention has focused on a reaction product formed on an electrode surface which causes malfunction or deterioration of a power storage unit such as a lithium-ion secondary battery. In the power storage unit used for a vehicle that runs on the power of an electric motor, rapid discharge occurring in the acceleration of the vehicle or the like tends to promote the solidification of the reaction product. The reaction product is removed by application of an electrical stimulus, specifically, an inversion pulse voltage. |
US09895980B2 |
Power supply system
A power converter has a series direct connection mode of keeping on/off of a plurality of switching elements to maintain the state where first and second DC power supplies different in amount of voltage change with respect to input/output of the same amount of electric power are connected in series with an electric power line connected to a load, and a voltage controlling mode of controlling an output voltage on the electric power line to be a voltage command value by controlling on/off of the plurality of switching elements. In the voltage controlling mode, between time tx and ta, the sum of voltages of the first and second DC power supplies is matched with the voltage command value by controlling the output voltage by means of charging/discharging between the first and second DC power supplies. After time ta, the series direct connection mode is applied. |
US09895975B2 |
Bar type display apparatus and vehicle comprising the same
Disclosed is a bar type display apparatus which is capable of providing various information without obstructing a front view of a driver, and a vehicle comprising the same, wherein the bar type display apparatus may include a display module provided on a dashboard and disposed adjacent to a lower portion of a front glass of a vehicle, wherein the display module extends from one edge of the dashboard to the other edge of the dashboard. |
US09895969B2 |
Push-push latch
A push-push latch includes a slider slidably disposed on a frame. A resilient element is to urge the slider toward an extended state. The slider or the frame defines a cam-track. A pin member is connected to the frame or the slider. The pin member selectably engages a closed course in the cam-track to cause the slider to alternate between a retracted state and the extended state in response to alternating application and removal of an actuating force on the slider. An interference member is on the frame to selectively prevent the pin member from engaging the closed course thereby locking the slider in the retracted state. A pivotable catch is rotatably on the slider to open in the extended state and to close in the retracted state. A shape memory alloy actuator selectively causes the interference member to selectively prevent the pin member from engaging the closed course. |
US09895968B2 |
Fuel supply system
An object is to provide a fuel supply system having a filler neck formed easily with high accuracy. A fuel supply system is configured to supply fuel ejected from a fuel nozzle to a fuel tank. The fuel supply system comprises a filler neck including a resin filler neck body and a metal retainer. The filler neck body is formed in a tubular shape and has an opening end arranged to form an opening which the fuel nozzle is inserted through. The retainer is placed to cover at least part of the opening end of the filler neck body and is joined with the filler neck body in at least part of the filler neck body by thermal welding. |
US09895963B1 |
Tonneau cover system with single piece spanning multiple panels
A tonneau cover including a core panel having a first panel surface, a second panel surface, and a perimeter. An upper film is bonded to the first panel surface. A lower film is bonded to the second panel surface. The tonneau cover has a first section, a second section, and a flexible hinge separating the first and second sections. The tonneau cover is foldable between a deployed arrangement where the first section and the second section are generally planar for covering the cargo box, and a folded arrangement where the first section and the second section are stacked for allowing access to the cargo box. The tonneau cover has a first thickness at the first section and the second section, and a second thickness at the flexible hinge. The second thickness is less than the first thickness. |
US09895960B2 |
Front defroster nozzle apparatus
A front defroster nozzle apparatus includes a retainer, and a guide fin. The retainer includes an inlet opening, an outlet port, and a retainer base. The retainer base is branched into two forked elements (i.e., first and second branches having a first outlet opening and a first inlet end and a second outlet opening and a second inlet end, respectively). The outlet port involving the first and second outlet openings has an outlet width of 400 mm or less that is larger than an opening width of the inlet opening. The first and second outlet openings have first and second opening widths being larger than first and second opening widths of the first and second inlet ends. The retainer base includes a throttled portion whose flow-passage cross-sectional area accounts for from 80% or less to 60% or more of a flow-passage cross-sectional area of the inlet opening. |
US09895956B2 |
Vehicle air conditioning apparatus for low outside air temperature use
A vehicle air conditioning apparatus including a heat released refrigerant expansion valve that decompresses the refrigerant discharged from the radiator during the heating operation and the first heating and dehumidifying operation; a gas-liquid separator that separates the refrigerant decompressed by the heat released refrigerant expansion valve into a gaseous refrigerant and a liquid refrigerant; and a bypass circuit that allows part of at least the gaseous refrigerant separated in the gas-liquid separator to flow into a section of the compressor through which the refrigerant being decompressed passes. |
US09895955B2 |
Method for controlling interior vehicle temperature to protect occupants from extreme heat
A method for protecting occupants in the passenger compartment of a parked motor vehicle from exposure to dangerously elevated temperatures and CO2 concentration levels is based on control of vehicle systems by a central microprocessor in communication with CO2 and temperature sensors and a wireless communication module. The method implements a graduated, progressive series of warnings and responses as the cabin temperature and/or CO2 concentration levels reach certain designated setpoints, so that security-compromising steps, such as opening windows, can be deferred until less extreme measures have been exhausted. |
US09895954B2 |
Thermal dissipation system of an electric vehicle
The present disclosure relates to a thermal dissipation system of an electric vehicle that includes: a heat exchanger arranged at the front part of the electric vehicle for providing heating or cooling to an air conditioning system of the electric vehicle; a first heat sink and a second heat sink, which are respectively arranged at the two sides of the front part of the heat exchanger; a number of rotatable and adjustable air deflectors for changing the flow direction of the air flowing through the heat dissipation system. Temperature sensors are included within the thermal dissipation system for sensing the working temperatures and the environmental temperatures of a battery pack and a motor of the electric vehicle. Opening and closing states of the air deflectors are adjusted in accordance with data provided by the temperature sensors. |
US09895946B2 |
Vehicle
A utility vehicle with ergonomic, safety, and maintenance features is disclosed. A vehicle is also disclosed with improved cooling, suspension and drive systems. These features enhance the utility of the vehicle. |
US09895940B2 |
Wheel
The wheel includes a tire, a rim, two groups of supporting members. The tire is coupled to the rim. The groups of supporting members are oppositely positioned and received in the tire. Each group of supporting members are separately positioned from each other. The supporting members of each group are coupled to an inner surface of the tire by injection method. Central axes of the supporting members of each group are coincident or parallel. A central axis of each supporting member is coincident with or parallel to a central axis of a central axis of the tire. |
US09895939B2 |
Run-flat tire and method for mounting the same on four-wheeled vehicle
A run-flat tire 1 comprises a carcass 6, a pair of side reinforcing rubber layers 9, and a pair of sidewall rubber components 10. At a tire maximum-width position, a first side reinforcing rubber layer 9A disposed in the side of a first bead portion has a thickness B1 greater than a thickness B2 of a second side reinforcing rubber layer disposed in the side of a second bead portion, and a first sidewall rubber component disposed in the side of the first bead portion has a thickness A1 smaller than a thickness A2 of a second sidewall rubber component disposed in the side of the second bead portion. |
US09895938B2 |
Tire bead for aircraft
Aircraft tire (1) comprising two beads (2). In each bead (2) portion (8) comprises surface layer (9) in contact with rim (3) via radially interior bead face (4) and having a shear stiffness K1. Portion (8) comprises a rigid layer (10), radially on the outside of and adjacent to the surface layer (9), having a shear stiffness K2 at least equal to five times the shear stiffness K1 of the surface layer (9), and a deformable layer (11), radially on the outside of and adjacent to the rigid layer (10) and radially on the inside of and adjacent to the carcass reinforcement portion (5) radially on the inside of the bead wire (7), having a shear stiffness K3 at most equal to 0.3 times the shear stiffness K1 of the surface layer (9). |
US09895935B2 |
Pneumatic tire
A pneumatic tire includes a belt layer, a belt reinforcing layer in which a plurality of reinforcing cords are arranged, four main grooves, and land portions comparted by the four main grooves, wherein in the case that the belt reinforcing layer is partitioned into five areas in a tire width direction by the four main grooves, an arrangement density of the reinforcing cord in the fifth area is higher than that of the reinforcing cord in the first area, and an arrangement density of the reinforcing cord in the second area is higher than that of the reinforcing cord in the fourth area, and wherein protruding portions having protruding heights in proportion to the arrangement densities are provided on ground surfaces of the land portions which are positioned outside in the tire diametrical direction in the areas having the higher density than that of the third area. |
US09895933B2 |
Non-pneumatic tire
A non-pneumatic tire has high durability performance. A non-pneumatic tire is provided with: an annular tread section (2) which comes into contact with the road surface; an annular inner peripheral section (3) which is located on the inside of the tread section (2) in the radial direction of the tire; and a plurality of connection sections (4) which connect the tread section (2) and the inner peripheral section (3). The connection sections (4), the inner surface (2b) of the tread section (2), and/or the outer surface (3a) of the inner peripheral section (3) is provided with a plurality of dimples (5). |
US09895932B2 |
Tire tube
A tire tube includes a tube body and two connectors. The tube body includes an air jet, a first end and a second end. The two connectors are connected to the first end and the second end of the tube body respectively. One of the connectors includes an operating portion corresponding to a tube core of the tube body. |
US09895931B2 |
Method for forming an axle shaft and related axle shaft
A method for forming an axle shaft that includes friction welding a tubular shaft to a shaft portion of a wheel flange. Portions of the joint members on the tubular shaft and the wheel flange are extruded into an annular weld cavity in the wheel flange during the formation of the friction weld. A related axle shaft is also provided. |
US09895927B2 |
Protector shield for a sidewall of a motor vehicle tire, and a wheel assembly for such a vehicle incorporating it
The present invention relates to a protector shield for at least one sidewall of a motor vehicle tire, and to a wheel assembly for a motor vehicle incorporating this protector shield. The invention particularly but non exclusively concerns the fire protection against flames and/or said flammable substances, such as oil or Molotov cocktails, as well as a high solvent and/or acid resistance, especially in hostile environments. A protector shield of the invention is in a form of a curved ring designed to be mounted on a wheel rim receiving said tire and, according to the invention, the shield includes a fire protection part which defines an outer convex face of said shield and which comprises a cross-linked rubber composition which particularly exhibits flame retardant and heat resistance properties for imparting to said tire an improved fire protection against flames and/or flammable substances. |
US09895923B2 |
Divider adhesion strip assembly
Disclosed is a divider adhesion strip assembly that includes a sheet with a front side and a bottom side having a perimeter that is defined by a first edge, a second edge, a third edge, and a fourth edge wherein the first edge is opposite the second edge and the third edge is opposite the fourth edge. A first laminate strip portion may be adhered to the front side of the divider sheet. The first laminate strip portion is positioned along the first edge of the sheet and extends between the third edge and the fourth edge. A plurality of apertures may be aligned adjacent the second edge of the sheet. A tab member having indicia thereon and an adhesive portion may be provided wherein the adhesive portion is configured to adhere to the first laminate strip portion such that the indicia extends past the perimeter of the sheet. |
US09895922B2 |
Ring binder with interlocking ring members
A ring binder for use in holding loose-leaf pages. A retaining system is configured to selectively and releasably hold first and second ring members in a closed position. First and second interlocking formations are selectively movable relative to one another between a retaining position and a non-retaining position. The first interlocking formation includes a projection having a free end. The free end has a void configured and arranged to permit resilient bending of portions of the free end of the projection in a first direction as they engage the second interlocking formation when the interlocking formations are moved from the non-retaining position to the retaining position. In the retaining position, the portions of the free end of the projection are substantially inhibited from bending in a second direction in response to pivoting movement of either of the ring members. |
US09895919B2 |
Stamp and stamping insert
In some embodiments, a stamp comprising at least one stamping component and one stamping insert with a mounted band unit. The stamping component may comprise a top part and a bottom part with a cushion-receiving element. The mounted band unit may be connected so as to move synchronously via a reversing mechanism in the bottom part to the top part. In the resting position a text plate mounted on the stamping insert and a stamping area of the mounted band unit may abut against an ink pad soaked with ink in the cushion-receiving element. During a stamping process for producing a stamp impression the stamping insert can be shifted via the reversing mechanism into a stamping position. On the stamping insert, a height adjustment element for the mounted band unit and/or a text plate carrier may be provided. |
US09895918B2 |
Image forming apparatus, image forming system, and method for forming test patterns
An image forming apparatus includes a controller configured to control a first image former to form a first test pattern on a recording medium, the first test pattern including figures arranged in a first direction on a two-dimensional lattice defined with an X-axis direction intersecting a Y-axis direction parallel to a conveyance direction, the first direction being inclined relative to the X-axis direction, control a conveyor to convey the recording medium in the conveyance direction, and in response to the recording medium being conveyed to a position where a second test pattern intersects or is in proximity to the first test pattern, control a second image former to form the second test pattern on the recording medium, the second test pattern including figures arranged in a second direction on the two-dimensional lattice, the second direction being inclined relative to each of the X-axis direction and the first direction. |
US09895916B2 |
Print head support assembly and inkjet printer comprising such assembly
In a print head support assembly for carrying a number of print heads and for positioning the number of print heads, the print head support assembly includes a carriage plate provided with reference elements for positioning the number of print heads, the carriage plate being further provided with at least four support positions and a support sub-assembly provided with at least four adjustable mounting points for coupling to said at least four support positions and for supporting the carriage plate at said at least four support positions. The support sub-assembly is configured to constrain the carriage plate in six degrees of freedom with respect to a position of the carriage plate and to constrain the carriage plate in at least one degree of freedom with respect to a shape of the carriage plate. Thus, a light-weight and compliant carriage plate may be used to provide for a light-weight carriage suitable for high-speed printing. |
US09895914B2 |
Media transporting device and inkjet printer
A tension applying member of an inkjet printer can apply tension on a printing medium by pushing a portion of the printing medium that is not wound by a winding mechanism by its own weight in a rotating direction indicated with an arrow having an axis line as a center; a transport controller causes a motor to generate a power for winding the printing medium when a predetermined tension is no longer applied on the printing medium by the tension applying member; and the winding mechanism limits a torque with a torque limiter and applies a predetermined tension on the printing medium when the motor is caused to generate the power for winding the printing medium when the predetermined tension is no longer applied on the printing medium by the tension applying member. |
US09895913B2 |
Printing medium holder
A printing medium holder system is described which has first and second printing medium holders, a connection mechanism to connect the holder system to a printer and a pivot mechanism. The pivot mechanism is connected to each of the first printing medium holder, the second printing medium holder and the connection mechanism. The pivot mechanism is pivotable so that each of the first printing mechanism holder and the second printing mechanism holder move relative to the connection mechanism between a first configuration of the holder system and a second configuration of the holder system. A printing system and a printing device are also described. |
US09895912B1 |
Printing method
To provide a printing method capable of inhibiting a paper sheet from being damaged at the time of conveyance and efficiently starting reprinting with high positional accuracy after printing is once stopped.The present invention is directed to a printing method of printing a unit image G by a printing part 2 based on detection of a reference punched hole 41 of a hole detection sensor 4 to form a print portion P1, then stopping printing to form a non-print portion P0, then by a mark detection sensor 3 detecting a register mark G2, recognizing a boundary between the print portion P1 and the non-print portion P0, and reprinting the unit image G from the non-print portion P0 based on detection of the reference punched hole 41 by the hole detection sensor 4. |
US09895911B2 |
Image forming apparatus
When trial printing is executed in a repeat printing mode, trial printing is performed in size of an image of one piece in a layout in which a plurality of images are supposed to be printed in the repeat printing mode normally. A user who has checked a finished state of the trial printing sets, when the finished state is in a desired state, the recording paper on which the trial printing is performed to the paper feed portion again and executes the repeat printing. Thereby, in a blank space excluding a print image which is printed with a first time trial printing, a scheduled quantity of a plurality of images are repeatedly printed. |
US09895910B2 |
Printing print frames based on measured frame lengths
In an example implementation, a processor-readable medium stores code representing instructions that when executed by a processor cause the processor to initiate motion of a media web in an inkjet web press, begin printing a print frame based on a start pulse from a metering device, verify that printing the print frame is complete, receive a signal from the metering device that a frame-length of the media web has been measured at the output of the press, and begin printing a new print frame based on the verification and the signal. |
US09895907B2 |
Inkjet printer
An inkjet printer is an inkjet printer for performing printing on a print medium, and includes: a platen, having a groove formed at a position facing an inkjet head and configured to support a print medium; an air blowing unit, for sucking air from an inside of the groove; a lid, attachable to and detachable from the platen and configured to cover an opening of the groove and support the print medium by a surface of the lid when attached to the platen; a storage part, for storing the lid detached from the platen; and a link mechanism, for guiding movement of the lid between the platen and the storage part. |
US09895896B2 |
Anti-wetting, low adhesion coatings for aqueous ink printheads
Disclosed herein are methods for reducing drooling, wetting or adhesion on a front face of an inkjet printhead configured for ejecting aqueous ink. The methods including disposing an anti-wetting, low adhesion coating onto a surface of the inkjet printhead front face, wherein the anti-wetting, low adhesion coating is a reaction product of a reactant mixture including a triisocyanante and a perfluoropolyether diol compound having an ethyoxylated spacer; and ejecting a drop of an aqueous ink having a surfactant from the printhead, wherein the aqueous ink drop exhibits a contact angle of greater than about 40° and a sliding angle of less than about 30° with a surface of the coating on the inkjet printhead front face. |
US09895880B2 |
Method for adjusting recording head, and image forming apparatus
When discharge timing of a first head module and a second head module, adjacent to each other, is adjusted in a recording head in which a plurality of head modules each having s nozzle array in which a plurality of nozzles is arranged in different positions in a first direction is joined in a second direction intersecting with the first direction, the discharge timing is adjusted so that a complementary region recording shift amount being a recording shift amount in the first direction in a complementary region in a joined portion between the first head module and the second head module becomes a value between a first non-complementary region recording shift amount and a second non-complementary region recording shift amount that are recording shift amounts in the first direction in respective non-complementary regions in the first head module and the second head module. |
US09895877B2 |
Printing apparatus and printing method
To more appropriately carry out printing at high precision even when a gap distance is large. A printing apparatus includes an inkjet head, a main scan driver, and a controller, where the controller sets a moving speed of the inkjet head according to a gap distance, and sets the moving speed in a main scanning operation so that an entering angle at a time of landing of the ink droplet on a medium becomes smaller than or equal to 45 degrees with respect to at least a position where the gap distance becomes the largest in a region of the medium to become a target of the main scanning operation. |
US09895875B2 |
Printing unit having a plate cylinder and plate changer
A printing unit has a printing form cylinder. A plate changer is arranged in a manner which is allocated to the printing form cylinder. The plate changer has a bearing surface on which a printing form, which is arranged or is to be arranged on the printing form cylinder, can be laid. That bearing surface is arranged such that it can be moved to and fro between at least two defined positions longitudinally with respect to the rotational axis of the printing form cylinder. The printing form is arranged and registered on the bearing surface of the plate changer. At least two edges of a carrier for the relevant printing form, which are arranged at a right angle with respect to each other, are brought into physical contact with register pins which are arranged on the bearing surface of the plate changer. A first edge of the carrier of the relevant printing form is arranged to bear against a first register pin and a second edge, orthogonal with respect to the first edge, of the carrier of the relevant printing form, is arranged to bear against a second register pin. The printing unit is preferably arranged as a device for printing hollow bodies. |
US09895874B2 |
Screen printing apparatus and screen printing method
A screen printing apparatus for printing paste on a printed pattern of a print target constituted of a substrate or a plurality of aligned substrates includes a mask having a plurality of opening patterns different in size from one another. The screen printing apparatus images the substrate or one of the aligned substrates constituting the print target, and calculates a level of deformation by expansion and contraction of the print target, based on a result of the imaging. The screen printing apparatus then selects an opening pattern from among the opening patterns, based on the calculated level of deformation by expansion and contraction of the print target, brings the print target into contact with the mask to superimpose the selected opening pattern on the printed pattern, and deposits the paste on the printed pattern. |
US09895866B2 |
Anisotropic organic thin film and its manufacturing method
Disclosed are an anisotropic organic thin film and its manufacturing method. The method includes steps of depositing a mixed solution including an ionic liquid and a polymerizable material on a substrate; separating positive ions from negative ions in the ionic liquid, so that the polymerizable material is aligned; polymerizing the aligned polymerizable material, so that an aligned first thin film is obtained after cured; and depositing liquid crystal molecules on the first thin film, and polymerizing the liquid crystal molecules to form a second thin film, wherein the second thin film is aligned in a way that matches with the first thin film, and the first thin film and the second thin film constituent the anisotropic organic thin film. |
US09895862B2 |
Multi-layered assembly with tight peel control
Embodiments disclosed herein provide for multi-layered assemblies comprising a carrier having opposed sides; a heat sealable layer disposed on at least a portion of one of said sides of the carrier, said heat sealable layer comprising a partially salt neutralized ionomer; and a polymeric film comprising polyurethane and having opposed sides, wherein one of said sides of the polymeric film is in at least partial contact with said heat sealable layer, methods of making the same as well as other variations. |
US09895858B2 |
Sheet processing apparatus, method for controlling sheet processing apparatus, and storage medium
A sheet processing apparatus includes a processing unit, a sheet discharge unit, a determination unit, and a control unit. The processing unit performs crease processing on a sheet. The sheet discharge unit discharges a sheet having been subjected to the crease processing by the processing unit. The determination unit determines whether a number of the discharged sheets having been subjected to the crease processing exceeds a predetermined number of sheets. The control unit performs control to cause the discharge unit to discharge a sheet. In a case where the determination unit determines that the number of the discharged sheets having been subjected to the crease processing exceeds the predetermined number of sheets, the control unit performs control to cause the discharge unit to not discharge sheets having been subjected to the crease processing onto the discharge destination. |
US09895855B2 |
Tyre equipped for attaching an object to the wall thereof and method for making same
A tire is described that includes a casing defining a cavity and equipped to receive an object, such as an electronic circuit, for example, through use of a two-part attachment, such as a touch-close attachment, of which a first part is fixed to a wall of the casing and a second part can be joined to the first part when placed in contact with the first part to keep the object on the casing in a service position. The first part of the attachment includes connection elements that are an integral part of the wall of the casing of the tire. The connection elements allow these two parts to have freedom to move relative to each other, thereby limiting the transmission of stresses, which affect the wall of the tire, to the object. The connection elements may be loops of flexible thread formed by the extremities of turns of a coiled thread integrated into the wall of the tire during the tire's manufacture. |
US09895853B2 |
Holographic storage layer, holographic disk using the same, and method for manufacturing the same
A holographic storage layer includes a reflective structure and photosensitive units. The reflective structure is a grid-shaped structure and includes cavities. The photosensitive units are disposed in the cavities, in which each of the photosensitive units is surrounded by the reflective structure. First openings and second openings are defined by the reflective structure, and the photosensitive units are exposed by the first openings and the second openings respectively. |
US09895848B2 |
Systems and tooling for manufacturing composite parts and related methods
Disclosed systems and tooling for manufacturing flanged ducts may improve upon prior art manufacturing techniques, such as by increasing ease of manufacturing and/or quality of resulting parts formed by the systems and tooling. One example of tooling includes a first tool piece that may be coupled to a base, and a second tool piece that is selectively coupled to and removable from the first tool piece. When positioned together in a closed position, the first tool piece and second tool piece form a composite material-receiving surface and a flange surface on which composite material may be placed and cured in order to form a composite part, such as a flanged duct. Such tooling may allow for placement of composite material over a male radius of the tooling, thereby improving ergonomics of the manufacturing process, as compared to attempting to place composite material into a female radius of prior art tooling. |
US09895842B2 |
Selective sintering of structurally modified polymers
A three-dimensional object is manufactured by selective sintering by means of electromagnetic radiation, wherein the powder comprises a polymer or copolymer having at least one of the following structural characteristics: (i) at least one branching group in the backbone chain of the polymer or copolymer, provided that in case of the use of polyaryletherketones (PAEK) the branching group is an aromatic structural unit in the backbone chain of the polymer or copolymer; (ii) modification of at least one end group of the backbone chain of the polymer or copolymer; (iii) at least one bulky group within the backbone chain of the polymer of copolymer, provided that in case of the use of polyaryletherketones (PAEK) the bulky group is not selected from the group consisting of phenylene, biphenylene, naphthalene and CH2— or isopropylidene-linked aromatics; (iv) at least one aromatic group non-linearly linking the backbone chain. |
US09895841B2 |
User specific design customization for 3D printing
Methods, systems, and apparatus, including computer programs encoded on computer storage media, for determining 3D printing customizations for a user. One of the methods includes receiving data indicating a selection of a product design by a user for creation of a three-dimensional product that includes a plurality of attributes, determining a style which includes values for some of the plurality of attributes and that is associated with the user, for each of the plurality of attributes determining whether the style includes a value for the respective attribute, and upon determining that the style includes a value for the respective attribute, customizing the product design using the value for the respective attribute, or upon determining that the style does not include a value for the respective attribute, customizing the product design using a default value for the respective attribute, and providing data for the customized product design for the three-dimensional product. |
US09895839B2 |
Fastening structure
A fastening structure (10) includes: a resin member (14) that contains a resin material, and that has a through-hole (14H) for mounting having a tapered inner wall surface (14T); a member for fastening (16) that is made of metal, and that has a collar portion (16C) that is inserted within the through-hole (14H) for mounting and whose intermediate portion has a tapered outer wall surface (16T) that abuts the tapered inner wall surface (14T), and a flange portion (16F) that projects out along an obverse face of the resin member (14) at an end portion (16Z) at a large-diameter side of the collar portion (16C); and an adhesive (18) that is provided between the obverse face (14A) of the resin member and the flange portion (16F), and that adheres the resin member (14) and the member for fastening (16). |
US09895837B2 |
Textured film and process for manufacture
A textured film, a process for manufacture of the textured film, and a light management stack, a backlight, and a display using the textured film are described. The textured film and process for manufacture thereof, include processes in which the surface texture of the optical film is controlled by incorporation of a patterned coating. The surface texture of a polymeric film, such as a polymeric optical film, is controlled by incorporation of the coating, that can fracture or deform upon stretching the film. |
US09895833B2 |
Method for producing an electrically and/or thermally conductive part from a composite material and resulting part
In order to produce a part (16) from a composite material, which is conductive at least on one of the surfaces thereof, the method consists of: the conductive overstitching (30) of a preform (20) of the part using electrically or thermally conductive threads (31, 32) with substantially parallel stitch lines (34) oriented in at least two intersecting directions. The parts obtained are adapted for the production of aircraft structures that may be subjected to lightning strikes and allow return currents from the electrical or electronic aircraft equipment and/or the discharge of heat by conduction. |
US09895831B2 |
Compression-molded parts having an embedded conductive layer and method for making same
A compression-molded part has a conductive layer embedded in the part during molding of the part. The conductive layer is generally adjacent an outer surface of the part and is preferably formed from a mesh, a foil, a pulled screen, or multiple layers of conductive elements. The part is preferably optimized for use on the exterior of an aircraft for lightning-strike or EMI protection or for use as an antenna. Methods for forming the panels of the invention include placing the conductive layer against a mold surface of a compression mold, then forming the compression-molded part with the conductive layer embedded in the part. |
US09895830B2 |
Method for producing spacers and device therefor
The invention relates to a method for producing spacers from a bone cement comprising the following chronological steps: A) controlling the temperature of a casting mold to a first temperature; B) filling a cement dough, which has a temperature that is lower than the temperature of the temperature-controlled casting mold, into the temperature-controlled casting mold; C) allowing the cement dough to cure in the casting mold to form a spacer; and D) separating the casting mold from the spacer after the spacer is cured. The invention also relates to a device for producing spacers from a bone cement through said method comprising a casting mold and a temperature control facility for controlling the temperature of the casting mold, whereby at least 80% of the inner surface of the casting mold comprises a negative image of the spacer surface to be produced. |
US09895829B2 |
Post-mold system
Disclosed herein, amongst other things, is a post-mold system (100, 200, 300, 400, 500) for conditioning a molded article (130). The post-mold system comprises a retrieval device (110, 210, 310, 410, 510) having a receptacle (112, 212, 312, 412, 512) that is configured to retrieve the molded article (130) from a mold (132) and a conditioning device (120, 320, 420, 520). The receptacle (112, 212, 312, 412, 512) is configured to be selectively transferable between the retrieval device (110, 210, 310, 410, 510) and the conditioning device (120, 320, 420, 520). The conditioning device (120, 320, 420, 520) includes a first thermal regulator (140, 240, 440) that is configured to thermally regulate the receptacle (112, 212, 312, 412, 512) when connected thereto. |
US09895827B2 |
Method and manufacturing system for producing prefabricated parts from mineral-bound building materials
A method and manufacturing system for producing prefabricated parts of mineral-bound building materials, in particular for construction of buildings is disclosed. The manufacturing system includes at least one formwork table provided for casting the prefabricated parts of mineral-bound building materials as the essential component. The manufacturing system is mobile and it can be brought to the site of use of the prefabricated parts and in particular to the erection site of a building for manufacturing the prefabricated parts. Thus, this mobility allows transporting a complete small factory for manufacturing prefabricated parts of mineral-bound building materials to very different locations. |
US09895823B2 |
Miter saw
An improved miter saw, including a base, a workbench, a stop plate, a swing arm, a motor, a cutting assembly, and an extension platform. The workbench is rotationally disposed on the base. The swing arm is rotationally disposed on the rear of the workbench. The stop plate is disposed on the rear of the base. The extension platform is disposed on two sides of the base. The upper surface of the extension platform and the supporting surface of the base are in a same plane. The extension platform is movably connected to the base through a guide rod. The extension platform comprises an L-shaped limit block and a recess corresponding to the L-shaped limit block. The L-shaped limit block is adapted to turn over in the recess horizontally or vertically along the length direction of a workpiece mounted on the workbench for cutting. |
US09895822B2 |
Automated frangible cannula breaker
Apparatus and method are disclosed for opening a frangible internal cannula located in flexible fluid flow path. The frangible cannula has first and second portions joined by a frangible junction and the apparatus and method cause bending of one portion of the cannula relative to the other portion that results in breaking of the frangible junction and opening of the flow path to fluid flow therethrough. |
US09895819B1 |
Continuous feed fabric cutting
Aspects of continuous feed fabric cutting are described. In one example, a system includes a textile cutter having a cutting table and a laser cutting assembly. The laser cutting assembly includes a set of laser cut modules arranged in a row to provide a combined laser cutting span across at least a portion of the cutting table. The laser cut modules provide respective laser cutting spans which, collectively, form the combined laser cutting span across the cutting table. As a textile sheet is fed across the cutting table of the textile cutter, one or more textile panels or pieces of fabric can be cut out from the textile sheet using laser beams along the region where the textile sheet intersects or crosses the combined laser cutting span. The laser cutting assembly can provide continuous cutting as a sheet is being fed across the cutting table. |
US09895815B2 |
Multiple joints robot with mechanism for cooling motor
A multiple joint robot includes a movable body, a motor for generating power to actuate the movable body, a motor housing for accommodating the motor, and a cooling structure for dissipating heat generated from the motor. The cooling structure includes a heat conductor in the motor housing, and the heat conductor forms a heat conductive path for transmitting heat from the motor to the motor housing. The heat conductor has a first surface in contact with a heat generating surface of the motor and a second surface in contact with an inner surface of the motor housing. A position of the heat conductor can be adjusted to form the heat conductive path by sliding the first surface and/or the second surface along the opposed heat generating surface or inner surface. |
US09895814B2 |
Industrial robot with at least one drive
A robotic arm of an industrial robot includes successive links connected by joints having respective drives and associated transmissions for moving the links. First and second links have respective first and second housings that transfer forces and moments arising from the weight of the robotic arm, or a load carried by the arm, to adjacent links. A first drive rotatably connecting the first and second links includes a drive housing, a rotor, and a stator connected to the drive housing. The drive housing is fastened to the first housing of the first link and forms an external wall of the robotic arm. The transmission associated with the first drive includes an input link that is joined with the rotor of the first drive. An output of the first drive is connected to a flange that is fastened to the second housing and rotatable relative to the drive housing. |
US09895811B2 |
Targets and processes for fabricating same
In one embodiment, the present disclosure provides a target or mold having one or more support arms coupled to a substrate. The support arm can be used in handling or positioning a target. In another embodiment, the present disclosure provides target molds, targets produced using such molds, and a method for producing the targets and molds. In various implementations, the targets are formed in a number of disclosed shapes, including a funnel cone, a funnel cone having an extended neck, those having Gaussian-profile, a cup, a target having embedded metal slugs, metal dotted foils, wedges, metal stacks, a Winston collector having a hemispherical apex, and a Winston collector having an apex aperture. In yet another embodiment, the present disclosure provides a target mounting and alignment system. |
US09895809B1 |
Visual annotations in robot control interfaces
Methods, apparatus, systems, and computer-readable media are provided for visually annotating rendered multi-dimensional representations of robot environments. In various implementations, an entity may be identified that is present with a telepresence robot in an environment. A measure of potential interest of a user in the entity may be calculated based on a record of one or more interactions between the user and one or more computing devices. In some implementations, the one or more interactions may be for purposes other than directly operating the telepresence robot. In various implementations, a multi-dimensional representation of the environment may be rendered as part of a graphical user interface operable by the user to control the telepresence robot. In various implementations, a visual annotation may be selectively rendered within the multi-dimensional representation of the environment in association with the entity based on the measure of potential interest. |
US09895807B2 |
Setting synchronized robot movements
An inventive programming means for programming a movement of a robot axis arrangement and a movement of at least one further robot axis arrangement is adapted to synchronize the pair of positions of the movement of the robot axis arrangement and the pairs of positions of the movement of at least one more robot axis arrangement, and while maintaining this synchronization, to specify at least another position between either one of these pairs of positions, which is not synchronized with another position of the hereby synchronized pair of positions. |
US09895799B2 |
System for cooperation between a human and a robotic device
A robot control system has a jointed mechanism with sensors and actuators in a rotatable sphere, tracks movements of a person engaged in the jointed mechanism through the sensors, as commands causing movement of a robot machine, which also has sensors and actuators mirroring the sensors and actuators of the jointed mechanism. The robot machine sends activity data back to influence actuators at the jointed mechanism, providing tactile feedback to the person engaged in the jointed mechanism. |
US09895793B2 |
Speed-selectable hand tool
A speed-selectable hand tool includes a handle, a cage member fixed to the handle, a shaft member extending into the cage member, a sleeve member sleeved on the shaft member and extending into the cage member, a plurality of transmission members each meshing with the shaft member and the sleeve member, a plurality of pawls mounted to the cage, a knob surrounding the pawls, and an outer casing mounted with the transmission members. The speed-selectable hand tool is operable to serve as a non-ratcheting hand tool or a ratcheting hand tool by rotating the knob relative to the cage member to actuate the pawls. The rotational speed of the shaft member relative to the handle is selectable through operation of the outer casing. |
US09895792B2 |
Workpiece clamp device capable for changing clamp angle
A workpiece clamp device capable for changing clamp angle is arranged on a base plane and comprises a first and a second movable blocks, a driving block, at least one first and at least one second elastic members, at least one first and at least one second cylinders, and at least one third and at least one fourth elastic members. Since the first and the second cylinders are slightly rotatably and detachably respectively embedded in the first and the second embedding grooves to make the first and the second rough surfaces be exposed and the elasticity of the third and the fourth elastic members is cooperated therewith, the first and the second rough surfaces are slightly fine-tuned based on the shapes and sizes of the workpieces so as to be suitable for clamping and fastening the workpieces with different shapes. |
US09895789B2 |
Polycrystalline diamond composite compact elements and methods of making and using same
A polycrystalline diamond composite compact element comprises a body of polycrystalline diamond material and a cemented carbide substrate bonded to the body of polycrystalline material. The cemented carbide substrate has tungsten carbide particles bonded together by a binder material comprising an alloy of Co, Ni and Cr. The tungsten carbide particles form between 70 weight percent and 95 weight percent of the substrate. The binder material comprises between about 10 to 50 wt. % Ni, between about 0.1 to 10 wt. % Cr, and the remainder weight percent comprising Co. The size distribution of the tungsten carbide particles in the substrate has fewer than 17 percent of the carbide particles with a grain size of equal to or less than about 0.3 microns, between about 20 to 28 percent of the tungsten carbide particles having a grain size of between about 0.3 to 0.5 microns; between about 42 to 56 percent of the tungsten carbide particles having a grain size of between about 0.5 to 1 microns; less than about 12 percent of the tungsten carbide particles being greater than 1 micron; and the mean grain size of the tungsten carbide particles is about 0.6+0.2 microns. |
US09895785B2 |
Motor driving device of machine tool comprising plurality of switching elements
A motor driving device comprises a first heat sink arranged outside a housing, a second heat sink arranged inside the housing, and a heat conduction plate configured to thermally connect the first heat sink and the second heat sink. A switching element for a spindle is mounted on the first heat sink, and a switching element for a feed axis is mounted on the second heat sink. |
US09895774B2 |
Systems and methods for low-manganese welding alloys
The present disclosure relates generally to welding alloys and, more specifically, to welding consumables (e.g., welding wires and rods) for welding, such as Gas Metal Arc Welding (GMAW), Gas Tungsten Arc Welding (GTAW), Shielded Metal Arc Welding (SMAW), and Flux Core Arc Welding (FCAW). In an embodiment, a welding alloy includes less than approximately 1 wt % manganese as well as one or more strengthening agents selected from the group: nickel, cobalt, copper, carbon, molybdenum, chromium, vanadium, silicon, and boron. Additionally, the welding alloy has a carbon equivalence (CE) value that is less than approximately 0.23, according to the Ito and Bessyo carbon equivalence equation. The welding alloy also includes one or more grain control agents selected from the group: niobium, tantalum, titanium, zirconium, and boron, wherein the welding alloy includes less than approximately 0.6 wt % grain control agents. |
US09895773B1 |
Method and system for marking a material using a laser marking system
A laser marking system for marking a length of material includes a laser device for emitting a marking beam. A motor moves the length of material relative to the laser device. A sensing system detects a predetermined movement of the length of the material and provides a speed signal and a distance signal, and a controller is provided in operative communication with the sensing system and the laser device for receiving the speed signal and the distance signal and responsively directing the marking beam of the laser system onto the length of material in a predetermined pattern. |
US09895770B2 |
System for automatically inspecting and trimming a patch antenna
A system for automatically inspecting and trimming a ceramic patch antenna includes an inspection apparatus electrically connected to a radio frequency component testing fixture. The inspection apparatus is inputted standard parameters of electrical characteristics of the ceramic patch antenna. The ceramic patch antenna is arranged on the radio frequency component testing fixture. Then, the inspection apparatus is configured to measure electrical characteristics of the ceramic patch antenna and to judge whether the electrical characteristics of the ceramic patch antenna are the same as the standard parameters or not. The inspection apparatus is configured to drive a trimming machine for trimming a radiation metal surface of the ceramic patch antenna if the electrical characteristics of the ceramic patch antenna are different from the stand parameters. |
US09895764B2 |
Resistance spot welding system
A resistance spot welding system includes a calculation unit that calculate and store a time variation of an instantaneous amount of heat generated, a division unit that divides a current pattern into a plurality of steps and stores a time variation of the instantaneous amount of heat generated and a cumulative amount of heat generated for each step as a target value, and an adaptive control unit that starts welding upon subsequent actual welding using, as a standard, a time variation curve of the instantaneous amount of heat generated that is stored as the target value, and adjusts welding current and voltage during welding, when a time variation amount of an instantaneous amount of heat generated deviates during any step from the time variation curve by a difference, so as to compensate for the difference during a remaining welding time in the step. |
US09895761B2 |
Method and apparatus for controlling a welding system
A wireless control system (10) for a welding system (12) including an electrical control interface (18). The control system (10) may generally comprise a foot pedal (14) and a receiver (16). The foot pedal (14) may include a pivotable housing (20), a sensing element (22) operable to sense a position of the pivotable housing (20) and provide a corresponding pedal position signal, and a transmitter (24) operable to wirelessly transmit the pedal position signal. The receiver (16) may include an antenna (36) operable to wirelessly receive the pedal position signal generated by the foot pedal (14), a processor (38) operable to process the received pedal position signal, and a connector (40) operable to connect with the electrical control interface (18) associated with the welding system (12) to provide the processed pedal position signal thereto. |
US09895759B2 |
Wire electric discharge machining apparatus, wire electric discharge machining method, and control device
A wire electric discharge machining apparatus includes a machining unit that forms a product part by cutting off an outer frame portion from a workpiece and a control device that controls the machining unit. The machining unit machines a first boundary region in a boundary between the outer frame portion and the product part to leave an uncut portion, cuts off the product part from the outer frame portion by machining a second boundary region, which is the uncut portion, and repeats machining for the first/second boundary regions. When n is a natural number equal to or larger than 2, the control device sets, based on a machining state when the first boundary region is machined, different machining conditions as first machining conditions in machining the first boundary region for n-th time and second machining conditions in machining the second boundary region for n-th time. |
US09895756B2 |
Flip-down table-saw fence
A Flip-Down Table-saw Fence (FTF) is disclosed for accurately cutting cabinet parts faster while eliminating the need to do math and without the use of a tape measure. An apparatus for adjusting a width of a cut by a table saw, comprises a saddle for setting on a fence of the table saw, a side of the fence defining the width of the cut; and at least a first spacer hinged to the saddle such that the first spacer can be flipped down about a first pivot point to be disposed adjacent to the side of the fence shortening the width of the cut by a first spacer width. |
US09895751B2 |
Cutting tool and method for producing a cutting tool
The cutting tool (1), especially drill or milling cutter, comprises a base (3) which extends in an axial direction (2) and has an outer shell (14) with at least one interior recess (18) that extends in the axial direction (2), a supporting structure (16) having at least one separating piece (26) which separates a plurality of recesses (18) from each other being formed in the supporting structure. The cutting tool (1) is particularly a solid hard-metal tool. The supporting structure (16) ensures an efficient use of material. |
US09895745B2 |
Method for demoulding a casting, cast from a light metal melt, from a casting mould
A method for demolding a casting from a casting mold having at least one casting core which images a passage opening in the casting connecting two outer sides of the casting and is produced from a molding material bound by a binder which decomposes under the influence of temperature, wherein the casting mold undergoes a heat treatment in a furnace for the demolding, during which it is heated to a temperature at which the binder loses its binding effect. In the furnace, hot gas is flowed through a passage formed in the casting core of the casting mold, the temperature of the hot gas corresponding at least to the temperature at which the binder of the molding material loses it binding effect such that the casting core decomposes into fragments or separate sand particles as a consequence of the influence of the hot gas. |
US09895744B2 |
Process and apparatus for direct chill casting
A process in direct chill casting wherein molten metal is introduced into a casting mold and cooled by impingement of a liquid coolant on solidifying metal in a casting pit including a movable platen and an occurrence of a bleed-out or run-out is detected the process including exhausting generated gas from the casting pit; and introducing an inert gas into the casting pit, the inert gas having a density less than a density of air; reducing any flow of the liquid coolant. |
US09895743B2 |
Method and device for casting a cast part
The invention relates to a method for casting a cast part according to the tilt pour casting principle, and the metal melt (1) is poured from at least one tiltable casting vessel (2) into a casting mold (3) having a mold cavity (4) that forms the cast part, and the at least one casting vessel (2) and the casting mold (3) are arranged next to each other in one step, and in a subsequent step the metal melt (1) is settled, and the at least one casting vessel (2) and the casting mold are positioned in such a way before pouring the metal melt (1) from the at least one casting vessel (2) into the casting mold (3) that a settled level (a) of the metal melt (1) in the at least one casting vessel (2) is at the same height as a section of an inner surface of the casting mold (3). |
US09895739B2 |
Apparatus for making border wire
An apparatus is provided which makes a border wire having a rectangular cross-section. The apparatus is adapted to receive a roll of wire having a circular cross-section, straighten the wire and change the cross-section of the wire to rectangular. The reconfigured wire is then accumulated, passed through another straightener, cut to size and then bent into a rectangular configuration. Opposed ends of the piece of wire having a rectangular cross-section are welded together to complete the border wire. The apparatus has an ejector which removes the completed border wire from the apparatus. |
US09895735B2 |
Method for joining two metal strip ends
A method and a device are provided for joining the ends of strips with two or more surfaces arranged flat on top of each other, more particularly metal sheets that can be coiled, in order to draw these successively through a treatment or machining system. It is provided that the strip ends are joined by means of a plurality of eyelets arranged essentially transversally to the strip direction, wherein initially all holes are simultaneously punched in a first stroke and then all eyelets are pressed in a second stroke. The device has a clamping device and a machining unit, which has a working tool with a plurality of punching and pressing tools, wherein the working tool and a die are displaceable by the distance between two neighboring individual tools and wherein above the punching and pressing tools, a pressing device is provided. |
US09895733B2 |
Systems and methods for extruding tubes
In some embodiments, the instant invention provides for a method including: extruding, utilizing a first die and a mandrel, a hollow tube having a first tube section having a first outer tube diameter of Z, a first inner tube diameter, and a first length; extruding, utilizing a second die and the mandrel, continuing from an end of the first tube section, a hollow tube having a second tube section having a second inner tube diameter and a second length, where the second die has a first die section, and where an angle of a wall of the first die section of the second die relative to a longitudinal axis of the hollow tube ranges from 10 to 45 degrees; extruding a third tube section, a third inner tube diameter, and a third length, and producing a monolithic hollow stepped tube extrudate. |
US09895730B2 |
Method for extraction and surfactant enhanced subsurface contaminant recovery
Methods and compositions for removing contaminants from soil and groundwater by extracting the contaminants and assisting the extraction by provision of an oxidant introduced prior to or simultaneously with a surfactant into the subsurface. Extractable contaminant can be extracted from the subsurface. The amount and/or distribution of contaminant in the subsurface can be characterized. The extracting of contaminant and the introducing of oxidant and surfactant can be coordinated to reduce contaminant to a target amount. A portion of the contaminant can be oxidizable. |
US09895726B1 |
Method for cleaning a food waste recycling bin of a food waste recycling appliance
A method for cleaning a food waste recycling bin of a food waste recycling appliance includes maintaining between a lower portion and an upper portion of the food waste recycling bin a temperature differential sufficient such that water vapor is emitted from waste located in the lower portion of the food waste recycling bin. |
US09895724B2 |
Pneumatic sweeping system
A method and system for removing loose impediments from a surface in a manufacturing setting. The surface may be where a widget is processed. As the widget is processed, loose impediments may fall onto the surface. The surface may be transported to a cleaning station where at least one nozzle directs a stream of fluid onto the surface to displace the loose impediments. A container may be provided adjacent to the surface to receive the loose impediments displaced from the surface. The at least one nozzle may continuously direct the stream of fluid onto to surface so long as the surface is present at the cleaning station. When the surface is no longer present at the cleaning station, the at least one nozzle may be deactivated. |
US09895723B2 |
Gas purge apparatus, load port apparatus, installation stand for purging container, and gas purge method
In a gas purge apparatus, a load port apparatus, an installation stand for a purging container, and a gas purge method, the inside of the purging container is filled with a cleaning gas until just before transportation, and a placement failure does not happen to the next purging container to be placed. A purge nozzle is moved to a direction separating from a purge port after detecting a movement of a table on which the purging container is installed to an undock position and a stop of a feeding of the cleaning gas. |
US09895721B2 |
Rotisserie oven with shooter tube cleaning system
A grease removal system for an oven that collects excess grease during a cook cycle into a reservoir, which also serves as a container for cleaning solution during a clean cycle. A high-pressured shooter tube allows the cleaning solution to be shot from the reservoir to a ceiling of the oven cavity without the need for extra tubing. |
US09895720B2 |
Methods and apparatus of producing collectible cards
Methods and apparatus of producing collectible cards are disclosed. An example method includes producing a first stack of cards including a first card type and a second card type from a single substrate sheet, separating the first stack of cards into a first sub-stack and a second sub-stack. The first sub-stack includes the first card type and the second sub-stack includes the second card type. The example method includes comparing a first top card of the first sub-stack to a first reference card and, based on the first top card being substantially similar to the first reference card, automatically transferring the first sub-stack to a first tray designated to receive the first card type. |
US09895718B2 |
CMOS ultrasonic transducers and related apparatus and methods
CMOS Ultrasonic Transducers and processes for making such devices are described. The processes may include forming cavities on a first wafer and bonding the first wafer to a second wafer. The second wafer may be processed to form a membrane for the cavities. Electrical access to the cavities may be provided. |
US09895716B2 |
Repair process and a repaired component
Matrix composite component repair processes are disclosed. The matrix composite repair process includes applying a repair material to a matrix composite component, securing the repair material to the matrix composite component with an external securing mechanism and curing the repair material to bond the repair material to the matrix composite component during the securing by the external securing mechanism. The matrix composite component is selected from the group consisting of a ceramic matrix composite, a polymer matrix composite, and a metal matrix composite. In another embodiment, the repair process includes applying a partially-cured repair material to a matrix composite component, and curing the repair material to bond the repair material to the matrix composite component, an external securing mechanism securing the repair material throughout a curing period, In another embodiment, the external securing mechanism is consumed or decomposed during the repair process. |
US09895714B2 |
Crystalline organic-inorganic halide perovskite thin films and methods of preparation
A film comprising a crystalline halide perovskite composition having the following formula: AMX3 (1) wherein: A is an organic cation selected from the group consisting of methylammonium, tetramethylammonium, formamidinium, and guanidinium; M is at least one divalent metal; and X is independently selected from halide atoms; wherein the crystalline film of the halide perovskite composition possesses at least one of an average grain size of at least 30 microns, substantial crystal orientation evidenced in an ordering parameter of at least 0.6, and a level of crystallinity of at least 90%. Methods for producing films of these halide perovskite compositions using ionic liquids instead of volatile organic solvents are also described herein. |
US09895701B2 |
Shower water rotating structure
A shower water rotating structure includes a main body having a water inlet and water outlet, and a rotating disk, pinion, water inclining support, impeller and rotors arranged top to bottom inside the main body; the water inclining support has inclined water inlet adapted to guide water flow to impact the impeller to rotate the impeller configured with a drive gear adapted to drive the pinion to rotate; the pinion is configured with a guide rod adapted to drive the rotating disk to rotate; the rotating disk is distributed radially with guide grooves for the staged matching with the guide rod; and a lower part of rotating disk is configured with a gear adapted to drive the rotors having an inclined water hole and capable of being rotated in the water outlet of the main body, thereby realize spray having a pulsating rotating water effect. |
US09895699B2 |
Circuit-based optoelectronic tweezers
A microfluidic optoelectronic tweezers (OET) device can comprise dielectrophoresis (DEP) electrodes that can be activated and deactivated by controlling a beam of light directed onto photosensitive elements that are disposed in locations that are spaced apart from the DEP electrodes. The photosensitive elements can be photodiodes, which can switch the switch mechanisms that connect the DEP electrodes to a power electrode between an off state and an on state. |
US09895696B2 |
Material processing apparatus with auxiliary drive system
A material processing apparatus comprising a rotary operating device coupled to a material processing device, especially a crusher. A primary drive system is coupled to the rotary operating device. An auxiliary drive system has a rotary drive member and is operable between a driving state, in which it is coupled to the rotary operating device, and a non-driving state in which it does not rotate the rotary operating device. The apparatus is operable in a primary mode in which the primary drive system rotates the rotary operating device and the auxiliary drive system is in its non-driving state, or in an auxiliary mode in which the auxiliary drive system is in its driving state. In the auxiliary mode, the auxiliary drive system may be operated to repeatedly rotate the rotary operating device alternately in both rotational directions to impart a back-and-forth rocking motion to the material processing device. |
US09895695B2 |
Device and method for removing a peelable seal
A container or array of containers that is are sealed with a peelable seal is transported via a conveyor along a processing path toward a desealing station at which an adhesive surface having a width substantially the same as or greater than the width of the seal is pressed against the upper surface of the peelable seal. A collection rod applies a downward pressure on the adhesive surface, pressing it against the seal and keeping the container or container array in position on the conveyor as the plate moves with the conveyor. As the leading edge of the seal passes the collection rod, the adhesive surface is rolled upward, away from the plane of the seal, pulling up on the leading edge of the seal to separate it from the container or container array while the container or container array is held down by the roller. The removed seal is then discarded. |
US09895687B2 |
Process for regeneration of tar reformer catalyst
The invention relates to a catalyst regeneration process for a tar reforming catalyst within a catalyst bed in a tar reformer. The process comprises the steps of:—Admitting a main gas stream with controlled temperature and oxygen content to an inlet into the tar reformer;—Passing the main gas stream through the catalyst bed to form an oxygen depleted gas stream;—Exiting the oxygen depleted gas stream from the tar reformer; and—Recycling at least a part of the oxygen depleted gas stream exiting from the tar reformer back into said main gas stream upstream said tar reformer. The temperature of said main gas stream at the inlet is controlled to be within the range from about 500° C. to about 1000° C. |
US09895686B2 |
Double-component modified molecular sieve with improved hydrothermal stability and production method thereof
A method for producing double-component modified molecular sieve comprises adding molecular sieve to an aqueous solution containing phosphorus to form a mixture, allowing the mixture to react at pH of 1-10, temperature of 70-200° C. and pressure of 0.2-1.2 MPa for 10-200 min, and then filtering, drying and baking the resultant to obtain phosphorus-modified molecular sieve, and then adding the phosphorus-modified molecular sieve to an aqueous solution containing silver ions, allowing the phosphorus-modified molecular sieve to react with silver ions at 0-100° C. in dark condition for 30-150 min, and then filtering, drying and baking. The obtained double-component modified molecular sieve contains 88-99 wt % molecular sieve with a ratio of silica to alumina between 15 and 60, 0.5-10 wt % phosphorus (based on oxides) and 0.01-2 wt % silver (based on oxides), all based on dry matter. A catalyst produced from the double-component modified molecular sieve has improved hydrothermal stability and microactivity. |
US09895685B2 |
Method of preparing catalyst having Pt—Pd dispersed polymer electrolyte multilayers treated with sulfuric acid
Disclosed herein is a method of preparing a catalyst having Pt—Pd dispersed in polymer electrolyte multilayers, suitable for use in production of hydrogen peroxide, wherein the use of the catalyst prepared by forming polymer electrolyte multilayers on an anionic resin support and performing sulfuric acid treatment and loading (insertion or attachment) of Pt—Pd particles can result in high hydrogen conversion, hydrogen selectivity and hydrogen peroxide yield for a long period of time. |
US09895683B2 |
Zeolite, manufacturing method of the same, and catalytic cracking catalyst of paraffin
A MSE-type zeolite which has a Si/Al ratio of 5 or more, is a proton-type zeolite, and is obtained by transforming a raw material MSE-type zeolite synthesized without using a structure directing agent into an ammonium-type zeolite through ion exchange, then, exposing the MSE-type zeolite to water vapor, and subjecting the exposed MES-type zeolite to an acid treatment. |
US09895682B2 |
Catalyst for selective conversion of oxygenates to aromatics
A catalyst composition comprises a self-bound zeolite and a Group 12 transition metal selected from the group consisting of Zn, Cd, or a combination thereof, the zeolite having a silicon to aluminum ratio of at least about 10, the catalyst composition having a micropore surface area of at least about 340 m2/g, a molar ratio of Group 12 transition metal to aluminum of about 0.1 to about 1.3, and at least one of: (a) a mesoporosity of greater than about 20 m2/g; (b) a diffusivity for 2,2-dimethylbutane of greater than about 1×10−2 sec−1 when measured at a temperature of about 120° C. and a 2,2-dimethylbutane pressure of about 60 torr (about 8 kPa). |
US09895680B2 |
FCC catalyst compositions containing boron oxide
Described are fluid catalytic cracking (FCC) compositions, methods of manufacture and use. FCC catalyst compositions comprise particles containing a non-zeolitic component and one or more boron oxide components. In embodiments, the FCC catalyst composition contains a zeolite component and optionally a rare earth component and a transition alumina. FCC catalytic compositions may comprise a first particle type containing one or more boron oxide components and a first matrix component mixed with a second particle type containing a second matrix component, and a zeolite. The FCC catalyst compositions can be used to crack hydrocarbon feeds, particularly resid feeds containing high V and Ni, resulting in lower hydrogen and coke yields. |
US09895679B2 |
Process for rejuvenating hydrotreating catalysts
The invention refers to a process for rejuvenating a hydrotreating catalyst comprising a group VIB hydrogenation metal and/or a group VIII hydrogenation metal, which comprises the steps of: (a) regenerating the catalyst by contacting said catalyst with an oxygen containing gas at a temperature from about 300° C. to 550° C. to obtain a regenerated carbon-reduced catalyst, (b) impregnating the regenerated carbon-reduced catalyst with a solution which consists of a mixture of water and citric acid, (c) aging the impregnated catalyst for at least 6 hours and (d) drying the aged catalyst. The invention also refers to the rejuvenated catalyst obtained and its use for hydrotreating hydrocarbon feedstocks. |
US09895676B2 |
Processes and catalysts for converting alkanes to alkenes
Generally, regenerable, encapsulated metal oxide catalysts comprising a ceramic matrix and metal catalysts may be used to convert alkanes to alkenes. The encapsulated metal oxide catalyst may be tailored to produce a variety of alkenes including ethylene, butylene, and propylene. Further, the encapsulated metal oxide catalysts advantageously allow for regeneration and reactant recovery for cost effective and environmentally friendly processes. |
US09895672B2 |
High strength seamless alginate capsules
The invention is directed to a seamless alginate capsule having a film encapsulating a fill material, in which the film comprises alginate, noncrystallizing plasticizer, and glycerol and in which a ratio by weight of noncrystallizing plasticizer to glycerol in the film is between about 1:1 and about 8:1. The invention is also directed to a method of making the seamless alginate capsules and to capsules made by the method. The capsules have excellent breaking strength and are resistant to oxidation of the fill material. |
US09895670B2 |
Head for a mixing apparatus
A head that can be coupled with a mixing apparatus includes a body that defines a longitudinal axis and includes a first side, a second side, a third side, and a fourth side. Each of the sides includes a projection. The body is configured to receive a microplate between the sides, which is removably secured to the body by the projections. At least one vertical channel in the body is configured to removably secure a first test tube to the body so that the longitudinal axis of the tube is perpendicular to the longitudinal axis of the body. The first vertical channel has a first diameter. At least one horizontal channel in the body is configured to removably secure a second test tube so that the longitudinal axis of the tube is parallel to the longitudinal axis of the body. The first test tube and the second test tube can be coupled to the body at the same time. |
US09895668B2 |
Dispersion of particulate clusters via the rapid vaporization of interstitial liquid
A process for dispersing agglomerates or clusters of particles utilizing pressure generated from volatilization of an interstitial liquid. More particularly, the method relates to infusing the particles with a first liquid, placing the infused particles in a second liquid or fluid having a higher boiling point than the first liquid and heating the composition to a temperature above the boiling point of the first liquid thereby resulting in breakage of the particles. Compositions including particles dispersed by interstitial liquid vaporization are also disclosed. |
US09895660B2 |
Method for producing metal exchanged microporous materials by solid-state ion exchange
A method is disclosed for the preparation of a metal exchanged microporous materials, e.g. metal exchanged silicoaluminophosphates or metal exchanged zeolites, or mixtures of metal exchanged microporous materials, comprising the steps of providing a dry mixture of a) one or more microporous materials that exhibit ion exchange capacity and b) one or more metal compounds; heating the mixture in a gaseous atmosphere containing ammonia and one or more oxides of nitrogen to a temperature and for a time sufficient to initiate and perform a solid state ion exchange of ions of the metal compound and ions of the microporous material; and obtaining the metal-exchanged microporous material. |
US09895650B2 |
Method and device for obtaining gas products
The invention relates to a method and to a device for physical gas scrubbing, wherein a feed gas (1) containing hydrogen, carbon monoxide, carbon dioxide and also carbonyl sulphide and/or hydrogen sulphide is conducted through a first scrubbing section (W1) in countercurrent to a scrubbing medium preloaded with carbon dioxide, in order to separate sulphur components substantially selectively off from the feed gas and to generate a desulphurized gas mixture (3). In a second scrubbing section, carbon dioxide is separated off from only a subquantity of the desulphurized gas mixture by scrubbing with an unloaded scrubbing medium (4) and the resultant carbon dioxide-preloaded scrubbing medium is used completely in the first scrubbing section (W1) as scrubbing medium. |
US09895643B2 |
Wet scrubber and a method of cleaning a process gas
A wet scrubber (1) useful for cleaning a process gas comprises at least a first spray level system (20) and a second spray level system (26) arranged vertically above the first spray level system (20) in a wet scrubber tower (2). The first spray level system (20) comprises at least one gas-liquid contacting plate (38) which is operative for deflecting absorption liquid, that has been atomized by means of the second spray level system (26) and flowing downward in the wet scrubber tower (2), so deflected absorption liquid (AL) may contact process gas (F) contacted by absorption liquid atomized by the first spray level system (20). |
US09895641B2 |
Laboratory apparatus
The present invention relates to a glass laboratory apparatus that eliminates a pre filter and a provides a simpler vaporizing platform in fluid communication with a fitted disc filter arranged in an exhaust chamber to scrub solids from a gas using water filtration. A preferred embodiment of the present invention includes a main vessel adapted to hold a volume of a liquid such as water and an inlet conduit with an opening above the liquid level in the main vessel. The inlet conduit includes a vaporizing platform with a platform having four ventilated regions surrounding the platform. |
US09895640B2 |
Filter element for a filter device for gas filtration
A filter element for a filter device for gas filtration has at least two individual filters which are disposed adjacent to each other and through which the gas to be purified can flow orthogonally to the filter plane. On at least two sides, the individual filters delimit a gas collection chamber that is open on the edge side and that is fluidically connected to the clean sides of the individual filters and used to accommodate the purified gas. |
US09895637B2 |
Filter medium of a filter element, filter element and method for producing a filter medium
A filter medium of a filter element for filtering a fluid has at least one nonwoven filter layer of synthetic individual fibers. The filter layer has an increasing level of compression in a flow direction of a fluid passing through the filter medium. The filter medium has a degree of separation for particles to be filtered that increases in the flow direction of the fluid through the filter medium. The filter medium is used in a filter element for filtering fluids such as fuel or air. In a method for producing the filter medium, the synthetic fibers are deposited on a support surface in such a way that an increasing level of compression is created in a direction toward the support surface by gravity and suction acting on the fibers. |
US09895636B2 |
In-line single outlet filter with automatic clogged filter element bypass
An in-line or in situ filter is disclosed for filtering fluid flowing through a hydraulic system, and particularly an automotive hydraulic system. The filter has a magnetic base with a central opening at its outlet end and a seat with a central opening at its inlet. The base and the seat are joined by a cylindrical filter element made of a magnetically susceptible mesh screen material. A spring within the filter element biases a ball against the central opening of the seat normally sealing off the opening and forcing fluid to flow through the filter element to be filtered before exiting through the central opening of the base. If the mesh screen becomes clogged, backpressure forces the ball away from the seat against the bias of the spring to allow fluid to bypass the filter element and flow directly through the filter. In the process, ferrous debris entrained within the fluid flow continues to be captured by attraction to the magnetic base and the magnetized filter element. |
US09895635B2 |
Fluid filtration and particle concentration device and methods
Fluid filtration devices and methods of filtering fluids are described. The devices generally include a housing and an annular filter assembly, wherein the filter assembly is located inside the housing and comprises a filter material. The filter material may be, for example, an electroformed nickel screen having a smooth working surface and expanding pores. A rotating cleaning assembly comprising a distributor and wipers may be located inside the filter assembly. |
US09895632B2 |
Filter cartridges for liquid filtration; assembly; and, methods
A liquid filter cartridge is provided. Preferred seal arrangements are provided, to provide for preferred axial load conditions, with respect to one or more of the end caps of the cartridge. Some cartridge configurations provided include no core structure or outer liner structure therein, to support axial load. Assemblies using the cartridge, and methods of assembly and use, are provided. The liquid filter cartridge can be a serviceable cartridge, or it can be retained permanently in a housing. |
US09895626B2 |
Equal temperature distillation chamber and method
An equal temperature fractional distillation chamber allows for more precise distillation by providing solid particulate matter with air spaces, such as Raschig rings, to radiate heat from the bottom of the chamber to an area where the vapors are separated. This area is unencumbered by Raschig rings or other devices and can be reduced in size, as necessary, to be less than 20% or 10% of the vertical height of the chamber. Further, a distillation key can enter from the top of the chamber and come down into the chamber with rings which encourage condensation of vapors which rise upwards. In this manner, a very controlled and accurate distillation can be achieved due to the higher heat capacity of the glass or other materials around the unencumbered region. |
US09895625B2 |
Method and apparatus for preparing isopropyl alcohol
The present application relates to an apparatus for purifying isopropyl alcohol. The present application enables isopropyl alcohol to be obtained in a high purity from a feed comprising water and isopropyl alcohol with a minimum amount of energy consumption. |
US09895623B2 |
Toy couplers including a plurality of block retaining channels
Building sets including a plurality of blocks and a plurality of clips configured to engage a thickness of one or more of the blocks. Each clip includes a base and first and second substantially parallel extensions extending from the base and defining a channel therebetween into which a thickness of a block is receivable. The width of the channel is substantially equal to the thickness of the block receivable within the channel so that the thickness is frictionally retained therein. In one embodiment, the clip includes a plurality of channels. |
US09895619B2 |
Floating mobile water park
A floating amusement apparatus includes a base, at least one elevated platform secured to and supported above the base and a plurality of user-interactive amusement accessories secured to the base or the at least one elevated platform. The base includes a modular floating dock. The floating amusement apparatus is adapted to be mobile. |
US09895618B1 |
Children's entertainment device with water slide
The present disclosure provides a children's entertainment device with a water slide, including: a water slide provided with a first chamber and a first valve; and a first water spray pipe connected with the water slide, the first water spray pipe being provided with a plurality of first water spray holes. Accordingly, the water slide, which may be filled with water, applied by the children's entertainment device with a water slide can reduce an impact force imposed to the ground by the user, so that the user can be well protected. The water-filled water slide can avoid direct contact between the user and the ground, so that the user can be protected from being cut by hard objects, such as stones, tree branches, so as to avoid accidental injuries. Further, a combination of water-filled water slide and a pool can provide more entertainments in comparison with existing water slides. |
US09895615B2 |
System and method for arranging equine competitions according to participant ability groupings
A timed equine race grouping system and method for organizing competitive events, such as a timed barrel race, by using prior performance data in prior similar events to determine the appropriate ability of each contestant and then forming ability groups such that the contestants are competing against other contestants having similar abilities. |
US09895613B1 |
Facilitating multigame currencies in multiple online games
A system and method for facilitating multigame currencies in multiple online games and security therewith is disclosed. The multigame currencies may be “spent” and/or “earned” by the players in the individual ones of the multiple online games. A request to use the multigame currencies in a given player account in a given online game may be authenticated through a third party identity that has been associated with the given player for the given online game. In situations where such an association does not exist, a third party identity associated with the given player for any other online game may be used to authenticate the request. In situations where no third party identity is associated with the given player for any one of the online games, an association of a third party identity and the given player for the given online game may be facilitated for subsequent authentication of requests. |
US09895612B2 |
Platform for associating characteristics of a digital asset with multiple media sources
A method for managing a stored digital asset on one or more computers independently of a plurality of media sources. The digital asset includes a plurality of characteristics including at least one alterable characteristic, and includes one or more of a virtual character, virtual property, or a game asset. The method includes sending at least a first portion of the digital asset data to one or more of the media sources including at least one characteristic, whereby performance of media by the one or more media sources is affected by the at least one characteristic, receiving data from the one or more media sources for altering the at least one alterable characteristic, and altering the at least one alterable characteristic in the stored digital asset based on the received data. |
US09895611B2 |
Interactive events platform
The system is directed towards an interactive events platform. The interactive events platform may discover current in-game events associated with different video games currently available (or active). The platform may further notify a user of the discovered in-game events associated with different video games and facilitate the user joining a particular in-game event. The interactive events platform may also discover and notify the user of future in-game events associated with different video games. In some embodiments, the discovery and notification of any in-game events are based on games currently being played (or registered) with the user. |
US09895610B1 |
Real-time and near-real-time fantasy gaming
Player predictions may be received from one or more player devices. The player predictions may relate to an epoch of a contemporaneously-occurring, real-time gaming event, and may be received within a first time period. After receiving the player predictions, one or more referee reports may be received from referee devices. The referee reports may include assessed outcomes of the epoch of the contemporaneously-occurring, real-time gaming event, and may be received within a second time period. Based on the player predictions and the referee reports, player accuracies of the player predictions and player rankings of the player devices may be determined. Representations of the player accuracies and the player rankings may be transmitted to the player devices. |
US09895605B2 |
Game pieces for use with touch screen devices and related methods
There is provided a system and method for communicating with a first peripheral device, of a plurality of peripheral devices, using a touch-sensitive system that has a processor and a touch surface. According to an exemplary embodiment, a method includes detecting, using the processor, a plurality of touches on the touch surface of the touch-sensitive system that are made by the first peripheral device. The method further includes identifying, using the processor, the first peripheral device based on the plurality of touches on the touch surface of the touch-sensitive system that are made by the first peripheral device. The method additionally includes communicating data, using the processor, to a receptive circuit of the first peripheral device in response to the identifying of the first peripheral device. |
US09895604B2 |
Location-based mobile gaming application and method for implementing the same using a scalable tiered geocast protocol
A method is disclosed for initiating real-time geo-game using geocast messaging according to a scalable tiered geocast protocol. The method includes a first wireless terminal (WT), programmed with a geo-gaming application and the scalable tiered geocast protocol, geocasting a game declaration to a destination geocast region containing potential participants. The method also includes a second WT, of one of the potential participants, and programmed with the geo-gaming application and the scalable tiered geocast protocol, receiving the game declaration in the destination geocast region and responding by geocasting a response message indicating interest in participating in the real-time geo-game. |
US09895603B2 |
System and method for designing and selling games
Systems and methods for designing and selling a user-generated game offered for sale via an online retail platform are provided. A user can input user-specified game information via a computing device over a network instructions for the development of the components of a game are automatically created based at least in part on the user-specified game information. Moreover, the systems and methods may further include transmitting the instructions for the development of the components of the game to an online retail platform, print on demand manufacturing the game, and thereafter offering the game for sale or rent via the online retail platform. |
US09895602B2 |
Modified roulette game
A modified roulette game comprising a roulette wheel apparatus having red, black, yellow and blue number pockets, a roulette wagering board and a plurality of wagering options. Each number pocket enabling a plurality of payout schemes. The numbers on the roulette board are arranged in four columns of nine, each column having even or odd numbers associated with the four colors. The wagering board providing a unique first wager group and second wager group allowing wagering on at least a single color, wagering on a single number where the number is associated with a single color, and active wager on the quadruple color scheme. The unique wagering options allowing for increased payout. |
US09895598B1 |
Enhanced personal mobility park system
An enhanced mobility park system provides a place where those with or attempting to develop skills with a self-stabilizing scooter can gather to develop, demonstrate or enjoy them. The park has a plurality of obstacles each configured to be challenging or entertaining to those will skill in riding self-stabilizing scooters. Obstacles could be a ramp, velocity altering patches, valleys/peaks or the like. |
US09895596B2 |
Releasable binding system
A mechanism for attaching, for example, a boot to a ski, that uses a sphere in cylinder geometry to enable release in a wide array of incremental directions and rotations. |
US09895593B2 |
Cycling suit with a seat pad and a method for making the same
A cycling suit (1) includes a seat pad (2) in the crotch area, and a plurality of fabric panels, which are associated along structural seams, and the seat pad is attached by means of a fabric panel (7) disposed to connect the rear part of said seat pad (2) to the suit (1), and said panel is fixed to the suit along lower back structural seams (8, 9) of the same. A corresponding method for manufacturing the cycling suit is also described. |
US09895590B2 |
Method and system to analyze sports motions using motion sensors of a mobile device
A method and system to analyze sports motions using the motion sensors of a mobile device, such as a smart phone, is provided. This method uses the mobile device motion sensor output to define the impact point with a virtual object, such as a golf ball, baseball or tennis ball. The motion sensor signature of the sports motion is analyzed for characteristics, specific to each type of sports motion. A method is disclosed using multiple sensors outputs in a mobile device to compute the impact point with a virtual object, such as a golf ball, baseball, tennis ball. Further, a method is disclosed where moving virtual sports objects interact with virtual sports motions and the responsive outputs are displayed on the mobile device and/or any Web-enabled display device. |
US09895589B2 |
Light-weight portable bicycle rollers
A bicycle rollers device (110), having a frame (112, 114, 116) that includes a rear mounting assembly (112) for two rear rollers; a front mounting assembly for a front roller (114); support elements (140, 141, 142, 144, 145) for supporting the frame above a surface, upon which the support elements are set to rest; and a central bridge (116) connecting the front mounting assembly to the rear mounting gear. Also, two rear rollers are mounted in the rear mounting assembly and a front roller is mounted in the front mounting assembly and defines a roller width. Finally, the central bridge is more narrow than the roller width, thereby permitting a bicycle rider to mount and dismount a bicycle set on the rollers without encountering the central bridge. |
US09895587B2 |
Composite golf ball-hitting mechanism
A composite golf ball-hitting mechanism includes a base, a plurality of golf tees, and a cover layer. A first track is disposed on the base to not only hold the golf tees of different sizes but also guide selected ones of the golf tees to a hitting position. Golf balls are positioned at the golf tees and hit, respectively. |
US09895582B2 |
Golf club heads and methods to manufacture golf club heads
Embodiments of golf club heads and methods to manufacture golf club heads are generally described herein. In one example, a method may include providing a body portion and a plurality of weight portions. The plurality of weight portions may include a first set of weight portions and a second set of weight portions. Each weight portion of the first set of weight portions may be associated with a first mass, and each weight portion of the second set of weight portions may be associated with a second mass that is less than the first mass. Other examples and embodiments may be described and claimed. |
US09895578B2 |
Biometric assessment in fitness improvement
In some embodiments, an automated system comprises one or more biometric sensors, an interactive screen, and an exercise routine generation application communicable with a mobile application. In some embodiments, the mobile application receives data from an automated station and displays exercise routines, other exercise information, or both. In some embodiments, the mobile application includes a scanner to scan labels, other indicia, or physical or other features of an exercise machine or other exercise apparatus to identify the machine or apparatus. In some embodiments, the mobile application communicates with one or more local or remote databases identifying differing exercise facility locations within a geographic area and identifying exercise apparatus available in each of the differing facilities. |
US09895570B2 |
Exercise device
In general, an exercise device includes a handle having a first end and a second end. A curved member is coupled to the first end of the handle. A movable member is coupled to the curved member, with the movable member configured to travel along a length of the curved member, where the movable member has a first portion and a second portion, and the second portion is configured to move relative to the first portion. An elongate member has a first end and a second end, and the first end of the elongate member is coupled to the second portion of the movable member. A weight is coupled to the second end of the elongate member. |
US09895568B2 |
Belt-based system for strengthening muscles
Systems and methods are presented for performing exercises to strengthen, e.g., the transversus abdominis and related muscles. The systems and methods may involve one or more independent belts, allowing a full range of continuous motion. The systems and methods may further use a resistance-control mechanism that allows a user to adjust the force required to move the one or more belts, thereby controlling the rate of motion in the forward and/or backward directions. The systems and methods may further use a unidirectional resistance mechanism that allows the user to increase the resistance of the one or more belts in one direction, while allowing the one or more belts to move freely in the other direction. |
US09895562B2 |
High-visibility locking levers for fire hose couplings
A fire hose coupling, such as a quarter-turn Storz-style coupling, comprises a substantially annular body having a first end connected to a fire hose and a second end having internal engagement lugs for connecting to lugs on another coupling. The coupling includes at least one locking lever movable between an unlocked position and a locked position, the lever locking the annular body of the coupling to the other coupling. The one or more locking levers comprise a light-reflecting surface to improve visibility of the lever. This facilitates assembly and disassembly of the couplings in conditions of poor visibility. |
US09895560B2 |
Methods for rejuvenating skin by heating tissue for cosmetic treatment of the face and body
Methods for treating skin and subcutaneous tissue with energy such as ultrasound energy are disclosed. In various embodiments, ultrasound energy is applied at a region of interest to affect tissue by cutting, ablating, micro-ablating, coagulating, or otherwise affecting the subcutaneous tissue to conduct numerous procedures that are traditionally done invasively in a non-invasive manner. Methods of lifting sagging tissue on a face and/or neck are described. Treatment with heat is provided in several embodiments. |
US09895558B2 |
Voxel type block phantom for a multifunctional radiation measurement apparatus
The present invention relates to a voxel-type block phantom for a multifunctional radiation measurement apparatus. A phantom, for adjusting an amount of radiation, has solid pixel blocks, having a radiation measuring device equipped therein and different media and densities from one another, assembled on top of one another so as to be assembled into a 3-dimensional voxel, wherein the phantom is formed by placing a solid block which is appropriate for a density that corresponds to each pixel of the 3-dimensional voxel. An inspector can personally and instantly customize a phantom that is appropriate for a subject to be measured and thus can obtain an accurate measurement value. |
US09895557B2 |
Method and system for calorimetry probe
Radiotherapy is one of the most effective treatments for cancer and its success depends critically on accurate targeting and delivery of the correct radiation dose. Accurate dosimetry is therefore essential to maintain and improve patient survival rates. However, size and long wait times currently limit water and graphite based calorimeters to standards laboratories leaving field-based dosimetry to ionization chamber measurements which depend upon a reference field-specified calibration factor. It would therefore be beneficial to provide radiotherapy equipment operators a direct approach of clinical reference dosimetry wherein the dosimeter provides increased independence on dose, dose rate, radiation energy, and energy type, etc. It would be further beneficial for such novel clinical dosimeters to be compact, function as secondary standards used routinely for measurements and allow radiotherapy doses to be measured directly and in an absolute manner. According to embodiments of the invention novel compact graphite probe calorimeters are provided. |
US09895555B2 |
Imaging methods for image-guided radiation treatment
An IGRT system and methods are described embodiments of which perform selectively integration of x-ray source arrays, dual-energy imaging, stereoscopic imaging, static and source collimation, or inverse geometry tomosynthesis imaging to acquire or track a target during radiation treatment. |
US09895551B2 |
Brachytherapy applicator device and method of use thereof
An applicator device is provided including a connecting unit. The connecting unit includes a first connector coupled to a first colpostat and a second connector coupled to a second colpostat. The first connector includes a first contact portion and a body portion, the first contact portion being immovably fixed to the body portion. The second connector includes a second contact portion and a third contact portion, the second contact portion being configured to contact and pivotally engage the first contact portion. The first connector further includes a fourth contact portion configured to contact the third contact portion. The second contact portion and the third contact portion are disposed between the first contact portion and the fourth contact portion, and the first contact portion are disposed in closer proximity to a point of delivery of a radiation source than the second, third, or fourth contact portions. |
US09895549B2 |
On-demand drug release using magneto-electric nanoparticles
Disclosed herein are methods of delivering drugs to a subject in a controlled release fashion by administering a magneto-electric nanoparticle having ionic bonds to a drug then applying a magnetic field to weaken the ionic bonds and release the drug. |
US09895547B2 |
Biocompatible and implantable optical conduits
The present disclosure provides advantageous optical conduit assemblies (e.g., biocompatible and implantable optical conduit assemblies), and related methods of use. More particularly, the present disclosure provides advantageous optical conduit assemblies (e.g., polydimethylsiloxane (“PDMS”)-based optical conduit assemblies) configured to power implantable devices (e.g., neural micro-stimulators or deep brain stimulators or the like) or to be used in optogenetic stimulation. In general, the exemplary optical conduit assemblies can be used for applications where energy needs to be transmitted to deep locations inside the body or brain without using electrical wires. Therefore, implantable devices that need to be powered (e.g., neural prosthetics) can be powered from an external light source using an optical conduit and an optical-to-electrical converter (e.g., a photodiode) attached to the end of the optical conduit on the inside. |
US09895544B2 |
Method for calculating an estimate of a time-varying physiological variable
A medical device performs a method for computing an estimate of a physiological variable. The method includes sensing a physiological signal and measuring an event of the physiological signal. The device initializes a value of a long-term metric of the event measurement, wherein the long-term metric corresponds to a time interval correlated to a response time of the physiological variable to changes in the event. The estimate of the long-term metric is updated in a memory of the medical device using a previous long-term metric and a current measurement of the event. The device detects a need for computing the physiological variable and computes an estimate of the physiological variable using the updated long-term metric. |
US09895540B2 |
Devices and methods for low current neural modulation
A device may include an implantable circuit and at least one pair of implantable electrodes, in electrical communication with the implantable circuit. The circuit and the electrodes may configured for implantation in a subject in the vicinity of a nerve. The circuit may be configured to deliver to the electrodes an electrical signal having a current less than about 1.6 milliamps, and the electrodes may be configured to emit an electric field such that a portion of the field lines extend along a length of the nerve such that the delivery of the electrical signal of less than about 1.6 milliamps causes modulation of the nerve. |
US09895535B2 |
Hearing assistance system with improved signal processing comprising an implanted part
The application relates to a hearing assistance system (a method and its use) for processing an input signal representative of sound according to a user's needs, the hearing assistance system comprising an implanted part adapted for being at least partially implanted in a user's head and comprising a sensing unit capable of measuring an endocochlear potential at one or more positions along the length of the cochlear partition. The hearing assistance system further comprises a decoder configured to receive said endocochlear potentials or signals derived therefrom and to transform the received signals into signals appropriately conditioned for use as control inputs to the signal processing unit, and wherein the signal processing unit is configured to process the electric input signal in dependence of said control inputs from said decoder. Thereby the processing of the audio signal of a hearing assistance device can be automatically adapted over time. |
US09895534B2 |
MLCC filter on an AIMD circuit board with conductive ground pin attached to a hermetic feedthrough ferrule
An EMI/energy dissipating filter for an active implantable medical device (AIMD) is described. The filter comprises a first gold braze hermetically sealing the insulator to a ferrule that is configured to be mounted in an opening in a housing for the AIMD. A lead wire is hermetically sealed in a passageway through the insulator by a second gold braze. A circuit board substrate is disposed adjacent the insulator. A two-terminal chip capacitor disposed adjacent to the circuit board has an active end metallization that is electrically connected to the active electrode plates and a ground end metallization that is electrically connected to the at least one ground electrode plates of the capacitor. A ground path electrically extends between the ground end metallization of the chip capacitor and the ferrule. The ground path comprises a conductive pin electrically and mechanically connected to the ferrule by a third gold braze. The ground path comprises an internal ground plate disposed within the circuit board substrate, and the internal ground plate is electrically connected to both the conductive pin and the ground end metallization of the chip capacitor. An active path electrically extends between the active end metallization of the chip capacitor and the lead wire. |
US09895533B2 |
Impedance monitoring during electrostimulation
Embodiments described herein include a controller (22). The controller includes at least one interface (62) that couples the controller to stimulation circuitry (24), which includes a pair of electrodes (26a, 26b), and to measuring circuitry, and further includes controller circuitry (64). While the electrodes are coupled to skin (60) of a subject, the controller circuitry, via the interface, drives the stimulation circuitry to (i) pass a plurality of stimulating pulses (32) between the electrodes, and (ii) pass one or more reference pulses (34) between the electrodes, the reference pulses being different from each of the stimulating pulses. The controller receives, from the measuring circuitry, an impedance between the electrodes that is measured using the reference pulses. In response to the impedance measured using the reference pulses, but not in response to any impedance measured using the stimulating pulses, the controller circuitry controls the stimulation procedure. Other embodiments are also described. |
US09895531B2 |
Protective patch for protecting the implant site of a trial neurostimulation lead
A protective patch or bandage is provided for use with an implantable trial neurostimulation lead for implant within a patient. In one example, the lead is routed through the patch to a trial neurostimulation generator. In another example, the patch includes an internal electrical connector for connecting the trial neurostimulation lead to a connection line from the trial neurostimulation generator. In either case, the patch is sealed over an implant site to protect and hygienically isolate the site. A central chamber of the patch is provided to hold medical gauze and to further hold a coiled portion of the neurostimulation lead. In some examples, the patient can shower while wearing the protective patch. |
US09895529B2 |
Device with flexible multilayer system for contacting or electrostimulation of living tissue cells or nerves
The object,—to create a printed circuit board for an implant having improved properties in connection with the electrical contacting via the contact points of the conductor tracks on the printed circuit board,—is achieved, according to the present invention, by means of a device for contacting and/or electrostimulation of living tissue cells or nerves with having a printed circuit board having with at least one contact point for electrical contacting, the printed circuit board encompassing comprising a flexible multilayer system with at least one conductor track. In accordance with the invention, the contact points for the conductor track in the multilayer system are galvanically reinforced. To this end, a galvanically reinforced layer is grown onto the already preprocessed contact point, for example by means of a galvanic process. By virtue of the application of one or more additional material layers onto the contact points of the conductor tracks, these latter are mechanically more stably anchored in the printed circuit board in mechanically more stable manner and hence become more reliable in their function. |
US09895524B2 |
Fluid bypass device for valved catheters
Bypass elements for medical valves and methods of using the same are disclosed. Embodiments of the invention include an insert having a tip that is adapted to displace a valve element without penetrating it, and a lumen that fluidly communicates with a lumen of a valve housing distal to the valve element when the bypass element is engaged. Bypass elements are used, in certain embodiments, to facilitate fluid pressure and ECG signal measurements through implanted medical devices including catheters. |
US09895522B2 |
Cell culture transferring instrument
A cell culture transferring instrument includes a cylindrical body held by an operator not shown in the drawing, a plunger inserted through the interior of the cylindrical body, a plurality of support members connected to a distal end of the plunger, and an adsorbent capable of adsorbing a sheet-shaped cell culture held by the support members. The support members in contact with the distal end of the cylindrical body are elastically deformed by displacing the plunger toward the proximal end side with respect to the cylindrical body in a state in which the sheet-shaped cell culture is adsorbed to the adsorbent, whereby the adsorbent and the sheet-shaped cell culture are deformed and housed in a housing hole in the cylindrical body. |
US09895521B2 |
Transdermal therapeutic system with pressure generating device
A transdermal therapeutic system with a system support, at least one advancing element which is embedded into the system support, and at least one active ingredient reservoir which can be elastically deformed at least in some regions and which is embedded into the advancing element. On the application side of the transdermal therapeutic system, the system support surrounds the advancing element, and the advancing element surrounds the active ingredient reservoir. The advancing element comprises a swelling body which can be expanded by means of a liquid intake. The system support is designed to be rigid at least in some regions. A transdermal therapeutic system is developed which enhances the effect of the advancing element. |
US09895519B2 |
Treatment of cavities in a human body
Apparatus and methods are described, including apparatus for treating a cavity in a human body, the apparatus including a delivery tube. A bather device has a collapsed configuration and an expanded configuration, the barrier device moving from the collapsed configuration to the expanded configuration upon being deployed from the delivery tube. A pushing element, slidably disposed within a lumen of the delivery tube, is configured to deploy the barrier device from the delivery tube by pushing the bather device. One or more bather-deployment elements are coupled to the barrier device and to the pushing element, the bather-deployment elements being configured to conformingly contact the barrier device with tissue surrounding the cavity. Other applications are also described. |
US09895517B2 |
Inflatable medical devices
An inflatable structure for use in biological lumens and methods of making and using the same are disclosed. The structure can have an inflatable balloon encircled by a shell. The shell can have proximal and distal tapered necks, longitudinally-oriented flutes, and apertures at the proximal and distal ends of the shell. The apertures can be recessed in the flutes in the necks. The shell can also have fiber reinforced walls. |
US09895514B2 |
Medical device securement system and method
A medical device securement system is configured to secure medical devices such as catheters in place. The securement system includes an anchor pad that attaches to a patient's skin. A malleable support base is attached to an upper surface of the anchor pad. The support base has front and back inclined surfaces that are separated by an offset surface that extends generally normal to both of the inclined surfaces. A spot of adhesive is applied to one or more of the inclined surfaces. A catheter assembly includes a connector having a first connector portion with a diameter larger than an adjacent second structure. The catheter assembly is attached to the support base with the first connector portion engaged with and supported by the back inclined surface, and the second connector portion engaged with and supported by the front inclined surface. |
US09895505B2 |
Nasal assembly
A vent assembly includes at least one vent having a first end configured to face atmosphere and a second end opposite the first end, and a central portion provided between the first and second ends including a substantially cylindrical cross-sectional shape, wherein the second end includes a counter bore. |
US09895503B2 |
Mask system
A mask system for treating sleep disordered breathing, comprising headgear, a shell/cushion including a channel adjacent a front aperture, a frame, an elbow including at least one undercut on a proximal end, a retaining ring including a rear flange adapted to be retainably insertable in the channel of the shell/cushion, and a front flange adapted to retainably engage with the at least one undercut of the elbow. |
US09895500B2 |
Portable ultrasonic nebulizer and medicine accommodating structure thereof
A medicine accommodating structure includes a medicine accommodating unit and a movable unit. The medicine accommodating unit is disposed in a receiving space, and the medicine accommodating unit includes a medicine accommodating space and a first opening communicated between the receiving space and the medicine accommodating space. The movable unit is movably disposed between the receiving space and the medicine accommodating space through the first opening. At least one pharmaceutical capsule having a medicinal liquid received therein is placed inside the medicine accommodating space. Whereby, when the movable unit is moved from the receiving space into the medicine accommodating space, the movable unit can pierce into the at least one pharmaceutical capsule, such that the medicinal liquid can flow from the at least one pharmaceutical capsule into the receiving space. |
US09895499B2 |
Adhesive and peripheral systems and methods for medical devices
A repeater system may control a pump by using a repeater and a user interface. An adhesive patch system may be used for affixing a pump or other object to a human body. Such an adhesive patch system may include two sets of adhesive members, each member including an adhesive material on at least one side so as to attach to the body. The members of the first set are spaced to allow the members of the second set to attach to the body in spaces provided between the members of the first set, and the members of the second set are spaced to allow members of the first set to detach from the body without detaching the members of the second set. Also, fill stations and base stations are provided for personal pump systems. |
US09895497B2 |
Method for reducing leachables and extractables in syringes
The present invention relates to a method of producing syringes. Said method comprises fixing a needle to a syringe body by use of an adhesive followed by subjecting the syringes thus obtained to heat treatment. The invention further relates to a method of reducing leachables and/or extractables in prefilled syringes, said method comprising heat treating pre-fabricated syringes at a temperature of at least 40° C. before filling. |
US09895492B2 |
Autoinjector
An autoinjector having a lower body (10; 1010) receiving a reservoir, a piston, a needle, an actuating sleeve (11; 1011) with a contact end to contact the user. The actuating sleeve is displaceable between projected positions and an actuation position, being in a first projected position prior to actuation of the autoinjector. The autoinjector also having an injection device (5, 8; 1005, 1008) and an injection lock. The actuating sleeve is automatically returns to the second projected position when the user removes the autoinjector from his body and is locked in this second projected position. The autoinjector includes an external shell (22; 1022) having a display window for indicating the actuation sequences, at least one display window (221; 1221; 1023) indicating to the user that the injection of the fluid product is finished. |
US09895491B2 |
Field update of an ambulatory infusion pump system
Portable or ambulatory infusion devices and systems capable of remotely updating an ambulatory fluid delivery device include safety protocols that verify the status of the ambulatory fluid delivery device before and after a field update of software. Methods of accomplishing the same field update of software are also described. |
US09895488B2 |
Conductive coding of syringe information
A system for identifying information regarding a syringe assembly used with a fluid injector includes at least one syringe assembly having a barrel extending from a distal end to an open proximal end, at least one indicator provided on at least a portion of an outer circumferential surface of the barrel, an injector having at least one syringe port adapted to receive the at least one syringe assembly, and at least one sensor provided on or within at least a portion of each syringe port. The at least one indicator may conduct electricity corresponding to information regarding the at least one syringe assembly, which is identified by the at least one sensor. |
US09895487B2 |
Compact non-electric medicament infuser
An assembly is provided which includes an infusion device coupled to a standard medication syringe. The medication syringe may be coupled to a stopcock valve having multiple ports and to which syringes, vial adapters, infusion tubing, and multiple other items may be coupled. The infusion device includes a source of power based on a resistance force such as vacuum, spring or gas power. The infusion device converts the resistance based force to usable work in the form of a force applicator. The force applicator includes a driver section on one section of a reciprocating arm and an attachment to the power source on another section of the arm. The driver is pulled outward (excursion) to increase the size of the chamber, creating a force that tends to return the driver back inward, causing incursion. The driver can be attached removably to the syringe plunger to induce the infusion process. |
US09895483B2 |
Systems and methods for cleaning body cavities
Systems and methods for cleaning body cavities are presented. Some embodiments reduce size of fecal matter pieces within an evacuation conduit. Some comprise devices and methods for purging an evacuation conduit. Some comprise reduced cross-sectional profiles of a cleaning device. Some protect intestinal tissue by preventing exposure to excessively high and low pressures. |
US09895482B2 |
Membrane separation devices, systems and methods employing same, and data management systems and methods
A membrane separation device is disclosed along with systems and methods employing the device in blood processing procedures. In one embodiment, a spinning membrane separator is provided in which at least two zones or regions are created in the gap between the membrane and the shell, such that mixing of the fluid between the two regions is inhibited by a radial rib associated with the membrane that decreases the gap between the membrane and the shell to define two fluid regions, the ridge isolating the fluid in the two regions to minimize mixing between the two. Automated systems and methods are disclosed for separating a unit of previously collected whole blood into components, such as concentrated red cells and plasma, for collecting red cells and plasma directly from a donor in a single pass, and for cell washing. Data management systems and methods and priming methods are also disclosed. |
US09895481B2 |
Device and method for blood treatment with single needle operation
A device and a method are provided for blood treatment in a single-needle operating mode. The blood treatment device has an extracorporeal blood circuit comprising a blood supply line leading to the inlet of a blood treatment unit and a blood return line leading away from the outlet of the blood treatment unit. A blood collecting container is provided in the blood return line, and is connected to an air reservoir by a flow line. The flow connection comprises two line branches, one branch being used to transfer gas from the air reservoir into the blood collecting container and the other branch being used to transfer gas from the blood collecting container into the air reservoir. The connection branch for transferring gas from the air store into the blood collecting container can contain a compressor. |
US09895476B2 |
Intravascular ventricular assist device
One aspect of an intravascular ventricular assist device is an implantable blood pump where the pump includes a housing defining a bore having an axis, one or more rotors disposed within the bore, each rotor including a plurality of magnetic poles, and one or more stators surrounding the bore for providing a magnetic field within the bore to induce rotation of each of the one or more rotors. Another aspect of the invention includes methods of providing cardiac assistance to a mammalian subject as, for example, a human. Further aspects of the invention include rotor bodies having helical channels formed longitudinally along the length of the body of the rotor where each helical channel is formed between peripheral support surface areas facing radially outwardly and extending generally in circumferential directions around the rotational axis of the rotor. |
US09895474B2 |
Breast pump system
The present application relates to a breast pump system. The breast pump system comprises a vacuum path for creating a pressure reduction on a breast. A pump unit generates and releases a pressure reduction in the vacuum path, and comprises a vacuum pump (20). A leakage aperture (60) is configured to allow a controlled release of a pressure reduction in at least part of the vacuum path so that the pressure reduction in at least part of the vacuum path is released in the event that the pump unit fails to release the pressure reduction in the vacuum path. The vacuum pump (20) has a discharge port (22) for discharging air drawn from the vacuum path, and the leakage aperture (60) is disposed proximate to the discharge port (22) so that airflow discharged from the discharge port (22) is directed over the leakage aperture (60). |
US09895471B2 |
Devices and methods for treatment of damaged tissue
Methods and devices for treatment of damaged tissue are disclosed, including treatment of wounds by employing non-electrically powered, reduced pressure therapy devices. Maintenance and control of the sub atmospheric pressure exerted may be provided by such devices while minimizing discomfort to the user. The devices may be configured to be worn inconspicuously underneath clothing. |
US09895470B2 |
Non-fouling, anti-microbial, anti-thrombogenic graft—from compositions
Substrates, optionally coated with an undercoating layer, having grafted there from one or more non-fouling materials are described herein. The non-fouling, polymeric material can be grafted from a variety of substrate materials, particularly polymeric substrates and/or polymeric undercoating layers. The graft-from techniques described herein can result in higher surface densities of the non-fouling material relative to graft-to formulations. Graft-from methods can be used to produce covalently tethered polymers. The compositions described herein are highly resistant protein absorption, particularly in complex media and retain a high degree of non-fouling activity over long periods of time. The compositions described herein may also demonstrate antimicrobial and/or anti-thrombogenic activity. The non-fouling material can be grafted from the substrate, or optionally from an undercoating layer on the substrate, preferably without significantly affecting the mechanical and/or physical properties of the substrate material. |
US09895468B2 |
Immobilization of an active agent on a substrate
The invention provides methods of immobilizing an active agent to a substrate surface, including the steps of, depositing a primer compound on a substrate, thereby forming a primed substrate, contacting the primed substrate with a solution of a compound including a trihydroxyphenyl group, thereby forming a trihydroxyphenyl-treated primed substrate, and contacting the trihydroxyphenyl-treated primed substrate with a solution of an active agent, thereby immobilizing the active agent on the substrate. Further provided are methods of immobilizing an active agent on a substrate, including the steps of providing a substrate, combining a solution of a compound including a trihydroxyphenyl group with a solution of an active agent, thereby forming a solution of an active agent-trihydroxyphenyl conjugate, and contacting the primed substrate with the solution of the active agent-trihydroxyphenyl conjugate, thereby immobilizing the active agent on the substrate. The invention further provides substrates and medical device or device components with active agents immobilized on the surface thereof. |
US09895466B2 |
Liposomal drug delivery system for bone cements
The invention relates to a novel antibiotic delivery vehicle for impregnating bone cement wherein said vehicle is an antibiotic encapsulated liposome having a block co-polymer on its surface; a method for the manufacture of a bone cement impregnated with antibiotic or a mixture of antibiotics using said vehicle; and also a novel bone cement made therewith and/or thereby. |
US09895464B2 |
Axial, triple-separation, diffusion apparatus and method
A reservoir containing an essential oil feeds to an eductor injecting a jet forming a plume of air entraining oil droplets. A series of drift chambers act as velocity reducers to alternately slow the flow droplets with entry, and then reaccelerate them upon exit through an exit channel. A micro cyclone separator operates between at least two of the drift chambers, exposing the flow to circumferential direction and centripetal acceleration driving comparatively larger droplets out of the flow away from comparatively finer droplets sufficiently small to remain with the flow of air. Separation of comparatively larger droplets, effectively eliminates “spitting” of liquids that might or rapid drift onto surrounding surfaces. |
US09895462B2 |
Method and apparatus for high efficiency air purification
The present invention discloses an air purification apparatus. The air purification apparatus comprising: a casing which contains at least one apparatus air inlet and at least one apparatus air outlet; at least one main filter which is being installed at the apparatus air inlet and/or within the casing; at the periphery of the main filter, there locates a primary air flow inlet and a secondary air flow inlet. When a primary air flow is drawn to flow from the upstream to the downstream positions inside the casing, the primary air flow is adapted to pass by at least one edge of the exterior of the main filter, resulting at least two exterior surfaces of the main filter being exerted with different atmospheric pressures. Through the secondary air flow inlet, a secondary air flow is entrained through the main filter and flows from its exterior surface is exerted with higher atmospheric pressure to its exterior surface is exerted with lower atmospheric pressure. The invention offers an air purification apparatus which owns the characteristics of simple structure, able to extend the life-span of the filter cost effectively, low energy consumption and induced low noise level. |
US09895461B2 |
Devices, systems and methods for treating medical devices having passageways with ozone gas
The present disclosure is generally related to devices, methods and systems for cleaning, disinfecting and/or sterilizing a medical device, medical hoses and tubes and accessories thereof with ozone gas, in particular the disclosure relates to devices, methods and systems with multiple receptacles for providing closed-loop fluid pathways to distribute ozone gas to inner passageways and the outer compartments of medical devices. The devices in accordance with an embodiment of the disclosure have two or more receptacles for distributing ozone gas, a gas-tight compartment, an ozone operating system, and one or more connector units configured to fluidly migrate ozone in closed-loop treatment systems. |
US09895456B2 |
Sterilisation container
A container for sterilizing a medical object and storing a sterilized medical object, the container including: a container body including a first opening in a first end of the container for passage of the medical object into the internal cavity, the internal cavity including a removably insertable platform having a receiving surface to receive and support the medical object, the platform keyed to be retained in a fixed position between the first end of the container body and a second end of the container body; a first seal for closing the first opening; and a vapor permeable sterility barrier for maintaining sterility of the internal cavity and allowing the passage of vapor. |
US09895450B2 |
Anti-wall teichoic antibodies and conjugates
The invention provides anti-wall teichoic acid antibodies and antibiotic conjugates thereof, and methods of using the same. |
US09895447B2 |
Drug-containing PLA implants and methods of use thereof
The present invention provides implants comprising a therapeutic drug and a polymer containing polylactic acid (PLA) and optionally polyglycolic acid (PGA). The present invention also provides methods of maintaining a therapeutic level of a drug in a subject, releasing a therapeutic drug at a substantially linear rate, and treating schizophrenia and other diseases and disorders, utilizing implants of the present invention. |
US09895446B2 |
Poloxamer-based intralesional injections for the delivery of chemotherapeutic agents
Intralesional injections including poloxamer compounds and anticancer drugs are disclosed. The combination of the poloxamer-based composition with chemotherapeutic agents within the disclosed intralesional injections provides a synergistic effect, thereby allowing lower dosages of the active drugs and enhancing the treatment effectiveness. The disclosed poloxamer-based intralesional injections are employed for treating different types of cancer in humans and other animal species. The disclosed intralesional injections can be used as the sole therapy or in combination with one or more additional therapies, such as, chemotherapy, electrotherapy, immunotherapy and/or radiation therapy. The disclosed intralesional injections can be employed in virotherapy and gene therapy treatments. The disclosed intralesional injections are designed for immediate release or controlled release of the active drugs. The disclosed intralesional injections are employed for local or systemic administration of active drugs. |
US09895441B2 |
Methods of treating cancer using PD-L1 axis binding antagonists and VEGF antagonists
The present invention describes combination treatment comprising a PD-1 axis binding antagonist, chemotherapy and optionally a VEGF antagonist and methods for use thereof, including methods of treating conditions where enhanced immunogenicity is desired such as increasing tumor immunogenicity for the treatment of cancer. |
US09895440B2 |
Modulation of the immune response
Methods for increasing the numbers of regulatory T cells (Treg), e.g., in a population of T cells or in a patient. |
US09895438B2 |
Treatment of cancer with naltrexone
The present invention provides novel therapeutic applications of low dose naltrexone (LDN). Said applications have been determined in light of the discovery by the present inventors that naltrexone acts as an antagonist of Toll-like receptor 9 (TLR9), an innate immune receptor which elicits the production of inflammatory cytokines when agonized. Chronic inflammation and TLR9 overexpression are characteristics of a number of disorders, including certain cancers. Accordingly, the present invention provides novel uses of naltrexone in the treatment of a subject having a disorder characterized by TLR9 overexpression and/or overactivity of TLR9-mediated signalling. The present invention also provides novel uses of naltrexone in the supportive care of subject having a tumor/cancer, and methods of treating and providing supportive care to a subject, comprising the administration of naltrexone. |
US09895437B2 |
Aluminum compounds for use in therapeutics and vaccines
The invention relates to means and methods for preparing aqueous composition comprising aluminum and a protein said composition comprising less than 700 ppm heavy metal on the basis of weight with respect to the aluminum content. The invention further relates to aqueous compositions comprising a protein and an aluminum-salt, said composition comprising less than 350 ppb heavy metal based on the weight of the aqueous composition. |
US09895433B2 |
Interferon-β production modulating listeria strains and methods for using same
Mutant Listeria bacteria that modulate interferon-β production are provided. The subject bacteria are characterized by having a mutation in a gene chosen from a TetR gene, a LadR gene, a VirR gene, a MarR gene a MdrL gene, a MdrT gene and a MdrM gene. The subject bacteria find use in a variety of applications, where representative applications of interest include, but are not limited to: (a) use of the subject bacteria as adjuvants; (b) use of the subject bacteria as delivery vectors for introducing macromolecules into a cell; (c) use of the subject bacteria as vaccines for eliciting or boosting a cellular immune response; etc. |
US09895430B2 |
Cryopreservation of apoptotic cancer cells for use in immunotherapy against cancer
Described herein is a reliable method for preparing a potent vaccine useful for immunotherapy comprising the step of cryopreserving a population of cells undergoing immunogenic cell death, and using such cells to activate dendritic cells for use in immunotherapy. In a specific embodiment, the method comprises cryopreserving cancer cells undergoing cell death, which can be used to prepare a pharmaceutical composition for immunotherapy against cancer. |
US09895428B2 |
Methods of treating antibody-mediated rejection in organ transplant patients with C1-esterase inhibitor
A method and composition for treating or preventing antibody-mediated rejection (AMR) of a transplanted organ are provided. |
US09895426B2 |
Systemic gene replacement therapy for treatment of X-linked myotubular myopathy (XLMTM)
The present invention provides compositions and methods for treating a myopathy. In certain embodiments, the invention provides compositions and methods for treating, improving muscle function, and prolonging survival in a subject with X-linked myotubular myopathy (XLMTM). The present invention provides a method comprising systemic administration of a composition that induces the increased expression of myotubularin in the muscle of a subject. The invention provides sustained regional and global increases in muscle function. |
US09895415B2 |
Immunotherapy against several tumors including gastrointestinal and gastric cancer
A method of treating a patient who has gastric cancer includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has gastric cancer. A method of treating a patient who has gastric cancer includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the gastric cancer. |
US09895412B2 |
Cyclic depsipeptide compounds and their uses
The present invention relates to novel cycloundecadepsipeptide compounds and their analogues which bind and inhibit cyclophilins, have reduced immunosuppressive activity and improved physicochemical properties including water solubility. The present invention further relates to pharmaceutical compositions containing said depsipeptide compounds and their analogues for use in the treatment or prevention of diseases and pathologies which may be ameliorated by the inhibition of cyclophilin activity. |
US09895411B2 |
Analogs of C5a and methods of using same
Materials and methods for treating and preventing an infection or disease, and for directly killing microorganisms, using carboxy-terminal C5a analogs, are provided. |
US09895410B2 |
Methods for preventing and treating oral cancers
Methods for preventing or treating oral cancers, and/or reducing the severity of symptoms of oral cancers are described. The methods comprise administering an effective amount of an aromatic-cationic peptide to a subject in need thereof to normalize expression levels of genes involved in oral carcinogenesis. |
US09895407B2 |
Disinfecting formulations and uses thereof
The present invention provides a disinfecting formulation useful, for example, for cleaning and disinfecting human or animal body parts, and in particular for disinfecting human hands. The disinfecting formulation comprises alcohol including ethanol; an essential oil comprising cineole, in particular eucalyptus oil; an emollient including glycerin; and other ingredients comprising piroctone olamine, acrylic acid based polymer and 2-amino-2-methyl-1-propanol. The invention also provides methods of disinfection of human and animal body parts and methods for preparing the formulation. |
US09895406B2 |
Homeopathic remedies and methods for enhancing weight loss
Homeopathic compositions and formulations are disclosed. In one embodiment, compositions and formulations are disclosed that aid in weight loss and maintenance of a healthy weight. In another embodiment, methods are disclosed for producing homeopathic compositions and formulations. In still another embodiment, methods are disclosed for helping an individual lose weight. |
US09895400B2 |
Composition and use of Lactobacillus reuteri GMNL-263 in decreasing blood lipid levels
A use of a Lactobacillus reuteri GMNL-263 in decreasing blood lipid levels is disclosed. Lactobacillus reuteri GMNL-263 (accession No.: CCTCC M 209263) specifically inhibits gene expression related to pro-inflammatory factor and lipid synthesis and promotes gene expression related to cholesterol metabolism. Lactobacillus reuteri GMNL-263 is utilized to produce a composition for decreasing blood lipid levels, thereby achieving the aim of hyperlipidemia treatment. |
US09895399B2 |
Repair of peripheral nerve injury
The invention relates to methods and compositions for maintaining the pro-regenerative capacity of distal nerve segments following nerve injury. |
US09895396B2 |
Citrate containing beverage
Provided are beverage compositions comprising a urine citrate increasing component and a urine oxalate reducing component. The beverage compositions may be provided in a ready-to-drink form or may be provided in a concentrate form. Also provided are kits comprising the beverage compositions and methods for treating various conditions using the beverage compositions. |
US09895392B2 |
Saccharide fraction from wheat, isolation process and field of use of the invention
Fractions extracted from wheat seeds germinated and macerated in water having a molecular weight comprised between 3 and 30 K Daltons are described. |
US09895391B2 |
Compositions comprising decitabine and tetrahydrouridine and uses thereof
Embodiments of compositions and methods for the treatment of blood disorders and malignancies in a subject are described herein. In one embodiment, a composition for the treatment of a blood disorder or a malignancy in a subject comprises decitabine, tetrahydrouridine, and an excipient. In another embodiment, a method for the treatment of a blood disorder or a malignancy in a subject comprises the oral administration of a composition comprising decitabine and tetrahydrouridine. In some examples, the composition may be administered 1-3 times weekly. |
US09895389B2 |
Glycoside derivatives and uses thereof
This invention relates to compounds represented by formula (I): wherein the variables are defined as herein above, which are useful for treating diseases and conditions mediated by the sodium D-glucose co-transporter (SGLT), e.g. diabetes. The invention also provides methods of treating such diseases and conditions, and compositions etc. for their treatment. |
US09895385B2 |
Methods for treating pulmonary non-tuberculous mycobacterial infections
Provided herein are methods for treating a pulmonary infection in a patient in need thereof, for example, a nontuberculous mycobacterial pulmonary infection for at least one treatment cycle. The method comprises administering to the lungs of the patient a pharmaceutical composition comprising a liposomal complexed aminoglycoside comprising a lipid component comprising electrically neutral lipids and an aminoglycoside. Administration comprises aerosolizing the pharmaceutical composition to provide an aerosolized pharmaceutical composition comprising a mixture of free aminoglycoside and liposomal complexed aminoglycoside, and administering the aerosolized pharmaceutical composition via a nebulizer to the lungs of the patient. The methods provided herein result in a change from baseline on the semi-quantitative scale for mycobacterial culture for a treated patient, and/or NTM culture conversion to negative during or after the administration period. |
US09895383B2 |
Compositions for oral administration of zoledronic acid or related compounds for treating complex regional pain syndrome
Oral dosage forms of osteoclast inhibitors, such as nitrogen-containing bisphosphonates, can be used to treat or alleviate pain or related conditions such as complex regional pain syndrome. |
US09895381B2 |
Vitamin D receptor agonists to treat diseases involving CXCL12 activity
Provided herein are methods of treating and preventing pancreatitis, such as pancreatitis induced by glucagon-like peptide (GLP) agonists (such as GLP-1 agonists, for example Byetta®), by administration of a vitamin D receptor agonist (such as vitamin D, vitamin D analogs, vitamin D precursors, and vitamin D receptor agonists precursors). In some examples the subject has diabetes, such as type 2 diabetes. |
US09895379B2 |
17alpha, 21-dihydroxypregnene esters as antiandrogenic agents
The present application provides 17 and/or 21 esters of 17α,21-Dihydroxypregna-4,9(11)-diene-3,20-dione and 17α,21-dihydroxypregna-4-ene-3,20-dione having remarkable antiandrogenic activity, methods of using these compounds, and processes for their preparation. |
US09895377B2 |
Solid forms of tyrosine kinase inhibitors, process for the preparation and their pharmaceutical composition thereof
The present invention generally relates to solid forms of tyrosine kinase inhibitors, in particular combinations of tyrosine kinase inhibitors with anti-oxidative acids, processes for its preparation and a pharmaceutical compositions containing the same. |
US09895374B2 |
Thieno- and pyrrolopyrimidine analogues as anticancer agents and methods of use thereof
The present invention provides for the design and synthesis of halogenated thieno- and pyrrolopyrimidine compounds that exhibit cancer proliferation inhibitory activity and the use thereof for cancer treatment. |
US09895373B2 |
Substituted pyrazolo[3,4-D]pyrimidines and uses thereof
Presented herein are novel therapeutic compounds and methods of using the same for the treatment of cancers. |
US09895367B2 |
Formulation comprising phenylaminopyrimidine derivative as active agent
An oral pharmaceutical formulation containing an effective amount of NRC-AN-019 including its pharmaceutically acceptable salts and polymorphs such as Form I, Form II and Form III thereof to improve the bioavailability intended for self-emulsification upon its contact with the gastro-intestinal fluid. The invention also relates to a process for the preparation of oral solution containing NRC-AN-019 in an effective concentration for the better therapy against Chronic Myeloid Leukemia as BCR-ABL tyrosine kinase inhibitor and against other tumors such as head and neck cancer, prostate cancer and the like. |
US09895365B2 |
Combination therapy for cancer treatment
Combination therapies for treating cancer comprising administration of a topoisomerase-1 inhibitor and a PARP inhibitor are provided. The topoisomerase-1 inhibitor can be delivered as a liposomal formulation that provides for prolonged accumulation of the topoisomerase-1 inhibitor within a tumor relative to outside of the tumor. Therapeutic benefit can thereby be obtained by delaying the administration of the PARP inhibitor after each administration of a liposomal irinotecan formulation until the accumulation of the topoisomerase inhibitor in the tumor is sufficiently greater than outside the tumor to result in increased efficacy of the PARP inhibitor and topoisomerase inhibitor within the tumor, while reducing the peripheral toxicity of the combination therapy. The therapies disclosed herein are useful in the treatment of human cancers with solid tumors, including cervical cancer. |
US09895363B2 |
Methods for modulating function of proliferating cell nuclear antigen (PCNA) and treating cancer with PCNA-targeting compounds
Pharmaceutical compositions and methods for inhibiting cell growth, modulating function of PCNA, treating prostate cancer, and enhancing PCNA trimer formation are disclosed. The methods include administering an effective amount of a compound of Formula (I): (a representative image), or an effective amount of a specific compound of Formula (II): (a representative image). |
US09895358B2 |
Combination therapies for treatment of spinal muscular atrophy
Disclosed herein are compositions and methods for treatment of spinal muscular atrophy (SMA). In certain embodiments, compounds are provided that increase full-length survival of motor neuron (SMN) protein production by an SMN2 gene. |
US09895355B2 |
Methods of treating androgen receptor-mediated disorders with imidazoline derivatives
Methods for treating androgen receptor-mediated diseases, such as breast cancer, with imidazoline derivatives of formula (I) are provided: |
US09895353B2 |
Use of L-tryptophan for the treatment of parasomnias
Described is the use of L-tryptophan for treating a subject with parasomnia and associated methods of treating a subject with parasomnia. Optionally, the subject may be a child or adolescent between about 3 years of age and 18 years of age. The methods and uses described herein are useful for treating parasomnia in a subject exhibiting sleep walking, sleeptalking, confusional arousals, nightmares, night terrors, rhythmic movement disorder, sleep related eating disorder and/or bruxism. Optionally, subjects are treated with a dose L-tryptophan of about between 700 mg and 5 g per day. |
US09895346B2 |
Applications of substituent benzyloxy group containing ether compounds for preparing antitumor drugs
Disclosed are applications of substituent benzyloxy group containing ether compounds represented by general formula I for preparing antitumor drugs. The definition of the substituent groups in the formula I are provided in the specification.The compounds having general formula I have desirable antitumor activity, particularly, and have excellent activity against leukemia strain HL-60, lung cancer A549, H157, H460, H520, bladder cancer T24, J82, prostate cancer LNCap, PC-3, rectal cancer HCT8, HCT116, RkO and the like. |
US09895344B2 |
Treating various disorders with 7,8-dihydroxyflavone and derivatives thereof
Novel compounds and methods related to the activation of the TrkB receptor are provided. The methods include administering in vivo or in vitro a therapeutically effective amount of 7,8-dihydroxyflavone or derivative thereof. Specifically, methods and compounds for the treatment of disorders including neurologic disorders, neuropsychiatric disorders, and metabolic disorders (e.g., obesity) are provided. For example, a first method is provided of treating or reducing the risk of depression, anxiety, or obesity in a subject, which includes selecting a subject with or at risk of developing depression, anxiety, or obesity, and administering to the subject a therapeutically effective amount of 7,8-dihydroxyflavone or a derivative thereof. A further method of promoting neuroprotection in a subject also is provided, which includes selecting a subject in need of neuroprotection, and administering to the subject a therapeutically effective amount of 7,8-dihydroxyflavone or a derivative thereof. |
US09895338B1 |
Cobalt-polypyridyl complex for treatment of cancer, a pharmaceutical composition and a kit comprising it
A method for treating a subject suffering from a cancer, in particular a multidrug-resistant cancer includes administrating a cobalt-polypyridyl complex to the subject. A method for suppressing the growth of cancer cells, in particular inducing autophagy of the cancer cells, inducing cell cycle arrest of the cancer cells and/or inhibiting cell invasion of the cancer cells and for specifically targeting cancer cells with multidrug-resistance includes contacting said cancer cells with the cobalt-polypyridyl complex. A pharmaceutical composition and a kit are provided and include the cobalt-polypyridyl complex. Unexpectedly, the cobalt-polypyridyl complex is especially suitable to treat cancer, in particular multidrug-resistant cancer with an exceptionally increased cytotoxic activity towards multidrug-resistant cancer cells. |
US09895336B2 |
Crystalline forms of (N, N-Diethylcarbamoyl)methyl methyl (2E)but-2-ene-1,4-dioate, methods of synthesis and use
Disclosed herein are crystalline forms of (N,N-Diethylcarbamoyl)methyl methyl (2E)but-2-ene-1,4-dioate, which is a prodrug of methyl hydrogen fumarate. Crystalline form 1, Crystalline form 2, Crystalline 3, and Crystalline form 4 are disclosed. |
US09895334B2 |
Treatment of virally induced lesions
The present invention relates generally to the treatment of cutaneous lesions containing cells infected by a virus, as well as compositions for the treatment of such lesions. More specifically, the invention relates to the use of ingenol compounds, particularly ingenol angelates, in treating lesions caused by infection with a papilloma virus, such as a mammalian papilloma virus, in particular a Human Papilloma Virus. |
US09895333B2 |
Enhanced bioavailability of polyunsaturated fatty acids
Described herein are pharmaceutical compositions providing enhanced bioavailability of polyunsaturated fatty acids and methods of manufacturing the same. In particular, described herein are pharmaceutical compositions comprising soft enteric capsules that provide enhanced bioavailability of omega-3 polyunsaturated fatty acids. The oral pharmaceutical compositions described herein are useful as nutritional supplements or for the treatment of cardiovascular-related diseases, such as hyper dyslipidemia and moderate to high triglyceride levels. |
US09895332B2 |
Enteric soft capsules comprising polyunsaturated fatty acids
Described herein are pharmaceutical compositions comprising polyunsaturated fatty acids and methods of manufacturing the same. In particular, described herein are pharmaceutical compositions comprising soft enteric capsules comprising omega-3 polyunsaturated fatty acids. The oral pharmaceutical compositions described herein are useful as nutritional supplements or for the treatment of cardiovascular-related diseases, such as hyper dyslipidemia and high triglyceride levels. |
US09895330B2 |
IDO inhibitors
There are disclosed compounds of Formula (I) that modulate or inhibit the enzymatic activity of indoleamine 2,3-di-oxygenase (IDO), pharmaceutical compositions containing said compounds and methods of treating proliferative disorders, such as cancer, viral infections and/or autoimmune diseases utilizing the compounds of the invention. |
US09895325B2 |
Tablet composition comprising cinacalcet hydrochloride
The present invention relates to a tablet composition comprising a therapeutically effective dose of cinacalcet hydrochloride having a particle size distribution D90 equal to or less than 30 μm in an amount of from 40% to 60% by weight based on the total weight of the composition, and one or more pharmaceutically acceptable excipients. |
US09895323B2 |
Astaxanthin anti-inflammatory synergistic combinations
Compositions having synergistic combinations of astaxanthin with a tomato extract lycopene, and optionally with carnosic acid and/or lutein. Compositions having synergistic combinations of the aforementioned compounds, which may be used, inter alia, to inhibit/suppress inflammation via the suppression of the expression of anti-inflammatory mediators or via the suppression of the secretion of anti-inflammatory mediators from macrophages at a site of inflammation. |
US09895322B2 |
Pharmaceutical compositions for the delivery of substantially water-insoluble drugs
The subject invention relates to compositions and methods useful for the in vivo delivery of substantially water-insoluble drugs, like taxol. The use of specific composition and preparation conditions enables the reproducible production of unusually water-soluble formulation, which can be sterile-filtered. The particulate system produced according to the invention can be converted into a re-dispersible dry powder comprising nanoparticles of drug. The innovation is also based on the fact that complementary partner is also an active drug but may have a different mode action with respect to primary molecule of the hybrid drug. The complementary molecule has multiple properties like antioxidant, antimicrobial, anti-inflammatory, anti-allergic, cox-2 inhibitors, etc. This results in a unique delivery system, in which part of the pharmacologically active agent is readily bioavailable. |
US09895313B2 |
Combination liposomal pharmaceutical formulations
Docetaxel and doxorubicin can be formulated in liposomal pharmaceutical compositions. In various embodiments, the pharmaceutical compositions include (i) a first liposome type comprising a first lipid layer comprising an unsaturated phospholipid, cholesterol or a cholesterol derivative, DC-cholesterol, a cationic lipid, and preferably a pegylated phospholipid, and a first active pharmaceutical ingredient (API) comprising docetaxel in the first lipid layer; and (ii) a second liposome type comprising a second lipid layer, an aqueous interior, and a second API comprising doxorubicin crystallized in the aqueous interior, (iii) where the first liposome type does not comprise doxorubicin and the second liposome type does not comprise docetaxel. The pharmaceutical composition can be used to treat a subject, for example, a human subject having cancer. The cancer can be, for example, a lung cancer, preferably non-small cell lung cancer (NSCLC), colon cancer, breast cancer, or liver cancer, preferably hepatocellular carcinoma (HCC). |
US09895311B2 |
Foam-forming compositions and methods for delivering an active to a body cavity
Provided is a foam-forming formulation and method of treating an infection in a body cavity. The foam-forming formulation contains hydrogen peroxide, monoglyceride crystals, at least one acid and/or buffer which is present in an amount to provide a pH of 3 to 5 within a body cavity, a blowing agent in an amount to blow the foam-forming composition and form a foam, and water. The foam-forming composition is suitable application to body cavity when blown to form the foam and the form degrades at a body temperature to release the hydrogen peroxide to tissues in the body cavity at a pH of 3 to 5. Also provided is a foam-forming composition vehicle for delivering an active agent. |
US09895308B2 |
Heterocyclic compounds and their uses
Provided are certain pharmaceutical formulations of omecamtiv mecarbil and methods for their preparation and use. |
US09895303B2 |
Peptide, method and composition for stimulating melanogenesis
An isolated peptide for stimulating melanogenesis in a mammal subject is provided. The isolated peptide consisting of an amino acid sequence of FKCRRWQWRMK KLGAPSI (SEQ ID NO: 1). Also provided are methods and compositions for stimulating melanogenesis in a mammal subject. |
US09895295B2 |
Solid cosmetic composition in compact powder form
The present invention relates to a solid cosmetic composition in the form of a powder, which is preferably compacted, comprising at least: —a pulverulent phase in an amount of greater than or equal to 35% by weight relative to the total weight of the composition, comprising at least one perlite in the form of particles in a content of greater than or equal to 20% by weight relative to the total weight of the composition, —a liquid fatty phase, and in which the perlite particles and the liquid fatty phase are present in the composition in a respective total content such that the weight ratio of the perlite particles to the liquid fatty phase ranges from 2 to 25. The present invention also relates to a process for coating the face, and in particular the cheeks, the chin, the temples, the forehead and the nose, with the said cosmetic composition. |
US09895293B2 |
Illuminated nipple shield
A nipple shield containing a luminescent agent that illuminates for visibility in darkened conditions. The nipple shield has a nipple portion and a base portion that extends from the nipple portion formed of a resin material such as silicone that contains the luminescent agent, such as a photoluminescent pigment. The base portion or an outer annular part can contain the luminescent agent. The nipple shield or only the base portion can be a formed film that has a resin material layer that contains substantially no luminescent agent, and a layer that contains the molded resin material and the luminescent agent. An illuminating nipple shield can also be a nipple shield rim containing the luminescent agent that conforms and adheres releasable to the base portion of a conventional nipple shield. |
US09895292B1 |
Feeding device and methods using the same
Briefly, a feeding device embodying features of the present invention approximately conforms to the shape of a human breast and includes at least one housing for storing fluid coupled to a dispensing portion having an apertured dispensing tip for delivering the fluid to an infant. |
US09895291B2 |
Pressure-regulating vial adaptors
In certain embodiments, a vial adaptor comprises a housing configured to couple the adaptor with a vial, an access channel, a regulator channel, and a regulator assembly. The access channel is configured to facilitate withdrawal of fluid from the vial when the adaptor is coupled to the vial. The regulator channel is configured to facilitate a flow of a regulating fluid from the regulator assembly to compensate for changes in volume of a medical fluid in the vial. In some embodiments, the regulator assembly includes a flexible member configured to expand and contract in accordance with changes in the volume of the medical fluid in the vial. In some embodiments, the flexible member is substantially free to expand and contract. In some embodiments, the flexible member is not partly or completely located in a rigid enclosure. |
US09895290B2 |
Mechanical friction enhancement for threaded connection incorporating opposing barb
A medical connector includes a body having a distal end, a proximal end, and a sidewall extending between the distal end and the proximal end. The medical connector further includes a helical thread extending radially outward from a surface of the sidewall and at least one protrusion extending radially outward from a surface of the sidewall. The at least one protrusion has a first side and a second side. A radial height of the at least one protrusion from the surface of the sidewall tapers circumferentially from the first side of the at least one protrusion to the second side of the at least one protrusion. |
US09895286B2 |
Radially adjustable sex toy
A dildo with adjustable girth is provided through a construction including a base, dilating mechanisms, and an elastic membrane which is fit over the dilating mechanisms. The dilating mechanisms are formed from a shaft, lateral bracing supports, and a drive mechanism. The lateral bracing supports are connected along the shaft, forming an inner structure for the elastic membrane. The drive mechanism, when activated, causes the shaft to rotate, which in turn causes the lateral bracing supports to press against and expand the elastic membrane. Preferably, two dilating mechanisms are provided in order to evenly expand the dildo to each side. The drive mechanisms can be either electrically operated (for example a corded input or an internal battery powering a motor) or manually operated (for example a user manually turning a handle to rotate the shaft). An articulated shaft can also be added to allow for bending of the dildo. |
US09895278B2 |
Environment-friendly coffin
The environment-friendly coffin according to the invention comprising a box assembly and a profiled lid assembly covering said box assemblies, with both assemblies being connected to each other by means of connecting elements, is characterized in that the coffin's box assembly (1) comprises a casing (3) made of natural stone plates, plate-shaped flats (10) with tapped bores (11) made in them, fixed to inner or outer surfaces of longer plate side walls (5) of said casing, plate-shaped metal washers (12) with tapped mounting bores (13) fixed to these inner side walls (5) and a tubular element (15) mounted inside casing (3), said element tubular being made of glass fiber mat or metal and fastened to inner surfaces of plate side walls (5) and to bottom (4) made of natural stone slab or made of natural stone slab and plate (27) made of a made of a wood-base material and fixed to said stone slab by means of glue-based sealing mass (17), whereas the profiled lid assembly (2) of the coffin has an outer casing made of natural stone in the form of a solid with bottom cascade-shaped cavity (23) or with trough-shaped cavity (32) with a profile of the truncated pyramid, with a lower side offset in the form of a slab frame (29), where in the inner surface of said casing there is insert (30) made of a wood-base material with the same profile fixed by means of a glue to which glass fiber mat (31) is glued. |
US09895275B2 |
Extrusion bonded laminates for absorbent articles
An absorbent article of the present invention may comprise a topsheet, an outer cover, and an absorbent core disposed therebetween. The outer cover may comprise an extrusion bonded laminate. The EBL may comprise a multi-layer coextruded elastomeric film and a nonwoven. The film may comprise a core layer, a first outer layer, and a second outer layer, wherein the core layer is between the first and second outer layers. The nonwoven may comprise fibers and/or filaments. The first outer layer may be non-adhesively joined to the nonwoven via extrusion coating. Further, the outer cover may be elastic to at least about 50% engineering strain. The nonwoven may have high chemical affinity for the first outer layer. The first outer layer may have a low chemical affinity for the core layer. And, the first outer layer may comprise an amount of draw down polymer greater than about 45 wt %. |
US09895272B2 |
Absorbent articles with primary and secondary indicating
An absorbent article with a primary visual fullness indicator and a secondary visual wetness indicator. |
US09895271B2 |
Method and apparatus for attaching components to absorbent articles
Apparatus and method for applying discrete components of a first substrate to a second substrate includes a programmable servo motor having a shaft. The servo motor is programmed to rotate the shaft in a first phase and a second phase at a variable angular velocity in a single direction. The apparatus also includes a crank member connected with the shaft, a connector link connected with the crank member, and a tamper member connected with the connector link. When the shaft rotates in the first phase, the tamper member travels from a first position to a second position to displace a selected portion of the second substrate into contact with the discrete component. |
US09895269B2 |
Reduced-pressure, compression systems and apparatuses for use on a curved body part
A system for providing a force to a desired area on a curved body part of a person includes a dressing assembly shaped and configured to be placed on the desired area of the person, a releaseable circumferential member surrounding the curved body part that holds the dressing assembly against the desired area, a sealing subsystem for providing a fluid seal over the dressing assembly and the person's skin, and a reduced-pressure subsystem for providing a reduced pressure to the dressing assembly. When reduced pressure is supplied, the system generates the force against the desired area on the curved body part. |
US09895264B2 |
Gonio lens system with stabilization mechanism
This disclosure relates generally to methods and devices for use in viewing and positioning an eye with a gonio lens system, such as during ocular exams and ocular surgeries. Some embodiments of the gonio lens system can include a gonio lens for viewing one or more tissues and structures of the eye. In addition, the gonio lens system can include one or more positioning features for controlling movement positioning of the eye. |
US09895263B2 |
Patient interface for ophthalmologic diagnostic and interventional procedures
An ophthalmic system may comprise an imaging device having a field of view oriented toward the eye of the patient; a patient interface housing defining a passage therethrough, having a distal end coupled to one or more seals configured to be directly engaged with one or more surfaces of the eye of the patient, and wherein the proximal end is configured to be coupled to the patient workstation such that at least a portion of the field of view of the imaging device passes through the passage; and two or more registration fiducials coupled to the patient interface housing in a predetermined geometric configuration relative to the patient interface housing within the field of view of the imaging device such that they may be imaged by the imaging device in reference to predetermined geometric markers on the eye of the patient which may also be imaged by the imaging device. |
US09895258B2 |
Ocular delivery systems and methods
Described here are systems and methods for accessing Schlemm's canal and for delivering an ocular device or fluid composition therein. The ocular devices may maintain the patency of Schlemm's canal without substantially interfering with transmural fluid flow across the canal. The fluid composition may be a viscoelastic fluid that is delivered into the canal to facilitate drainage of aqueous humor by disrupting the canal and surrounding trabeculocanalicular tissues. Tools for disrupting these tissues and minimally invasive methods for treating medical conditions associated with elevated intraocular pressure, including glaucoma, are also described. |
US09895244B2 |
Segmented scaffolds and delivery thereof for peripheral applications
Segmented scaffolds composed of disconnected scaffold segments are delivered to an implant site on a delivery balloon. The segments are crimped to the balloon and separated from each other by gaps. When the balloon is inflated the gaps between the disconnected scaffold segments stay constant. Pillowed or banded balloons are used to deliver the segments. |
US09895237B2 |
Intervertebral implant
The present invention provides an intervertebral implant for implantation in a treated area of an intervertebral space between vertebral bodies of a spine. The implant includes a spacer portion having an inferior and superior surface, wherein the inferior and superior surfaces each have a contact area capable of engaging with anatomy in the treated area, and the inferior and superior surfaces define a through-hole extending through the spacer body. The present invention further provides holes extending from a side portion to the inferior and superior surfaces of the spacer portion and a plate portion rigidly coupled to the spacer portion, wherein the plate portion contains holes for receiving screws. A fastener back out prevention mechanism adapted on the plate to prevent the back out of the fasteners from the holes and to secure the spacer to the plate of the intervertebral implant. |
US09895236B2 |
Enhanced cage insertion assembly
A method of delivering a fusion cage to an intervertebral disc space bounded by adjacent vertebral endplates, comprising the step of delivering the fusion cage into the disc space without contacting its teeth to the vertebral endplates during delivery, wherein a sheath is interposed between a cage surface and the endplates to prevent contact therebetween during delivery. |
US09895232B2 |
Releasable threaded connection for modular implants
An orthopedic prosthesis assembly includes a first prosthetic component, a second prosthetic component, and a fastener. The first prosthetic component includes a threaded bore. The second prosthetic component includes an opening and a threaded inner wall that extends inwardly from the opening. The fastener includes a first axial section having a first plurality of threads engaged with the threaded inner wall the second prosthetic component, and a second axial section having a second plurality of threads engaged with the threaded bore of the first prosthetic component to secure the first prosthetic component to the second prosthetic component. |
US09895230B2 |
Deformable articulating templates
A method for generating a patient-specific prosthetic implant is disclosed which includes generating, using one or more processors from a medical image of a human anatomical feature, a three dimensional electronic representation of the human anatomical feature including size and surface curvature features matching the human anatomical feature, the surface curvature features including one or more radii of curvature on an outer camming surface of the human anatomical feature. A prosthetic implant template is selected, using the one or more processors, from a database of prosthetic implant templates, and the custom implant is virtually designed to imitate the size and surface curvature features of the three dimensional electronic representation based on the selected prosthetic implant template. Fit of the custom implant is tested, virtually using the one or more processors, using the three dimensional electronic representation of the human anatomical feature. |
US09895228B2 |
Covered heart valve sizer
A heart valve sizer and sizer cover are provided for determining the size of a heart valve annulus. The valve sizer can include a handle, a shaft extending distally from the handle, a sizing element coupled to the distal end of the shaft, the sizing element being movable between a first retracted position and a second expanded position, and a sizer cover. The sizer cover can be formed from a continuous sheet of material configured to surround at least a portion of the sizing element of the heart valve sizer so as to guard against entanglement of the sizing element with structures of a human heart. |
US09895224B2 |
Treatment catheter system
A treatment catheter system for treatment of a heart valve includes a circumferential valve tissue structure and an elongate catheter member, and has an inner lumen, proximal and distal end portions. The system includes a catching component which can be positioned at the distal end portion of the catheter member to be non-separable from the catheter member. An outer member extends circumferentially around the catheter member. The circumferential valve tissue structure is correspondingly arranged between the catheter member and the outer member. A catching mechanism reduces a radial distance between the catheter member and the outer member to catch the valve tissue between the outer member and the catheter member via a catching opening to immobilize and treat the caught valve tissue on the distal end portion of the catheter member. |
US09895223B2 |
Cardiac valve prosthesis
A prosthesis for implantation at an implantation site proximate a native aortic valve, the implantation site including a valve annulus and a plurality of Valsalva sinuses located distal to the valve annulus. The prosthesis comprises an armature and a valve connected to the armature, wherein the armature includes a proximal portion configured for anchorage to the valve annulus, a distal portion configured to be positioned distal to the Valsalva sinuses when the proximal portion is anchored to the valve annulus, and first, second and third Valsalva sinus anchors each extending between and connecting the proximal and distal portions and arching radially outward between the proximal portion and the distal portion. The Valsalva sinus anchors are positioned so that each can extend into and engage a wall of a different one of the Valsalva sinuses. |
US09895220B2 |
Mitral bileaflet valve
A heart valve assembly has a leaflet support structure and a leaflet assembly. The leaflet support structure has a wire frame that supports the leaflet assembly. The leaflet assembly has first and second separate leaflets, each of which is comprised of a skirt section and a sinus leaflet section. Each skirt section has a flange portion and a body portion that has a smaller diameter than the flange portion, with the body portion having opposing side edges, and a curved opening defined by a first stitching edge at about the central portion of the body portion. Each sinus leaflet section has an outflow edge, and a curved second stitching edge, with the sinus leaflet section stitched to the skirt section along the first and second stitching edges. The opposing side edges of the body portion of the first leaflet are stitched to the corresponding side edges of the body portion of the second leaflet. |
US09895219B2 |
Mitral valve prosthesis for transcatheter valve implantation
A transcatheter valve prosthesis is disclosed that has a compressed, delivery configuration and an expanded configuration for deployment within a native heart valve. The valve prosthesis includes a self-expanding frame and a prosthetic valve component. The self-expanding frame includes a valve receiving portion defining an opening therethrough and first and second anchors at opposing ends of the valve receiving portion. The valve receiving portion is substantially planar and the first and second anchors are oriented substantially perpendicular to the valve receiving portion when the valve prosthesis is in the expanded configuration. The prosthetic valve component is disposed within the opening of the valve receiving portion and secured thereto. |
US09895217B2 |
Stent attachment for endovascular aneurysm repair
The technology described herein relates to a stent graft and a method of making the stent wherein the stent comprises interconnected struts and is connected to the graft material by applying at least one band of polymer so as to cover at least a portion of at least some of the struts. A stent supported area is created by the stent's attachment to the graft material and the at least one band of polymer is applied so as to leave the majority of the stent supported area uncovered by the at least one band of polymer. |
US09895215B2 |
Method and apparatus for deploying and retrieving objects in a cavity
The present invention relates generally to a method and apparatus for deploying and/or retrieving a vena cava filter in a vena cava using a system configured to: (i) maintain grip of the unsheathed filter in the vena cava until deliberately released, (ii) prevent premature release of the filter in the vena cava, and/or (iii) facilitate retrieval by first everting the filter, then withdrawing the filter through a guiding catheter (e.g., retrieval via eversion). |
US09895212B2 |
Devices and methods for preventing incisional hernias
A reinforcement device comprises a sheet of biocompatible material equipped with a plurality of hooks or apertures for reinforcing the closure of a surgical incision, including elongated abdominal incisions. The reinforcement device, when implanted through surgery, reduces the likelihood of and/or prevents incisional hernias. The reinforcement device may be included in a surgical kit. |
US09895210B2 |
Electric linear actuator and output shaft vibration-type electric device with said electric linear actuator
An electric linear actuator includes a fixed block, an output movable block, a counter movable block, a projecting side coupling member, a retracting side coupling member, a block coupling member, and an output functional member. The output movable block and the counter movable block are configured to be reciprocated in the movable direction in opposite phases by electromagnetic force acting between the fixed block and the output and counter movable blocks. The projecting side coupling member is coupled to the output movable block and the counter movable block. The retracting side coupling member is coupled to the output movable block and the counter movable block. The projecting side coupling member and the retracting side coupling member have different shapes. |
US09895204B2 |
Dental handpiece of center-injection type
The dental handpiece of a center-injection type has a bur sleeve (8, 9) having an axial through hole capable of receiving and detachably holding therein a cutting bur having an axial through hole, upper and lower bearings (10, 11) for rotatably supporting the bur sleeve (8, 9), and an injection nozzle (5) capable of being inserted into the axial through hole of the cutting bur from its proximal end for injecting cooling water through the other end. The dental handpiece (1) further has an upper seal means (17) arranged to seal the space between the upper region of the bur sleeve (8, 9) and the upper bearing (10), and a lower seal means (17′9 arranged to seal the space between the lower region of the bur sleeve (8, 9) and the lower bearing (11). |
US09895200B2 |
Robotic devices and systems for performing single incision procedures and natural orifice translumenal endoscopic surgical procedures, and methods of configuring robotic devices and systems
Example embodiments relate to surgical systems having end-effector assembly, first and second arm assemblies, and elbow joint assembly. End-effector assembly includes instrument assembly and wrist assembly. Instrument assembly includes a first instrument. First arm assembly includes a body, first and second instrument drive assemblies, wrist drive assembly, and first arm drive assembly. First instrument drive assembly is configurable to move first instrument relative to first axis. Wrist drive assembly is configurable to move instrument assembly relative second axis. First arm drive assembly is configurable to rotate end-effector assembly relative to third axis. Elbow joint assembly includes elbow pitch joint portion configurable to be driven to move first arm assembly relative to fourth axis. Elbow joint assembly also includes elbow sway joint portion configurable to be driven to move first arm assembly relative to fifth axis. |
US09895195B2 |
Methods for therapeutic renal neuromodulation
Methods and apparatus are provided for treating hypertension, e.g., via a pulsed electric field, via a stimulation electric field, via localized drug delivery, via high frequency ultrasound, via thermal techniques, etc. Such neuromodulation may effectuate irreversible electroporation or electrofusion, necrosis and/or inducement of apoptosis, alteration of gene expression, action potential attenuation or blockade, changes in cytokine up-regulation and other conditions in target neural fibers. In some embodiments, neuromodulation is applied to neural fibers that contribute to renal function. In some embodiments, such neuromodulation is performed in a bilateral fashion. Bilateral renal neuromodulation may provide enhanced therapeutic effect in some patients as compared to renal neuromodulation performed unilaterally, i.e., as compared to renal neuromodulation performed on neural tissue innervating a single kidney. |
US09895191B2 |
Electrode sheath for electrosurgical device
This invention provides an electrosurgical device comprising a handle, a shaft member distal to the handle, a first electrode tip and a second electrode tip at a distal end of the shaft member with the first electrode tip laterally spaced from the second electrode tip, and an electrode sheath movable to cover and uncover a side of the electrode tips while a distal end of the electrode tips is uncovered to treat tissue. |
US09895183B2 |
Liner for cryogenic treatment systems
Liners for cryogenic treatment systems are described where a cryogenic fluid or gas may be introduced into a liner expanded within a body lumen such as the uterine cavity. The liner may be intentionally sized to be substantially larger than the typical size of the uterine cavity, e.g., 1.2 times (or more), greater than the size of the uterine cavity into which the liner is inserted. Because the liner is sized intentionally larger than the body lumen to be treated, the liner may never fully expand when deployed. But even with folds or portions of the liner being folded upon itself, the liner may remain sufficiently supple such that the resulting uncontrolled folds allow for complete conformance of the liner against the anatomy of the contacted tissue. |
US09895182B2 |
System and method for orthopedic implant configuration
Anatomic points within the body are projected outside the body through the use of extenders. The projected points may then be used for measurement, or to facilitate the selection or configuration of an implant that is to be positioned proximate the anatomic points. Such an implant may be a rod for a posterior spinal fusion system. Pedicle screws may be implanted into pedicles of the spine, and may then serve as anchors for the extenders. The extenders may have rod interfaces that receive the rod in a manner that mimics the geometry of the pedicle screws so that the selected or configured contoured rod will properly fit into engagement with the pedicle screws. |
US09895181B2 |
Variable angle locking rotation correction plate
A bone plate sized and shaped for fixation to one of a phalangeal and metacarpal bone includes a head extending from a first end to a second end and having an elongated curved plate hole extending therethrough along a curved path from a first end to a second end, a plate hole axis of the elongated curved plate hole extending orthogonally from a top surface to a bone contacting surface of the bone plate and a shaft extending from the head, the shaft including an elongated shaft plate hole extending therethrough and elongated in a direction extending orthogonal to a central longitudinal axis of the bone plate, a plate hole axis of the elongated shaft plate hole extending orthogonally from the top surface to the bone contacting surface. |
US09895180B2 |
Ankle tibia plates
Implant devices for the internal fixation of fractured bones, and more particularly to ankle plates for the tibia bone are disclosed and include an anterolateral tibia plate having an L-shaped body including a proximal portion defining a longitudinal axis, and a distal portion defining a traverse axis, and having a support bridge connected between the proximal portion and the distal portion. Implant devices disclosed also include an anterior tibia plate having an elongated first portion, a second portion that widens outward with respect to the elongated first portion, and a plurality of removable tabs attached to the outer edge of the second portion. Implant devices disclosed also include a medial tibia plate having an elongated shaft with a proximal portion and a distal portion. The distal portion is configured to extend proximate to a base of medial malleolus, and has a curvature with respect to a longitudinal axis defined by the elongated shaft. The distal portion may include a plurality of removable tabs. The removable tabs may be disposed to define an opening between the removable tabs to orient a bone fastener into a bone. |
US09895172B2 |
Receiving part for receiving a rod for coupling the rod to a bone anchoring element
A receiving part for receiving a rod for coupling the rod to a bone anchoring element includes a receiving part body including a first end and a second end, and having a substantially U-shaped recess at the first end forming a channel for receiving the rod, and an accommodation space for accommodating a head of the bone anchoring element, the accommodation space having an opening at the second end for introducing the head; and a pressure element arranged at least partially in the accommodation space, the pressure element including a first section having a second recess for receiving the rod, and a second section having a flexible portion to clamp the head, the first section and the second section being fixed relative to each other, wherein said pressure element is insertable from the opening. |
US09895170B2 |
Coupling assembly for coupling a rod to a bone anchoring element and bone anchoring device with such a coupling assembly
A coupling assembly for coupling a rod to a bone anchoring element includes a receiving part with an accommodation space defining an opening for inserting and accommodating a head of the bone anchoring element, and a pressure element having a cap portion configured to hold the head. In an inserting position, the cap portion of the pressure element is expandable in the accommodation space of the receiving part, and a first retaining element is configured to prevent the pressure element from moving towards a first end of the receiving part. In a pre-locking position, the head is held in the cap portion of the pressure element and is pivotable in the receiving part, while the cap portion is restricted from expanding to prevent removal of the head, and where a second retaining element is configured to prevent the pressure element from moving from the pre-locking position towards the inserting position. |
US09895164B2 |
Method and structure for selectively locking portions of a seal assembly
A surgical access device that includes a seal assembly. The seal assembly includes an upper housing portion having a first seal and a lower housing portion including a second seal. The upper housing portion is rotatably connectable to the lower housing portion. The surgical access device also includes a rotation prevention mechanism configured to prevent inadvertent relative rotation of, and disconnection of, the upper housing portion and the lower housing portion. The rotation prevention mechanism is further configured to be selectively actuated by a user, such that, when actuated, the upper housing portion is selectively rotatable relative to, and disconnectable from, the lower housing portion. |
US09895162B2 |
Method and apparatus for tissue grafting and copying
Exemplary embodiments of apparatus and method for obtaining one or more portions of biological tissue (“micrografts”) to form grafts are provided. For example, a hollow tube can be inserted into tissue at a donor site, and a pin provided within the tube can facilitate controlled removal of the micrograft from the tube. Micrografts can be harvested and directly implanted into an overlying biocompatible matrix through coordinated motion of the tube and pin. A needle can be provided around the tube to facilitate a direct implantation of a micrograft into a remote recipient site or matrix. The exemplary apparatus can include a plurality of such tubes and pins for simultaneous harvesting and/or implanting of a plurality of micrografts. The harvested micrografts can have a small dimension, e.g., less than about 1 mm, which can promote healing of the donor site and/or viability of the harvested tissue. |
US09895161B2 |
Ultrasonic surgical shears with clamping feature
An apparatus for operating on tissue comprises a shaft, an acoustic waveguide, and an end effector. The acoustic waveguide extends along the shaft and is configured to transmit ultrasonic vibration. The end effector comprises an ultrasonic blade and a clamp arm. The ultrasonic blade is in acoustic communication with the acoustic waveguide. The clamp arm is pivotable toward the ultrasonic blade. The end effector defines a first longitudinal region and a second longitudinal region. The end effector is configured to clamp tissue between the clamp arm and the ultrasonic blade in the first longitudinal region. The end effector is configured to sever tissue with the ultrasonic blade in the second longitudinal region. |