最新美国发明专利第2010-08-10期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US07773340B2	Patterned magnetic recording head having a gap pattern with substantially elliptical or substantially diamond-shaped termination pattern A thin-film magnetic recording head utilizing a timing based servo pattern is fabricated by sputtering a magnetically permeable thin film onto a substrate. A gap pattern, preferably a timing based pattern, is defined by the thin film. The gap pattern includes termination patterns or endpoints that are elliptical or diamond-shaped.
US07773330B2	Apparatus for excitation, enhancement, and confinement of surface electromagnetic waves for confined optical power delivery An apparatus for producing an optical spot on the order of 25 nm in a recording media. The apparatus includes an optical transducer comprising a waveguide which defines an aperture adjacent to an air bearing surface of the transducer adjacent a recording media. The transducer includes a protrusion extending beyond the plane of the air bearing surface extending toward the recording media.
US07773328B1	Synchronous repeatable run out field detection with high efficiency field format A hard disk control system comprises a phase adjust module, an offset adjust module, and a read/write timing module. The phase adjust module generates a phase adjust signal based on a phase difference between a first repeatable run out (RRO) field and a servo wedge field. The offset adjust module outputs a position calibration pattern to a storage medium based on the phase adjust signal; receives at least a portion of the position calibration pattern from the storage medium; and determines an offset based on a comparison between the output position calibration pattern and the received portion of the position calibration pattern. The read/write timing module determines a position to write a second RRO field on the storage medium based on the offset.
US07773324B2	Phase acquisition loop for a read channel and related read channel, system, and method A phase-acquisition (PA) loop for a read channel comprises an accumulator, a comparator, and a filter. The accumulator holds an acquired phase-correction value corresponding to a difference between a phase of a sample clock and a phase of data carried by a read signal, and provides the acquired phase-correction value to a circuit that modifies the read signal to compensate for the phase difference. The comparator receives a reference phase-correction value that also corresponds to the difference between the phases of the sample clock and the data, and generates an error signal that is related to a difference between the reference and acquired phase-correction values. And the filter causes the acquired phase-correction value to have a predetermined relationship to the reference phase-correction value. Because such a PA loop may require significantly fewer samples of a read-signal preamble than prior PA loops requires to acquire the phase between a sample clock and data carried by a read signal, such a PA loop may allow one to significantly reduce the length of the preamble.
US07773322B2	Systems and methods for moving a lens using shape memory materials An imaging apparatus comprises an image pickup and a lens. A shape memory actuator is coupled to the lens and configured to move the lens relative to the image pickup.
US07773319B2	Lens with collar and lens module using same An exemplary lens includes an active part configured for refracting light transmitting therethrough, an inactive part surrounding the active part, and a collar formed on a surface of the inactive part.
US07773317B2	Lens system with symmetrical optics A lens system comprising an inner lens structure and an outer lens structure. The inner lens structure comprises an inner positive lens, a first transparent substrate and an inner negative lens. The outer lens structure comprises an outer positive lens, a second transparent substrate and an outer negative lens.
US07773315B2	Laser optical device In a laser optical device including a beam shaping optical system 3 for shaping a laser beam 2 into a predetermined cross-sectional intensity distribution and converging the light and an image formation optical system 6 for forming an image of a shaped beam 4 shaped and converged through the beam shaping optical system 3, the image formation optical system 6 is made up of an objective lens system 8 having a negative focal length placed ahead of a focal plane 7 of the beam shaping optical system 3 and an imaging lens system 9 placed behind the objective lens system 8.
US07773313B2	Cam mechanism of a retractable zoom lens A cam mechanism includes a cam ring having front and rear cam grooves which have a common reference cam diagram and are formed so that a front part of the front cam groove and a rear part of the rear cam groove are omitted from the reference cam diagram. A normal-width section and a wide-width section are provided in each of the front and rear cam grooves. In a zoom range, an associated cam follower of a driven member is engaged in the normal-width section of one of the front and rear cam grooves, and another associated cam follower of the driven member is positioned out of the other of the front and rear cam grooves. In a transition state between the zoom range and an accommodated position, both of the associated cam followers are positioned out of the normal-width sections of the respective front and rear cam grooves.
US07773310B2	Zoom lens and image pickup apparatus A zoom lens includes first to fifth lens groups respectively having positive, negative, positive, positive, and negative refractive powers in that order from the object side. Zooming is performed by moving the second lens group and the fourth lens group in an optical-axis direction. The first lens group includes a front lens group having a negative refractive power, an optical member for bending an optical path, and a rear lens group having a positive refractive power in that order from the object side. The front lens group is a cemented lens in which a first lens having a negative refractive power is bonded to a second lens having a positive refractive power in that order from the object side to the image side.
US07773307B2	Phase mask with continuous azimuthal variation for a coronagraph imaging system Systems and methods for shifting the phase of incident light to induce a continuous phase variation in an azimuthal direction. A phase mask assembly has a first surface and a second surface. The first surface and the second surface are configured such that the distance between the first surface and the second surface varies continuously in an azimuthal direction around the phase mask. This mask can be used in a coronagraph system to effectively suppress the on-axis star image for the detection of off-axis planets.
US07773306B2	Electrowetting cells An electrowetting cell including an expandable joint between a body section and an end section. Such an expandable joint could include a membrane or a flange-like portion.
US07773303B2	Image projecting apparatus An image projecting apparatus includes a light source, a relay lens, a reflective light valve, and a projection lens. The light source is capable of emitting a light beam. The relay lens is disposed to permit the light beam provided by the light source to pass therethrough, and has a lens periphery formed with a notch. The reflective light valve is spaced apart from the relay lens, and is disposed to receive and modulate the light beam passing through the relay lens into an image light beam. The projection lens is disposed proximate to the notch of the relay lens, and is capable of projecting the image light from the reflective light valve to display an image onto a screen. The relay lens has a plurality of light-absorbing regions proximate to the notch for reducing a light-splitting effect attributed to the notch.
US07773291B2	Light filter/modulator and array of filters/modulators A light filter or an array of filters can be either one or two dimensional. The filter or filters use multiple beam interference by varying an optical path length between semi-reflective surfaces. The optical path length between the semi-reflective surfaces is varied by changing a thickness of a polymer film in response to an electric field formed between two semi-transparent electrodes. The filter can be configured in either a transmissive or reflective mode.
US07773285B2	Display element and production method thereof A display element that excels in electrode durability. This display element is one having opposed electrodes and, interposed therebetween, an electrolyte containing either silver or a compound containing silver in its chemical structure, the opposed electrodes driven and operated so as to induce dissolution and precipitation of silver, characterized in that of the opposed electrodes, the electrode at a face not lying on an image observation side, after hermetic charging of the electrolyte, is plated with silver with the use of the electrolyte as a silver plating solution.
US07773283B2	Optical modulation device and optical modulation method According to an aspect of an embodiment, an optical modulation device includes a Mach-Zehnder modulator and a controller. The Mach-Zehnder modulator is supplied a drive signal and a bias voltage. The Mach-Zehnder modulator modulates inputted light on the bases of the drive signal and the bias voltage. The drive signal selectively is superimposes a predetermined frequency signal. The bias voltage selectively is superimposes the predetermined frequency signal. The controller selects a superimposing target which is the drive signal or the bias voltage so as to change modulation formats.
US07773282B2	Optical deflector An optical deflector includes a mirror having a reflective plane; a torsion bar extending outwardly from a side of said mirror; a support surrounding said mirror; a piezoelectric cantilever including a supporting body and a piezoelectric body formed on the supporting body, one end of said piezoelectric cantilever being connected to said torsion bar, the other end of the piezoelectric cantilever being connected to said support, said piezoelectric cantilever, upon application of a driving voltage to the piezoelectric body, exhibiting a bending deformation due to piezoelectricity so as to rotate said torsion bar, thereby rotarily driving said mirror through said torsion bar; and an impact attenuator connected to said support, the impact attenuator being disposed in a gap between said mirror and said support.
US07773279B2	Actuator, optical scanner, and image forming apparatus An actuator includes: a first vibration system including a driving member having a frame shape, and a pair of first axial members each one end of which supports the driving member so as to allow the driving member to rotate about an X-axis; a second vibration system including a movable plate provided inside the driving member, and a pair of second axial members each one end of which supports the movable plate so as to allow the movable plate to rotate about a Y-axis perpendicular to the X-axis; a driving unit including a ferromagnetic member, a coil generating a magnetic field on the ferromagnetic; and a positioning portion that places the ferromagnetic member or the coil symmetrical with respect to an intersection point of the X and Y-axes.
US07773278B2	Reflective optical scanning system having minimized aberration The present invention is a scanning system having spherical mirrors to operate a two-dimensional scanning. Aberration owing to oblique incident light is compensated to reach diffraction limit. With proper metallic coating, the present invention uses a wavelength from ultra-violet light to tera-hertz wavelength
US07773277B2	Beam irradiation apparatus A light refracting element formed in parallel plate shape is attached to a support shaft of a mirror holder, a semiconductor laser and a PSD are disposed at positions between which the light refracting element is sandwiched. The light refracting element is rotated by rotation of the mirror holder, and whereby a laser beam irradiation position is changed on a light acceptance surface of PSD. The laser beam irradiation position on a light acceptance surface corresponds to the mirror rotation position, so that the mirror rotation position and a laser beam scanning position in a target area can be detected based on an output from the PSD.
US07773273B2	Method and apparatus for removing show-through in scanned image Provided are a method and apparatus for removing show-through of a scanned image. The method includes: performing forward scanning on a medium placed on a glass platen of an image scanner; performing backward scanning on the medium; and removing show-through of a forward-scanned image based on a backward-scanned image.
US07773272B2	Image reading apparatus An image reading apparatus that includes: a document delivering unit; a switchback delivering unit that pulls a document into a switchback delivery path extended to an opening formed on an external surface of an apparatus housing from a predetermined position of the document delivery path; an image reading unit that reads an image of the document delivered to a reading position of the document delivery path; and a control unit that delivers a document inserted into the opening of the switchback delivery path to the reading position by the switchback delivering unit and the document delivering unit, thereby reading an image in a second image reading operation to be carried out by temporarily stopping a first image reading operation.
US07773270B2	Image scanner feature detection Systems are disclosed for detecting an unwanted artifact in an image scanner. An exemplary system includes a treated component of the image scanner, the treated component treated such that light reflects differently from the treated component than light reflected by an image being scanned by the image scanner. The light reflected from the treated component facilitates detection and removal of the unwanted artifact in the image being scanned, the unwanted artifact caused by the light reflected by the treated component.
US07773262B2	Image rendering method An image rendering method includes the following steps. Firstly, a source image is provided. Then, raster operations (ROPs) are performed on the source image by a first bit operating engine to obtain ROP values, and the source image are divided into at least one first region and at least one second region. Then, a first operation is performed on the first region by the first bit operating engine and a render process is executed, thereby generating first bit image data. Then, a second operation is performed on the second region by a second bit operating engine and a render process is executed, thereby generating second bit image data. Afterwards, the second bit image data of the second region are converted into first bit image data of the second region according to a screening table between the first bit operating engine and the second bit operating engine.
US07773256B2	Estimating color of colorants mixed on a substrate Systems and methods are provided that accurately estimate a post-printing appearance of a color on a substrate. In addition, systems and methods are provided that accurately estimate a post-mixing appearance of several colors mixed on a substrate.
US07773254B2	Method and system for improved copy quality in a multifunction reprographic system A method and system reconstructs a contone image from a binary image by first tagging pixels to identify one of a multiplicity of image content types. The tag information and the pattern of bits surrounding the pixel to be converted to a contone value are used to reconstruct a contone image from a binary image. The pattern of bits in the neighborhood is used to generate a unique identifier. The unique identifier is used as the address for a lookup table with the contone value to be used wherein each lookup table corresponds to an image context type.
US07773253B2	Gloss difference control in a plurality of networked image forming apparatus A gloss difference control method includes: forming a predetermined image on a sheet in each of a plurality of image forming apparatuses connected to a network; measuring a glossiness of the image formed on each sheet; and controlling a gloss difference among the plurality of image forming apparatuses by changing a gloss adjustment parameter of each of the plurality of image forming apparatuses, based on a plurality of the measured glossiness.
US07773243B2	Image forming apparatus having a print processing unit An image forming apparatus judges whether the number of pages to print exceeds the number as a reference to judge whether to print many pages based on the setting of a confidential document print job, when receiving the print job. When the number of pages to print exceeds the reference number, the image forming apparatus ejects printed paper sheets to a housing box having a key unit to lock not to be taken out from the main body together with printed confidential documents. When the number of pages to print does not exceed the reference number, the apparatus performs a private print which starts printing and ejecting printed paper sheets to the paper eject unit after receiving an instruction from a user.
US07773242B2	Automated remote correction of preflight defects A method of automatic correction of preflight defects located in print jobs submitted by print buyers to a print vendor through the Internet. The defect correction routine determines whether the print job files are non-compliant with an associated file format supported by the preflight system in a manner that can be automatically corrected, and initiates an auto-correct subroutine if the print job file content is non-compliant. The routine queries whether the print job file is missing any resources, and initiates an obtain resources subroutine if the print job file is missing resources. The routine queries whether the print job files include defects that can be manually corrected, and initiates a manual-correct subroutine if the print job files include such defects. The routine sends the print job to the workflow if no manual corrections are required.
US07773239B2	System for managing replaceable modules in a digital printing apparatus An electrophotographic printing or copying machine includes a functional module which can be readily removed and replaced by service personnel. The module includes a monitor in the form of an electronically-readable memory, which includes information about how the particular module is to be operated. A distribution board electronically accesses the memories within the monitors and reads therefrom information, such as how much voltage to supply to different components within each module. The distribution board can also update the number of prints made with each module, and maintain this count within the monitors.
US07773232B2	Apparatus and method for determining trench parameters An apparatus includes an evaluating unit and a peak detection unit. The peak detection unit is configured to determine at least one peak parameter of a peak in a Fourier transformed reflection spectrum of infrared radiation reflected off a sample that may comprise trench structures. The evaluation unit is configured to determine from the at least one peak parameter and from a correction value containing information about an effective refractive index of the sample, a trench parameter of the trench structures.
US07773226B2	Web inspection calibration system and related methods Systems and methods for calibrating a web inspection system.
US07773222B2	UV enhanced full width array scanning spectrophotometer A system and method for full width scanning color analysis of a printed media sheet are disclosed. The full width array spectrophotometer system includes one or more substantially linear elongated illumination arrays of closely spaced multiple illumination sources. The sources include sets of illumination sources, including a first set of different color illumination sources and a second set including one or more UV-emitting illumination sources. The sets are arranged to span a printer paper path or other object path to illuminate a band extending transversely across a printed print media sheet or other object moving in the path. A full width array light imaging sensor includes an elongated array of multiple closely spaced photodetectors for detecting plural colors and is positioned adjacent to and extending substantially parallel to the linear array(s) to receive radiation reflected from the transverse illuminated band.
US07773214B2	Apparatus and methods for container inspection Apparatus, systems, and methods to recognize features on bottom surfaces of containers on a container production line, detect defects in the containers, and correlate the defects to specific production equipment of the container production line, based in part on the recognized features. The system includes imaging apparatus, programmable processing devices, and controllers. The methods include imaging techniques and estimation techniques.
US07773212B1	Contemporaneous surface and edge inspection In one embodiment, a surface analyzer system comprises a first radiation source to generate radiation at a first wavelength, a surface inspection assembly, and an edge detection assembly. In operation, the system enables contemporaneous surface inspection and edge detection.
US07773207B1	Estimating optical transmission system penalties induced by polarization mode dispersion (PMD) Polarization mode dispersion (PMD) induced system penalty ε is determined from optical characteristics of an optical wavelength division multiplexed (WDM) signal that is carried on a network. The method involves tapping the optical WDM signal, separating an optical channel from the tapped optical WDM signal, performing a frequency-resolved state of polarization (SOP) measurement on the channel, and computing the PMD-induced system penalty as ε=AL2+BL4, in which A and B are predetermined parameters and L is an SOP string length based on the SOP measurement.
US07773204B1	Apparatus and method for spatial encoding of a search space Spatial encoding of a search space is achieved by an array of radiation or acoustic energy detectors receiving data from at least one radiation or energy source. At least one radiation source capable of providing a predetermined type of radiation is used. The radiation may be in the form of a plurality of beams arrayed along at least one directional axis, and arranged in successive alignment to exhibit a directional component. The directional component is characterized by a frequency variance between successive beams in accordance with direction and disposed so radiation therefrom propagates within the search space. At least one radiation detector capable of detecting the radiation is provided, and is disposed to detect at least that type of radiation.
US07773202B2	Laser spot tracker and target identifier A laser spot tracker device comprising a laser tracker receiver using a quadrant detector incorporated into a pair of binoculars or optical telescope system with a crosshair or reticule. Directional information from the laser tracker receiver is displayed to an operator (JTAC) to allow the reticule to be manually steered on to the target illuminated by the laser, thus identifying the target to the spotter. The laser code may be pre-selected to track a particular designator, or, the tracker may read out the code or codes of laser spots within its field of view.
US07773201B1	Alignment of optical system components using an ADM beam through a null assembly A system for testing an optical surface includes a rangefinder configured to emit a light beam and a null assembly located between the rangefinder and the optical surface. The null assembly is configured to receive and to reflect the emitted light beam toward the optical surface. The light beam reflected from the null assembly is further reflected back from the optical surface toward the null assembly as a return light beam. The rangefinder is configured to measure a distance to the optical surface using the return light beam.
US07773198B2	Filtered device container assembly with shield for a reticle A device container assembly (30) for storing a reticle (26) includes a device container (246) and a shield assembly (250). The device container (246) encircles the reticle (26). Further, the device container (246) includes a fluid port (254) that allows for the flow of fluid (276) into and out of the device container (246). The shield assembly (250) is encircled by the device container (246). Further, the shield assembly (250) is positioned between the fluid port (254) and the reticle (26) when the reticle (26) is positioned within the device container (246). The shield assembly (250) can inhibit contaminants (278) near the fluid port (254) from being deposited on the reticle (26) and can maintain the integrity of the reticle (26).
US07773195B2	System and method to increase surface tension and contact angle in immersion lithography A system and method to allow organic fluids to be used in immersion lithographic systems. This is done by providing a showerhead portion of a liquid supply system that is partially coated or made from a TEFLON like material. The TEFLON like material reduces wetness effect, and thus increases containment, when using an organic immersion fluid in a space between the last optic and the substrate.
US07773192B2	Method for measuring a cell gap in a liquid crystal display A system for manufacturing liquid crystal displays is provided, which includes: a sealant-applying unit for depositing a sealant on one of the two panels having at least one liquid crystal cell area and a cell gap measuring pattern formed outside of the liquid crystal cell area; a liquid crystal depositing unit for depositing liquid crystal material on the liquid crystal cell area and the cell gap measuring pattern; a substrate-attaching unit for receiving the two panels from the sealant-applying unit or the liquid crystal depositing unit, then conjoining the panels in a vacuum state to complete the manufacture of a liquid crystal panel; and a the cell gap measuring unit for measuring a cell gap between the two panels by detecting the spread areas of liquid crystal material deposited on the cell gap measuring pattern.
US07773188B2	Liquid crystal display device and method of manufacturing the same An LCD device and a method of manufacturing the same are discussed. According to an embodiment, the method includes preparing first and second substrates; and spraying spacers on the first or second substrate through an ink-jet process, wherein the spacers including both positively charged spacers and negatively charged spacers are sprayed on the first or second substrate, thereby preventing the spots and the deterioration of luminance caused by the movement of spacers.
US07773187B2	Liquid crystal display device The present invention provides a liquid crystal display device which can enhance the accuracy in feeding back a common potential applied to common voltage supply lines. A display panel includes a common bus line electrically connected to common electrodes and formed annularly on a periphery of the display region, a common sensing line for feeding back a voltage of the common bus line to a control printed circuit board, a scanning-signal-drive-circuit-use power source line for supplying electricity for driving a scanning signal drive circuit, and a common-voltage-supply-use line for supplying a common voltage to the common bus line. The common-voltage-supply-use line, the common sensing line and the scanning-signal-drive-circuit-use power source line are formed along one side of the display panel to which at least the scanning signal drive circuit is connected. The common sensing line is formed between the common-voltage-supply-use line and the scanning-signal-drive-circuit-use power source line on one side of the display panel.
US07773177B2	Liquid crystal display device comprising a black matrix including carbon particles coated with an insulating material, metallic titanium particles, and a color pigment Disclosed is a black matrix for a liquid crystal display device (LCD) having an impedance about equal to or more than 105Ω, a specific resistance about equal to or more than 1011 Ωcm, and a relative dielectric constant about equal to or less than 20 at a driving frequency of about 1 kHz to 100 kHz. The black matrix as disclosed has dielectric properties that minimize parasitic capacitance between the black matrix and the circuitry of the LCD, thereby preventing a signal delay in charging pixel electrodes that degrades the LCD image.
US07773175B2	Display device and method of manufacturing the same A display device includes a substrate, a first color filter pixel and a second color filter pixel. The substrate includes a first pixel region and a second pixel region adjacent to the first pixel region for displaying an image. The first color filter pixel is formed in the first pixel region to change a white light into a colored light. The first color filter pixel includes a first color layer, and a second color layer on the first color layer. The second color filter pixel is formed in the second pixel region.
US07773171B2	Display apparatus and method of manufacturing the same A display apparatus includes a light providing unit generating light, a display unit displaying an image using the light generated by the light providing unit, a driving unit driving at least one of the light providing unit and the display unit, and a bottom chassis receiving the light providing unit, the bottom chassis having a driving unit receiving recess that receives the driving unit.
US07773169B2	Liquid crystal display and panel therefor A flat panel display having an improved picture quality is disclosed. In one embodiment, a first pixel electrode and a second pixel electrode are formed in each subpixel area. The electrodes enclose an open space (gap) such that their outer boundary has a substantially rectangular shape. The flat panel display may also include a capacitance electrode coupled to the second pixel electrode to form a coupling capacitor. In use, the coupling capacitor operates such that a magnitude of a voltage applied to the first pixel electrode is lower than an applied data voltage, and a magnitude of a voltage applied to the second pixel electrode is higher than an applied voltage. The different voltages operate such that a tilt direction of LC molecules disposed above the first pixel electrode differs from a tilt direction of LC molecules disposed above the second pixel electrode.
US07773167B2	Pixel structure comprising two first conductive regions, a second conductive region and two first channel regions, wherein the first transparent electrode is located between the reflective electrode and second transparent electrode A pixel structure disposed on a substrate and electrically connected to two scan lines and a data line is provided. The pixel structure includes a reflective electrode, a first transparent electrode, a second transparent electrode and a semiconductor layer. The first transparent electrode is electrically connected to the reflective electrode and is insulated from the second transparent electrode. The semiconductor layer has two first conductive regions, a second conductive region and two first channel regions, wherein the first conductive regions are respectively electrically connected to the reflective electrode and the second transparent electrode, the second conductive region is located between the first conductive regions and electrically connected to the data line, a part of the semiconductor layer overlapped with the scan lines is defined as first channel regions and each of the first channel regions is respectively electrically connected between the second conductive region and each first conductive region.
US07773165B2	Liquid crystal display The liquid crystal display includes a thin film transistor (TFT) panel including a pixel electrode in a rectangular shape having a transverse length longer than a longitudinal length, the pixel electrode including a first domain divider and having upper and lower half portions arranged symmetrically with respect to a transverse long axis passing through a center of the pixel electrode, a common electrode panel including a common electrode facing the pixel electrode, the common electrode including a second domain divider arranged parallel with the first domain divider, and a liquid crystal layer interposed between the TFT panel and the common electrode panel.
US07773164B2	Active device array substrate An active device array substrate including a substrate, a plurality of pixel units, a plurality of driving lines, a plurality of common lines, an electrostatic discharge (ESD) protection circuit, and a plurality of switch elements is provided. The substrate has a display region and a peripheral region adjacent to the display region. The pixel units are arranged as an array in the display region of the substrate. The driving lines are disposed in the display region and the peripheral region and are electrically connected to the pixel units. The common lines are disposed in the display region and are extended into the peripheral region. The ESD protection circuit is disposed in the peripheral region of the substrate. The switch elements are disposed in the peripheral region, wherein each of the switch elements is electrically connected between one of the common lines and the ESD protection circuit.
US07773160B2	Image display system and method An image display system comprises a first liquid crystal projector which projects a counterclockwise-rotating, circularly polarized light beam to form an image containing specific visual information on a screen and a second liquid crystal projector which projects a clockwise-rotating, circularly polarized light beam to form a white image on the same screen. When viewed with the naked eye, a combination of the two images projected on the screen appears totally white. A viewer wearing a dedicated viewing device equipped with an optical filter which allows counterclockwise-rotating, circularly polarized light to pass through can selectively see the image projected by the first liquid crystal projector.
US07773159B2	Switching system for signal monitoring and switch-back control Systems for switching a displayed signal for a display between a plurality of signals are disclosed. In one embodiment, the system includes a microcontroller; a chooser for choosing a primary signal from a plurality of program-variable signals at the microcontroller; a monitor tuner coupled to the microcontroller for tuning the primary signal during switching of the displayed signal from the primary signal to a secondary signal; a detector coupled to the monitor tuner and the microcontroller for detecting a predetermined condition in the primary signal; and a selector coupled to the microcontroller for switching the displayed signal from the secondary signal to the primary signal upon occurrence of the predetermined condition. A user can switch between signals such as television channels or other dedicated functions without the risk of missing a portion of the program material.
US07773157B2	Digital video signal processing apparatus and method for adaptive Y/C separation An adaptive digital video signal processing apparatus and method for Y/C separation. In the video signal processing apparatus, an adaptive 2D BPF carries out Y/C separation through comb filtering and bandpass filtering selected according to local characteristics of an image (e.g., based on the direction in which an edge in the image extends in vertical and horizontal directions. The adaptive 2D BPF performs 2D bandpass filtering in general case. The 2D BPF adaptively executes a series of selections of the various filtering operations in a continuous manner.
US07773146B2	Focus control apparatus and optical apparatus A focus control apparatus includes a signal generator for generating a first signal in accordance with a predetermined frequency component of an image signal obtained by photoelectrically converting an image of a subject formed by an image-taking optical system, a detector for detecting a second signal different from the first signal, and a controller for detecting a movement of the subject based on the second signal and for switching driving of the image-taking optical system based on the detection, wherein the controller controls driving of the image-taking optical system based on the first signal.
US07773137B2	Imaging apparatus, imaging element, and image processing method An imaging element includes a pixel group that has pixels arranged two dimensionally therein, each including a photoelectric converting unit. The pixel arrangement of the pixel group is m rows by n columns. In the pixel group, a pixel area of an arbitrary two rows by two columns respectively includes a red pixel, a green pixel, a blue pixel and a non-color pixel. A red color signal for a given red pixel is a signal value obtained from the pixel. A green signal for the red pixel is obtained by averaging the signal values of two green pixels adjacently on the right and the left of the pixel. A blue signal for the red pixel is obtained by averaging the signal values of four blue pixels adjacently on the upper-right, the upper-left, the lower-right, and the lower-left of the pixel.
US07773133B2	Camera apparatus and method for removing image noise Disclosed is a method of removing image noise of a camera having an illumination sensor. The method includes: grasping the noise response characteristics of the camera and storing mean signal-to-noise ratio values for respective illumination values in a low frequency region and a high frequency region; acquiring the present illumination value using the illumination sensor when photographing an image; reading mean signal-to-noise ratio values of the low frequency region and the high frequency region corresponding to the present illumination value from the stored mean signal-to-noise ratio values; and applying the read mean signal-to-noise values to filters for respective frequency regions, thereby filtering the signals of the photographed image.
US07773132B2	Image processing device and method, and video camera with zebra pattern features An image processing device utilizes a morphological filter such as an opening type morphological filter and a closing type morphological filter to remove a hole or a chunk in an over-luminance area of an image, thereby to display a zebra pattern masked on the over-luminance area more clearly, and accordingly a user can achieve a high quality image.
US07773131B2	Solid state image sensing device with level fluctuation suppression A level shifter (181) shifts a signal level of a noise signal produced from a pixel so that the signal level becomes close to a reference level, and then a level shifter (182) complements the noise signal whose level was shifted by the level shifter (181) by a signal level corresponding to the level shifted by the level shifter (181). After that, the differential amplifier (183) performs subtraction operation between the noise signal that has passed the level shifters (181, 182) and the image signal from the pixel, so as to output the image signal without noises.
US07773128B2	Imaging apparatus By connecting to or mounting a first storage medium that stores image data as a retrieval object (e.g. first memory card 121) and a second storage medium that stores a retrieve condition (e.g. non-volatile memory 111 or second memory card 122), an imaging apparatus 100 can store image data as a retrieval object and a retrieve condition on different storage medium. By replacing the first storage medium with a third storage medium, image retrieval can be executed for a plurality of storage medium using the same retrieve condition.
US07773122B2	Image pick-up module and method for assembling such an image pick-up module An image pick-up module, especially for an endoscope, comprises an electronic image sensor, a single-piece circuit board which is electrically bonded to the image sensor, with at least one cable leading away from the circuit board being further electrically bonded to the circuit board. The circuit board has at least three sections, with a first section and a second section extending in spaced relation one to the other and obliquely or crosswise to the image sensor and a third section being arranged between the first and the second section. In order to provide for strain relief of the at least one cable, it is proposed that the image sensor be arranged on one side of the circuit board opposite the third section. In a method for assembling the image pick-up module the circuit board initially has the form of a planar board blank comprising at least three sections that can be folded along flexible connecting sections whereby the at least one cable is bonded to the board blank, whereafter the board blank is folded in such a way that a third section is located between a first section and a second section, and finally the image sensor is bonded to the circuit board at an end of the circuit board opposite the third section.
US07773121B1	High-resolution, continuous field-of-view (FOV), non-rotating imaging system A high resolution CMOS imaging system especially suitable for use in a periscope head. The imaging system includes a sensor head for scene acquisition, and a control apparatus inclusive of distributed processors and software for device-control, data handling, and display. The sensor head encloses a combination of wide field-of-view CMOS imagers and narrow field-of-view CMOS imagers. Each bank of imagers is controlled by a dedicated processing module in order to handle information flow and image analysis of the outputs of the camera system. The imaging system also includes automated or manually controlled display system and software for providing an interactive graphical user interface (GUI) that displays a full 360-degree field of view and allows the user or automated ATR system to select regions for higher resolution inspection.
US07773120B2	Scan-assisted mobile telephone The present disclosure illustrates an apparatus and method for scanning, in particular documents with the aid of a camera. The method includes combining an image sequence or a sequence of partial images in order to obtain a final image, and projecting a reference model onto the camera vision field and in compensating representational differences of different images on the basis of geometrical information of the model.
US07773115B2	Method and system for deblurring digital camera images using reference image and motion estimation Deblur digital camera image captured in low-light, long-integration-time conditions by deconvolution based on motion estimation from preceding and following reference images. Alternatively, capture multiple short-integration-time images and fuse after motion estimation and alignment.
US07773110B2	Electronic endoscope apparatus An electronic endoscope apparatus comprises: a processor unit; and an electronic endoscope having a solid-state pickup element, the electronic endoscopes being capable of connecting to the processor unit, so as to generate digital picture signals, wherein the processor unit comprises a differential signal outputting portion that generates digital picture signals corresponding to a pixel number of the solid-state pickup element and corresponding to a display standard for an external computer, parallel-serially converts the digital picture signals, and outputs the converted signals as differential signals, and wherein the electronic endoscope apparatus further comprises a high-definition television system converter that detects the pixel number of the digital picture signals based on the differential signals, converts the digital picture signals to high-definition television signals based on the detected number of pixels and outputs the high-definition television signals, the high-definition television system converter being detachably connected to the differential signal outputting portion.
US07773107B2	Method for setting mute flags to improve compatibilities and the high definition multimedia interface system using the same method The present invention relates to an HDMI (High Definition Multimedia Interface) system, and more particularly, to a method for setting mute flag in connection with transmission of audio data and auxiliary data transmitted through HDMI system, and an HDMI system using the same method.
US07773104B2	Apparatus for driving a display and gamma voltage generation circuit thereof The present invention discloses an apparatus for driving a display in which each pixels of the display receives a driving voltage and a common voltage, and a luminance of each pixel is determined by a difference between the received driving voltage and the common voltage. The apparatus comprises a plurality of source driver chips, each of which receives a pixel value and generates the driving voltage corresponding to the pixel value according to a plurality of Gamma voltages, wherein at least one of the Gamma voltages is generated by one of the source driver chips.
US07773101B2	Fisheye lens graphical user interfaces In an implementation, an appearance of a lens is applied to an original image by a data processing system to produce a presentation for display on a display screen, the appearance of the lens having a focal region at least partially surrounded by a shoulder region. A data interaction mode is provided by the data processing system to interact with underlying data of the focal region if a cursor is positioned over the focal region in the presentation. A lens interaction mode is provided by the data processing system to adjust one or more parameters of the appearance of the lens if the cursor is positioned over the shoulder region in the presentation. The presentation is displayed on the display screen.
US07773099B2	Context aware image conversion method and playback system The embodiments of invention provide method and apparatus for converting one or more images for display on a display surface. The output image is obtained from an input image. We scale the input image to generate a foreground image, in which a content of the foreground image corresponds directly to a content of the input image, and in which a resolution of the foreground image when displayed is smaller than a resolution of a display surface. The input image is also transformed to a background image, in which a content of the background image depends indirectly on the input image, and in which a resolution of the background image is larger than the resolution of the foreground image. Next, the foreground image is combined with the background image to form the output image, in which pixels of the foreground image replace corresponding pixels of the background image.
US07773097B2	Visual emphasis for cognitive training exercises Computer-implemented method for enhancing cognition of a participant using visual emphasis. One or more scenes are provided and are available for visual presentation to the participant, each scene having a background and at least one foreground object. A scene is visually presented to the participant with a specified visual emphasis that enhances visual distinction of the at least one foreground object with respect to the background, where the foreground object(s) and/or the background are modified or selected to achieve the specified visual emphasis. The participant is required to respond to the scene, and a determination made as to whether the participant responded correctly. The visual emphasis may be modified based on whether or not the participant responded correctly a specified number of times. The presenting, requiring, and determining (and possibly the modifying) are repeated in an iterative manner to improve the participant's cognition.
US07773096B2	Alternative graphics pipe Various technologies and techniques are disclosed that improve the operation of accessibility applications. A graphics pipe is provided that can be called in user mode from multiple accessibility programs. A request is received from an accessibility application to access the graphics pipe, and a connection is established. The accessibility application listens to the graphics pipe for particular content of interest and builds a model based on that content. The model is used to deliver content to an end user appropriately. Screen captures can be performed on at least part of the content and then rendered onto another surface.
US07773090B1	Kernel mode graphics driver for dual-core computer system A kernel-mode graphics driver (e.g., a D3D driver running under Microsoft Windows) exploits the parallelism available in a dual-core computer system. When an application thread invokes the kernel-mode graphics driver, the driver creates a second (“auxiliary”) thread and binds the application thread to a first one of the processing cores. The auxiliary thread, which generates instructions to the graphics hardware, is bound to a second processing core. The application thread transmits each graphics-driver command to the auxiliary thread, which executes the command. The application thread and auxiliary thread can execute synchronously or asynchronously.
US07773088B2	Simultaneous simulation of markov chains using quasi-monte carlo techniques Methods, systems, apparatus and computer software/computer code products operable to enable computer graphics systems to simulate Markov chains (and thus trajectories of photons and the like) comprise simulating, and/or means for simulating, Markov chains using a quasi-Monte Carlo methodology, wherein the simulating of Markov chains comprises sorting states, and wherein the sorting comprises proximity sorting.
US07773087B2	Dynamically configuring and selecting multiple ray tracing intersection methods Embodiments of the invention provide methods and apparatus to determine a coordinate system to use when traversing rays through a portion of a spatial index corresponding to a dynamic object which has a unique object coordinate system. An image processing system may take into consideration a number of factors including, but not limited to, a distance form a viewpoint to the dynamic object, a distance from the origin of the world coordinate system to the object coordinate system, a rate of traversal of the dynamic object, and a number of primitives which make up the object. These factors alone or together may indicate whether it is more efficient to perform ray intersection tests in an object coordinate system or in a world coordinate system. Embodiments of the invention may update a spatial index according to the selected coordinate system.
US07773083B2	Active matrix display device and semiconductor device for timing control thereof An active matrix display device includes: a plurality of pixels that are disposed in a matrix; a plurality of image signal lines that are disposed to correspond to respective columns of the pixels; a plurality of scanning signal lines that are disposed to correspond to respective rows of the pixels; an image signal line driving unit that supplies image signals for driving the pixels to the image signal lines; and a timing control circuit that transmits an image display control signal to the image signal line driving unit with a predetermined cycle even during a vertical blanking period. The timing control circuit performs a control operation allows the image signal line driving unit to intermit a read operation of image display data during the first period that is defined within the vertical blanking period and that includes at least a second half of the vertical blanking period.
US07773067B2	Liquid crystal display with three-level scanning signal driving An exemplary thin film transistor liquid crystal display (TFT-LCD) (100) includes an LCD panel having a number n (where n is a natural number) of gate lines G1-Gn that are parallel to each other, a data driving circuit (120), and a gate driving circuit (110). The gate driving circuit sequentially providing 3-level scanning signals to scan the gate lines G1-Gn. Each 3-level scanning signal sequentially includes a gate-on voltage, a feed-through compensation voltage, and a gate-off voltage wherein the gate-on voltage starts to be provided to a (Gi+1)th (1≦i≦n−1) of the gate lines G1-Gn at the time when the feed-through compensation voltage starts to be provided to a (Gi)th of the gate lines G1-Gn.
US07773064B2	Liquid crystal display films The present invention relates to a display film that may be transferred by lamination or otherwise onto a substrate. The display film is formed of a stack of layers that can include different types, arrangements, and functionality within the stack depending upon factors including the characteristics of the substrate (e.g., upper or lower, transparent or opaque, substrates) and addressing of the display (e.g., active or passive matrix, electrical or optical addressing). The layers of the stacked display film include one or more electrode layers and one or more liquid crystal layers and, in addition, may include various combinations of an adhesive layer, preparation layer, casting layer, light absorbing layer, insulation layers, and protective layers. The liquid crystal layer can include cholesteric or other liquid crystal material. The liquid crystal layer can be a dispersion of liquid crystal in a polymer matrix formed by a variety of techniques. The display film may interact with components mounted on or laminated to the substrate, including a solar cell, active matrix backplane and electrodes. The display film may be mounted onto flexible or drapable substrates such as fabric and can itself be drapable. Thus, the invention offers substantial flexibility in fabrication and design that has not been previously possible in the display industry.
US07773062B2	Method and apparatus for uniformity compensation in an electroluminescent display A method of compensating uniformity of an EL device, having a plurality of light-emitting elements, including providing the EL display; and measuring the performance of one or more light-emitting elements at three or more different code values. At least two different groups of code values are formed from the three or more code values, while calculating a linear transformation for converting an input signal to a compensated signal from the performance measurements for each of the groups. Subsequently, the difference between the measured performance and compensated signal is calculated over the range of code values for each of the groups; while the linear transformation, having a preferred difference, is selected. Additionally an input signal is received and employed with the selected linear transformation to calculate a compensated signal to drive the EL display.
US07773060B2	Method, medium, and apparatus compensating for differences in persistence of display phosphors A method, medium, and apparatus compensating for differences in the persistence of phosphors in a display panel. The method of compensating for differences in persistence of phosphors in a display panel, having two or more light-emitting elements with different response characteristics, may include compensating for the response time of a first light-emitting element that represents the longest response time, selecting data response time for a second light-emitting element, which is different from the longest response time, and compensating for the differences in the persistence of phosphors due to a difference between the response times of the first light-emitting element and the second light-emitting element by compensating for the selected video data based on the compensated video data for the first light-emitting element.
US07773056B2	Pixel circuit and light emitting display A pixel circuit for a light emitting display. Adjacent pixels of the light emitting display coupled to one scan line share one first power supply line. A driving circuit in each pixel circuit drives first and second organic light emitting diodes (OLEDs). A switching circuit is coupled between the first and second OLEDs and the driving circuit to sequentially control the driving of the first and second OLEDs. Because two adjacent pixel circuits share one pixel power supply line and a plurality of OLEDs are coupled to one pixel circuit, it is possible to reduce the number of pixel circuits and the number of wiring lines of the light emitting display. Other circuit elements may also be shared between adjacent pixel circuits. Reducing the wiring and other elements of the pixel circuits makes it possible to increase the aperture ratio of the light emitting display.
US07773051B2	Display apparatus driving circuitry A display apparatus driving circuitry for driving a plasma display panel. A first transistor is electrically connected between an output terminal and a high-voltage power supply terminal. A second transistor is connected between the output terminal and a reference power supply terminal. A buffer circuit supplies a voltage lower than a low voltage VDL for logic to a gate of the second transistor to make a drop in an output waveform gradual during an address electrical discharge. In a preferred embodiment, during this drop in the output waveform, a p-channel type MOSFET of the buffer circuit is turned on, whereby the VDL is suppressed due to a back gate effect. Therefore, a signal at a potential lower than the VDL is inputted to the gate of the second transistor. As a result, the drop in the second transistor output waveform is gradual, so that noise and damage are prevented.
US07773050B2	Semiconductor device and plasma display device using the same To provide an AC-PDP capable of achieving low power consumption and low cost, a driving method is adopted in which, during a period of sustaining light emission of the AC-PDP, an electrode of one side of the panel is fixed at a predetermined potential, and positive and negative voltages are alternately applied to an electrode of the other side of the panel. In addition, an IGBT is used as a switch element. Thus, with a half-bridge driving method using an IGBT as a switch element, it is possible to simultaneously achieve a reduction in loss of a driving circuit of the AC-PDP and a reduction in the number of components thereof, such reductions not being able to be achieved by the conventional techniques.
US07773040B2	Dual-band F-slot patch antenna A dual-band antenna includes a planar conductive layer comprising a conductive region and a central non-conductive region. The conductive region and the non-conductive region together define a pair of interconnected F-slot structures, and a loop strip structure coupled to and disposed around the F-slot patch slot antenna structures.
US07773038B2	Electronic devices with antenna sensors Electronic devices may be provided with sensors for determining the presence and position of extendable and removable antennas. The antennas may extend by rotating about an axis, by reciprocating along their length, or by flexing from a retracted position to an extended position. The electronic device may determine when a removable antenna is attached or detached using signals from the sensors. The electronic device may determine the extent to which an antenna has been extended using signals from the sensors. The electronic device may control the operation of a radio-frequency transceiver that is coupled to the antenna based on signals from the sensors. The electronic device may turn the transceiver off when the antenna is retracted or removed. When the antenna is partially extended, the electronic device may place the transceiver in a low-power mode or place a dual-band transceiver into a single-band mode.
US07773035B2	Microstrip antenna and high frequency sensor using microstrip antenna A microstrip antenna has feed element 102 and parasitic elements 104, 106 on the front surface of substrate 1. Microwave electrical power is applied to feed element 102. Parasitic elements 104, 106 are connected via through hole type leads passing through substrate 1, to switches upon the rear surface of substrate 1, respectively. By actuating the switches individually, parasitic elements 104, 106 are individually switched between a grounded state and a float state. The direction of the radio beam emitted from the microstrip antenna is varied by selecting which of parasitic elements 104, 106 is grounded and floated. A microwave signal source connects to feed element 102 via an feed line 108 very much shorter than the wavelength, accordingly the transmission losses being low and the efficiency being excellent.
US07773033B2	Multilayer metamaterial isolator A multilayer metamaterial isolator and method of fabricating the same. A first layer or surface of a multilayer dielectric substrate includes a first leg of a first resonator loop. A second layer or surface of the multilayer dielectric substrate includes a second leg of the first resonator loop. A third leg of the first resonator loop extends through the multilayer dielectric substrate interconnecting the first and second legs of the first resonator loop.
US07773031B2	Signal acquisition and method for ultra-wideband (UWB) radar An acquisition channel (20) includes a UWB sampler block (21) coupled to an analog integration block (22) further coupled to a digital integration block (24) via an analog/digital converter (23). For each range cell the UWB sampler block (21) repeatedly samples the received signal by tuning the sampling instants to the range cells to be acquired. The acquisition channel (20) is further coupled to a processor (26) and a database (25).
US07773030B2	Method and system for antenna training and communication protocol for multi-beamforming communication A method and system for antenna training for communication of multiple parallel data streams between multiple-input multiple-output communication stations is provided. An implementation involves performing antenna training by obtaining optimal antenna training coefficients by multi-stage iteration in estimating the multi-dimensional beamforming coefficients.
US07773029B1	System and method for filtering clutter A system and method for filtering clutter is contemplated that in one aspect performs clutter-filtering on complex-voltages. In one aspect, spectral coefficients identified from a series of spectral coefficients as having been affected by clutter are replaced by a refilling procedure to maintain the statistical properties of the spectral coefficients that are unaffected by clutter. Dual-polarization radar variables that have phase dependence can be subsequently generated from the modified spectral data.
US07773028B2	Method and system for concatenation of radar pulses A system and method are described for generating waveforms for use in radar and sonar systems. The system includes waveform generation circuitry a waveform generator and an up-conversion module. The waveform generator generates concatenated pulse waveforms at an IF band. In a given pulse repetition interval (PRI), the concatenated pulse waveforms comprise a first and second pulse types associated with first and second IF frequencies respectively. The up-conversion module up-converts the concatenated pulse waveforms to an RF band to form first and second sets of pulses. In the given PRI, each pulse is up-converted to a different RF frequency, pulses of different lengths are associated with a similar carrier frequency, and at least one pulse from each of the sets of pulses implements frequency diversity.
US07773025B2	Remote circuit interaction A method and system for remotely affecting electronics within a conductive enclosure are disclosed. The method can comprise transmitting electromagnetic radiation of two different frequencies to the enclosure. The two different frequencies can be selected such that they penetrate the enclosure and therein form electromagnetic radiation of a third frequency that resonates within the enclosure. The third frequency can interact with the electronics, such as to disrupt operation thereof.
US07773024B2	SAR analog-to-digital converter with large input range A method for analog-to-digital conversion is provided using successive approximation and a plurality of capacitors including a first set of capacitors and a second set of capacitors, a first side of each of the plurality of capacitors being coupled to a common node. The method includes sampling an input voltage on the first set of capacitors, after the step of sampling leaving a side of at least one capacitor of the first set of capacitors floating, coupling a capacitor of the first set of capacitors, which is not floating, with a capacitor of the second set of capacitors so as to redistribute the charge on the coupled capacitors, comparing the voltage on the common node with a comparator reference voltage level to receive a comparison result to be used for a bit decision, and switching the floating side of the floating capacitor of the first set of capacitors to either a first reference voltage or a second reference voltage in accordance with the bit decision.
US07773017B1	Transmitter digital-to-analog converter with noise shaping A noise shaping module includes a first addition module that receives an N-bit digital input signal, where N is an integer greater than one. A first filter module generates a first filtered output signal based on an output signal of the first addition module. A truncation module generates an M-bit truncated output signal based on the first filtered output signal, where M is an integer less than N. A second filter module generates a second filtered output signal based on the M-bit truncated output signal. The second filtered output signal is an input to the first addition module.
US07773003B1	Huffman search algorithm for AAC decoder A method for decoding an input bit stream encoded using Huffman encoding generates a lookup table using a standard Huffman code book. Thereafter, at least three bits are extracted from the input bit stream. The at least three bits extracted are used to traverse the lookup table. Subsequently, a data set corresponding to a Huffman code word is accessed, thereby decoding the input bit stream.
US07773000B1	Efficient coding of integers in non-power-of-two ranges Coding efficiently in non-power-of-two ranges. Coding is performed in an N-bit system, where certain codes are represented with N bits and other codes are represented with (N+1) bits. An example is where the other codes may have an N-bit representation used to represent multiple values, with the additional bit being disambiguation information provided to distinguish the codes having multiple values. Thus, N bits are used to represent most codes, and an extra bit is used to represent other codes. The number of bits per element used for representing a sequence is, on average, close to a theoretical minimum for N-bits.
US07772998B2	Method and apparatus for encoding/decoding metadata Provided are a meta data encoding/decoding method and apparatus. The meta data decoding method includes decoding a media signal containing a media object, and decoding meta data corresponding to the media object. During the decoding of the meta data signal, decoding of the meta data is skipped when the meta data that is to be decoded is identical to already decoded meta data.
US07772996B2	Alert and warning system and method The present inventions provide a system and method for providing a warning using at least one wireless communication link between an approaching object and the location where a warning is to be given based in part on the location of the object and its proximity to the warning location. One aspect of the inventions includes receiving a communication from an object, for example a vehicle, which includes location information, at an alert node, wirelessly communicating alert information to a warning node, and causing a warning device to generate a warning. Preferably the alert node communicates with a plurality of vehicles and a plurality of warning nodes and determines to which of the plurality of warning nodes to communicate alert information based in part on the location information received from at least one of the vehicles and the location of the warning device.
US07772995B2	Display system for aircraft A display system for an aircraft includes a device for controlling the presentation on a head-down screen of primary piloting information during a detected display defect on a head-up display device, which normally displays such primary piloting information.
US07772992B2	Method and device for assisting the ground navigation of an aeroplane in an airport The invention relates to a device (1) comprising a set (2) of information sources for determining the active values of a plurality of parameter of an aeroplane, calculating means (3) for determining, by means of said active values, a first position corresponding to a position which is extrapolated from the nose of the aeroplane following a particular time interval from the current instant. The inventive device also comprises a database (5) provided with at least one pre-determined unauthorized zone of the airport, comparison means (6) for comparing said first position to said pre-determined unauthorized zone of the airport, and warning means (9) for emitting at least one warning signal if the first position is located in the unauthorized zone.
US07772991B2	Accident avoidance during vehicle backup In one embodiment, the present invention is directed to a method to operate a host vehicle having a rearview camera vision sensor, and an electronic controller with memory. The method comprises the steps of determining whether the host vehicle is in reverse gear, activating a rearview camera vision sensor on said host vehicle to detect objects, determining host vehicle motion and path of travel, simultaneously determining an inter-frame difference metric and a histogram difference metric of the field of view of said rearview camera, determining a dynamic scene change, determining a collision threat assessment based upon said dynamic scene change, and activating warnings and collision avoidance moves.
US07772990B2	Signal monitor with programmable non-critical alarm A signal monitor includes an alarm function module configured to compare a plurality of input signals associated with traffic control to a set of programmable criteria associated with predetermined events, and to produce a non-critical alarm signal when at least one of the set of programmable criteria is satisfied. This non-critical alarm signal—which is associated with programmable alarm conditions that do not require that the intersection enter the “flash” mode—is communicated to the controller, which may then log and/or transmit the non-critical alarm condition to a central station or maintenance point.
US07772988B1	LED light assembly with predetermined distribution pattern and built-in retroreflector An apparatus and method for producing specified output intensity distribution requirements from a single LED source, wherein the apparatus includes a single LED source and a cover, including a lens, that captures and controls the non-collimated light of the LED source and limits its spread vertically and horizontally as well as producing intensity variations within the output pattern. In one aspect of the invention, the lens is on the same order of size as the LED source, the cover has an exposed surface area several times larger than the area of the lens and is primarily configured to have retroreflective properties.
US07772987B2	Lighting control framework A lighting control framework is provided. The lighting control framework receives an implicit request from an application. The implicit request is converted into a converted explicit request which is processed to utilize a light of a lighting device.
US07772986B2	Verbal warning systems and other audible warning systems for use with various types of devices, containers, products and other things Verbal warning labels and other audible warning systems for use with different devices, containers, products and other things in various environments are disclosed herein. An audible warning system configured in accordance with an embodiment of the invention includes a device having a standardized textual warning associated therewith, and a sound playback system operably coupled to the device. The sound playback device can be configured to audibly output a verbal warning corresponding to the textual warning. The verbal warning can be provided by at least one of a manufacturer, supplier, distributor or retail vendor of the device, and the verbal warning can supplement or replace the standardized textual warning.
US07772983B2	Apparatus for tracking carcasses An apparatus and method for identifying a carcass during meat production. In one embodiment, the apparatus includes a band sized to fit around a limb of the carcass and a readable identification tag affixed to the band for remote identification of the carcass. In another embodiment, the apparatus includes a block adapted to couple to a trolley carrying the carcass and a readable identification tag coupled to or embedded in the block. The readable identification tag may be used to read and write information relating to the carcass to a database.
US07772979B2	Ear tag element and methods for producing an ear tag element The invention relates to an ear tag element for tagging animals and to methods for producing it. The ear tag element according to the invention comprises a body (1) and a transponder (4) which is embedded in the said body, the transponder having a chip and an antenna which are connected to one another, and the body of the ear tag element comprising a rigid part (2), a flexible part (3) and a boundary surface (6) between them. The oar tag element according to the invention is characterized by the fact that at least the antenna of the transponder lies in the boundary surface, in such a manner that the antenna on at least one side bears against the rigid part and on at least one other side bears against the flexible part of the body.
US07772977B2	Intermodulation mitigation technique in an RFID system When multiple readers for RF transponders have to be placed in close proximity, such as in adjacent lanes of a highway toll barrier, they can be set to operate at different frequencies. When signals from two adjacent ones of the readers interfere, the resulting signal includes interference terms whose frequencies equal the sum of the reader frequencies and the difference between the reader frequencies. To remove such interference terms while passing the desired terms, a tag includes a low-pass or other frequency-selective filter.
US07772971B1	Method for the proactive verification of alarm signals from the protected premise location Apparatus for alarm data communication with a central alarm-monitoring station having a central station receiver linked to a communications medium involves a remote, premise-protecting alarm system. It has a central processing unit (CPU), at least one sensor reporting to the CPU, an interface for communications with the central station receiver across the communications medium, and at least one user interface for a user to enter inputs to the CPU. The alarm system furthermore has a pro-active verify utility configured to allow a user, after the alarm system has automatically propagated a message to the central station receiver comprising a report of an exception sensed by the sensor, to enter an input through the user interface that causes the alarm system to propagate a later message comprising the user's verification. Preferably the user interface is a keypad, and the pro-active verify utility is actuated by minimal key strokes.
US07772970B2	Vehicle display device The present invention provides a vehicle display device which can display fuel consumption information of a vehicle in a useful and optimum mode for a driver. A meter_EUC calculates an instantaneous fuel consumption of a vehicle based on a mileage and a fuel injection quantity within a set time, calculates an average fuel consumption of the vehicle based on respective cumulative values of the mileage and the fuel injection quantity repeatedly calculated for every set time, and displays the deviation of the instantaneous fuel consumption with respect to the average fuel consumption as fuel consumption information on a fuel consumption meter. The display on the fuel consumption meter is performed by swinging a pointer with respect to a neutral position. When the deviation takes a positive value, the pointer is swung in the pulse direction with a swinging width corresponding to the deviation quantity, while when the deviation takes a negative value, the pointer is swung in the minus direction with a swinging width corresponding to the deviation quantity.
US07772966B2	Vehicle rearview mirror assembly incorporating a communication system A vehicle communication and control system is provided that may be more readily installed in a vehicle and that utilizes minimal additional wiring. According to some of the disclosed embodiments, the electrical components of the “brick” of a communication and control system are integrated into a rearview mirror assembly. Preferably, the microwave antenna for the GPS and the cellular telephone antenna are also integrated into the rearview mirror assembly. Various functions and features of the system are also disclosed.
US07772960B2	Pre-loaded force sensing resistor and method A force sensing resistor (FSR) includes a substrate having separated electrically conductive traces and another substrate having a resistive layer in which the substrates are subjected to a biasing force such that the substrates contact one another with the resistive layer electrically connecting the traces with a resistance inversely dependent on the biasing force. Upon an external force applied towards a substrate, the substrates contact one another with a total force which is the sum of the forces with the resistive layer electrically connecting the traces with a resistance inversely dependent on the total force. An FSR output which is a function of the resistance is measured. Whether a change in magnitude of the FSR output during a time interval is greater than a threshold is determined. A touch applied on the FSR is detected during the time interval if the change is greater than the threshold.
US07772959B2	Fuse seat having light-emitting module of hidden type A fuse seat having light-emitting module includes an insulating body, two electricity-conducting pieces and a light-emitting module. The insulating body is arranged with an accommodating space, in which two electricity-conducting pieces are fixed respectively. A fuse is plugged into the accommodating space and connected conductively to the electricity-conducting pieces. The light-emitting module is hidden in the insulating body and is connected electrically to the electricity-conducting pieces, thus a cost-saving effect is thereby achieved.
US07772935B2	Oscillator voltage source circuits A power source circuit for an oscillator is provided comprising a multiplexer, a plurality of transmission gates, a plurality of resistors, a current source circuit, and an output circuit. The multiplexer inputs a digital signal and outputs one or more control signals. The transmission gates is individually coupled to the multiplexer and receives the one or more control signals, wherein each of the plurality of transmission gates are turned on or off according to the one or more control signals. The plurality of resistors is coupled in series and individually coupled to the plurality of transmission gates. The current source circuit is coupled to the plurality of resistors and provides a current source. The output circuit is coupled to the current source and provides output power for the oscillator according to the current source and the operation of the transmission gates.
US07772933B1	Multiple band oscillator system In one embodiment, a multiple band oscillator system is disclosed which comprises a first oscillator having a first input, a resonating element, a first output, and a second output. In addition, the multiple band oscillator system also comprises a second oscillator having a second input, a third output, and a fourth output. The first oscillator has a first oscillator frequency and the second oscillator has a and second oscillator frequency. The multiple band oscillator system also contains a tuning capacitive element coupled to the first and second oscillators for determining the second oscillator frequency, and the first oscillator and the second oscillators are both capable of operating the resonating element.
US07772932B1	Quadrature local oscillator generation for direct conversion radio transceiver A method of generating a quadrature local oscillator (LO) frequencies is provided. In this method, a voltage-controlled oscillator (VCO) frequency can be mixed with a divided version of the VCO frequency to generate mixed signals. A lower sideband of the mixed signals can be selected for the quadrature LO frequencies to minimize the occurrence of spurs. Notably, the divided version is 1/N of the VCO frequency and the VCO frequency is a radio frequency (RF) channel frequency times a ratio N/(N−1).
US07772930B2	Calibration techniques for phase-locked loop bandwidth Various embodiments are disclosed relating to calibration techniques for a phase-locked loop (PLL) bandwidth. According to an example embodiment, a calibration technique may include calibrating a voltage-controlled oscillator (VCO) of a phase-locked loop (PLL) circuit, and calibrating a bandwidth of the PLL circuit based on the calibrating the VCO.
US07772928B2	Arrangement for phase synchronization according to the master/slave principle An apparatus for the phase synchronization of several devices, wherein one device is the master device and the other devices are slave devices, with a phase synchronization unit for every device, each of which has: a first controlled oscillator for producing a master reference signal, a first phase detector which, in order to control the first oscillator, compares the phase of a first comparison signal derived from the master reference signal with the phase of a second comparison signal derived from an auxiliary reference signal if the device is itself the master device and a second phase detector which, in order to control the first oscillator, compares the phase of a third comparison signal derived from the master reference signal with the phase of a reference signal coming from the phase synchronization unit of the master device if the device is not itself the master device but a slave device.
US07772926B2	Setting the DC operating current of a rail-to-rail output stage of an op-amp In an output stage of an operational amplifier, first and second transistors each provide a collector current under quiescent conditions to first and second current sources. A resistor receives a portion of one the collector currents and produces a resistor voltage in response. An output transistor provides a quiescent current having a value calculated as a function of the resistor voltage and a base-emitter voltage of the second transistor.
US07772924B2	Apparatus and method for controlling a common-mode voltage of switching amplifiers An H-bridge controller and a method for controlling a common-mode voltage and/or current of an H-bridge circuit are disclosed. In one embodiment, an H-bridge controller includes a section for receiving a signal indicating at least one of a common-mode voltage or common-mode current of the H-bridge circuit, and a section for generating control signals which determine switching of the H-bridge circuit so as to control at least one of the common-mode voltage or common-mode current of the H-bridge circuit. In another embodiment, a method for controlling a common-mode voltage and/or current of an H-bridge circuit includes receiving a signal indicating at least one of a common-mode voltage or common-mode current of the H-bridge circuit; and generating control signals which determine switching of the H-bridge circuit so as to control at least one of the common-mode voltage or common-mode current of the H-bridge circuit.
US07772923B2	Test circuit for programmable gain amplifier A test circuit, for checking whether at least one programmable gain amplifier (PGA) operates correctly, includes a signal generator, a gain controller, a test level output circuit, a comparison circuit and an identifying circuit. The signal generator is utilized for outputting a test input signal to a PGA to generate a test output signal. The gain controller is utilized for outputting a gain control signal to the PGA to adjust a gain of the PGA. The test level output circuit is utilized for referring to the test output signal to output a first test level and a second test level. The comparison circuit is utilized for comparing the first and second test levels to generate a result signal. The identifying circuit is utilized for identifying whether the PGA operates correctly according to the result signal.
US07772919B2	Double stage compact charge pump circuit A charge pump circuit comprising a plurality of charge pumps connected in parallel, each charge pump receiving a plurality of clock signals, having an output (VCP) that is coupled to the output of the at least one other charge pump, and further comprising a first capacitor that is being charged by a switching circuit receiving the clock signals to charge the first capacitor, a second capacitor coupled in series with the first capacitor, the second capacitor provided between a first terminal (IN) of the charge pump and a second terminal (OUT) of the charge pump, wherein the first terminal (IN) of the charge pump is connected to a second terminal (OUT) of another charge pump and the second terminal (OUT) of the charge pump is connected to the first terminal (IN) of another charge pump.
US07772911B2	Timing control circuit and semiconductor storage device Disclosed is a timing control circuit that receives a first clock having a period T1, a group of second clocks of L different phases spaced apart from each other at substantially equal intervals and selection signals m, n supplied thereto and generates a fine timing signal delayed from the rising edge of the first clock signal by a delay td of approximately td=m·T1+n·(T2/L). The timing control circuit includes a coarse delay circuit and a fine delay circuit. The coarse delay circuit includes a counter for counting a rising edge of the first clock signal after an activate signal is activated and generates a coarse timing signal whose amount of delay from the first clock signal is approximately m·T1. The fine delay circuit comprises L-number of multiphase clock control delay circuits disposed in parallel, delays by n·T2/L the timing of sampling of the coarse timing signal by respective clocks of the group of L-phase second clocks, and takes the OR among the resulting delayed pulses to thereby produce the fine timing signal.
US07772908B2	Voltage and temperature compensation delay system and method A delay circuit provides a voltage and temperature compensated delayed output signal. The delay circuit includes a first delay stage that receives an input signal, and generates a delayed output signal from the input signal. The delay circuit also includes a second delay stage that receives the delayed output signal of the first delay stage, and generates a delayed output signal from the output of the first delay stage. The first delay stage and the second delay stage are coupled a voltage supply. The magnitude of the delay of the second delayed signal is inversely proportional to the magnitude of the supply voltage to substantially the same degree that the delayed output signal of the first delay stage is proportional to the magnitude of the supply voltage.
US07772906B2	Low power flip flop through partially gated slave clock A system and method for reducing power consumption within a flip-flop circuit on a semiconductor chip. A gated input clock signal is received by a slave latch. The gated input clock is derived from an ungated input clock signal and a clock gating condition. The clock gating condition determines when an input data signal of the flip-flop and the stored internal state of the slave latch have the same logic value, such as only a logic low value. If they have the same value, toggling of the ungated input clock signal is not received by the slave latch, signal switching of internal nodes of the slave latch is reduced, and power consumption is reduced.
US07772905B2	Semiconductor integrated circuit apparatus It is made possible to provide a flip-flop circuit capable of implementing the error correction function with a small area increase as far as possible and a pipeline system using such a flip-flop circuit. A flip-flop circuit includes: a flip-flop configured to operate based on a rising edge or a falling edge of a first clock signal; a decision circuit configured to compare an input of the flip-flop with an output thereof and output a request signal when the input of the flip-flop is different from the output thereof; and a control circuit configured to receive a second clock signal from outside and generate the first clock signal and a confirmation signal. When the request signal is sent from the decision circuit after the flip-flop has been activated, the control circuit inverts the first clock signal, sends the confirmation to the decision circuit, and makes the decision circuit cancel the request signal.
US07772898B2	Phase interpolator with adaptive delay adjustment The phase interpolator includes two adjustable delays 30 and 31, phase comparator 32 which detects a phase difference between a signal delayed by the adjustable delay 30 and a signal delayed by the adjustable delay 31, an integrator 33 which integrates the outputs of the phase comparator 32 and multipliers 34-1 and 34-2 which set a control voltage for the adjustable delays 30 and 31. The feedback loop comprising phase comparator 32 and integrator 33 controls a delay amount of the adjustable delay 30 thereby securing a phase relation between {ACK1, ACK2} and ICK to achieve a stable ICK phase.
US07772894B2	Method for providing a power on reset signal with a quadratic current compared to an exponential current Aspects of the present invention include a method, apparatus and device for generating a power on reset (POR) signal in relation to the crossing point of two currents wherein at least one current is a quadratic function and the other is an exponential function, where each has a mathematical correlation to a function of a predetermined power supply voltage.
US07772893B2	Digital frequency synthesizer and method thereof A digital frequency synthesizer and a method thereof are provided. In the digital frequency synthesizer, a plurality of multiphase signals (MPSs) is generated by a phase delay locked loop array, and a transition reference values is generated by a programmable transition value generator. An operation result obtained according to an input signal and an accumulated value is compared with the transition reference values to generate a phase selection control signal. A phase signal is selected among the MPSs according to the phase selection control signal. After that, a sampling control is performed to the selected phase signal to generate a synthetic signal. The digital frequency synthesizer and the method thereof are flexible and are easy to produce tiny analytic phase, thus, not only fine tuning phases is added but also the resolution of the synthetic signal is improved.
US07772892B2	Differential hybrid circuit A main driver amplifier generates first differential signals (Vdp/Vdn) based on pattern data (PAT). A replica driver amplifier generates second differential signals (Vcp/Vcn) based on the pattern data (PAT). Two subtractors generate electric potential difference signals (HP=RP−Vep) and (HN=RN−Ven), respectively. Two sample hold circuits sample the electric potential difference signals (HP and HN), and hold them thereafter, respectively. A comparison unit compares a differential amplitude signal (DA=HHP−HHN) with a predetermined threshold value (VOH). A latch circuit latches an output from the comparison unit. Sampling timings of the two sample hold circuits and a latch timing of the latch circuit, can be adjusted independently.
US07772891B1	Self-timed dynamic sense amplifier flop circuit apparatus and method Apparatuses and methods are provided for a self-timed dynamic sense amplifier flop circuit, wherein a pulse generating circuit may be adapted to generate at least a first logic signal based, at least in part, on a first evaluation node signal, and a discharge path circuit comprising at least a first transistor within a first stack of transistors may be operatively responsive to the first timing signal.
US07772890B2	Systems and methods for dynamic logic keeper optimization Various systems and methods for implementing dynamic logic are disclosed herein. For example, some embodiments of the present invention provide dynamic logic devices with a logic circuit that includes an inverting output buffer, a logic function, a bias transistor, and a current circuit. An input of the logic function is electrically coupled to a logic input, an output of the logic function is electrically coupled to an input of the inverting output buffer, and the logic function exhibits a leakage current. The gate of the bias transistor is electrically coupled to an output of the inverting buffer, and a first leg of the bias transistor is electrically coupled to the input of the inverting buffer. The current circuit supplies a current corresponding to the to a second leg of the bias transistor. In some cases, an improved performance may be achieved for a given leakage, or a reduced leakage may be achieved for a given performance.
US07772884B2	Capacitive coupling type level shift circuit of low power consumption and small size Provided is a level shift circuit. The level shift circuit includes an inverter including a first transistor having a first polarity to which an input signal from an input port is applied through a gate and a second transistor having a second polarity which is an opposite polarity to the first polarity, the second transistor being connected in series to the first transistor between a positive source voltage and a negative source voltage and a connection node between the first and second transistors being an output port, a capacitor connected between a gate of the first transistor and a gate of the second transistor, and a voltage adjusting means for accurately adjusting a voltage applied to the gate of the second transistor according to an exact switching operation time of the second transistor, using a clock signal and an output port signal of the inverter. A stable and high-speed operation can be performed with a comparatively small size and low power consumption can be achieved.
US07772880B2	Reprogrammable three dimensional intelligent system on a chip A high performance 3D semiconductor is described with cubic dimensional multi-node reprogrammable components for multi-functionality and intelligent behaviors. The system is modeled with dynamic EDA techniques. Applications of the intelligent SoC are specified, particularly embedded, multifunctional, DSP and high-performance computing applications.
US07772879B1	Logic module including versatile adder for FPGA A logic module for an FPGA includes a LUT formed from an N-level tree of 2:1 multiplexers. Each of the N inputs to the LUT is connected to the select inputs of the multiplexers in one level of the tree. Each of the data inputs at the leaves of the tree is driven by a configuration memory cell that produces either a logic 0 or a logic 1. The output of the single multiplexer at the last level of the tree forms a Y output and is coupled to one input of an XOR gate and to the select input of a two-input carry multiplexer. The 0 input of the carry multiplexer is coupled to a G input. A CI input is coupled to the other input of the XOR gate and to the 1 input of the carry multiplexer.
US07772876B2	Configurable on-die termination Described are systems that employ configurable on-die termination elements that allow users to select from two or more termination topologies. One topology is programmable to support rail-to-rail or half-supply termination. Another topology selectively includes fixed or variable filter elements, thereby allowing the termination characteristics to be tuned for different levels of speed performance and power consumption. Termination voltages and impedances might also be adjusted.
US07772869B2	Display device and method for testing the same A method of economically manufacturing display devices having a matrix of drivable pixels arranged in rows and columns arranged to be driven by IC drivers, including the steps of including a plurality of sensor signal lines in the display device that are selectively connectable to certain of the pixel rows, a plurality of sensor signal lines selectively connectable to certain of the pixel columns, transmitting test signals to test predetermined ones of the rows and columns of pixels, and connecting pixel driving circuits to those display devices exhibiting uniform pixel brightness in response to the test signals.
US07772868B2	Accurate capacitance measurement for ultra large scale integrated circuits Test structures and methods for measuring contact and via parasitic capacitance in an integrated circuit are provided. The accuracy of contact and via capacitance measurements are improved by eliminating not-to-be-measured capacitance from the measurement results. The capacitance is measured on a target test structure that has to-be-measured contact or via capacitance. Measurements are then repeated on a substantially similar reference test structure that is free of to-be-measured contact or via capacitances. By using the capacitance measurements of the two test structures, the to-be-measured contact and via capacitance can be calculated.
US07772867B2	Structures for testing and locating defects in integrated circuits A method for detecting defects during semiconductor device processing can include providing a substrate having a semiconductor comprising layer with electrically isolated application and test circuits are formed thereon, directing an electron current inducing beam to the test circuit; measuring a current between the first and the second contact pads in the test circuit; determining an electron beam induced current (EBIC); and identifying one or more defect locations in the test circuit based on the EBIC and a location of the electron beam corresponding to the EBIC. A test circuit can include a plurality of semiconductor devices connected in parallel, a first contact pad coupled to a first terminal of the semiconductor devices, and at least a second contact pad coupled to a substrate terminal associated with the semiconductor devices.
US07772866B2	Structure and method of mapping signal intensity to surface voltage for integrated circuit inspection Embodiments of the present invention provide a test structure for inspection of integrated circuits. The test structure may be fabricated on a semiconductor wafer together with one or more integrated circuits. The test structure may include a common reference point for voltage reference; a plurality of voltage dropping devices being connected to the common reference point; and a plurality of electron-collecting pads being connected, respectively, to a plurality of contact points of the plurality of voltage dropping devices. A brightness shown by the plurality of electron-collecting pads during an inspection of the integrated circuits may be associated with a pre-determined voltage.
US07772864B2	Contact probe with reduced voltage drop and heat generation A contact probe includes a plurality of probes, each of the probes including: an conductive tube; an conductive plunger, contained in at least one end side of the tube, and having a distal end part protruding outward from the tube in an axial direction of the tube; and a coil spring, contained in the tube, and adapted to elastically urge the plunger outward. The plural probes are arranged in a first direction in a socket comprised of insulating material. A cross section of the tube in a direction perpendicular to the axial direction of the tube has a greater size in a direction different from the first direction than a size in the first direction.
US07772863B2	Mechanical decoupling of a probe card assembly to improve thermal response A stiffener structure, a wiring substrate, and a frame having a major surface disposed in a stack can be part of a probe card assembly. The wiring substrate can be disposed between the frame and the stiffener structure, and probe substrates can be coupled to the frame by one or more non-adjustably fixed coupling mechanisms. Each of the probe substrates can have probes that are electrically connected through the probe card assembly to an electrical interface on the wiring substrate to a test controller. The non-adjustably fixed coupling mechanisms can be simultaneously stiff in a first direction perpendicular to the major surface and flexible in a second direction generally parallel to the major surface.
US07772859B2	Probe for testing semiconductor devices with features that increase stress tolerance A novel probe design is presented that increases a probe tolerance to stress fractures. The probe includes a base, a torsion element connected to the base, and a second element connected to the torsion element through a union angle. The union angle includes an interface between the torsion element and the second element, and the edge of the interface is shaped to diffuse stress. What is further-disclosed are three features that increase stress tolerance. These features include a various union angle interface edge shapes, pivot cutouts and buffers.
US07772857B2	System and method to determine the impedance of a disconnected electrical facility A signal injection unit injects a test signal at a main frequency between a reference point of an electric circuit and ground, where the electric circuit is connected with the facility and injects another test signal at a second main frequency between a reference point of the electric circuit and ground. A signal conversion unit measures first and second response voltages and first and second response currents in the electric circuit, where the response voltages and the response currents result from the test signals. A processing device determines impedances to ground of the facility from the response voltages and the response currents, analyses impedances to ground of the facility, where this analysing includes comparing each determined impedance to ground with a predetermined value, and determines a safety state of the disconnected electrical facility based on the analysed impedances to ground.
US07772855B2	Instrument for measuring concentration of particulates in fluid, measuring method, and measuring program There are disclosed an instrument for measuring the concentration of particulates in a fluid, which is capable of determining the concentration of the particulates in the fluid with high accuracy. The instrument for measuring the concentration of the particulates in the fluid includes particulate collecting means, temperature measuring means, flow rate measuring means, impedance measuring means, time measuring means, constant determining means for determining an impedance change per unit time-particulate concentration constant from temperature and flow rate, impedance change per unit time computing means for computing the change of an impedance per unit time, and particulate concentration determining means for determining the concentration of the particulates from the change of the impedance per unit time computed by the impedance change per unit time computing means.
US07772851B2	Battery float management The invention relates to a new VRLA battery float model. The model covers the steady state and transient float charge behavior of both positive and negative electrodes. Backup analysis verifies the internal polarization distribution for a conventional 2V-cell polarization behaviors can be identified without the need for a physical reference electrode. The estimated individual electrode polarization allows early detection of common failure modes like negative plate discharge as well as a reference for float voltage optimisation. Furthermore, the positive polarization relating to minimum grid corrosion may be correlated with the occurrence of the peak of a “Tafel” like resistance used by the model. The model encourages utilisation of low signal perturbation for testing a cell's state of health and state of charge conditions while at float.
US07772839B2	Eddy current magnetic crash sensor A magnetic field generated by at least one coil operatively associated with a first portion of a vehicle responsive to a first signal from a signal source causes an eddy current in at least one conductive element operatively associated with or at least a part of a second portion of the vehicle. In one aspect, a circuit operatively coupled to the at least one coil generates a second signal responsive to a self-impedance of the at least one coil, wherein the second signal is at least partially in-phase with the first signal. In another aspect, a magnetic sensor is responsive to an eddy current in the at least one conductive element. In yet another aspect, the at least one conductive element comprises a metal sheet, film or coating of paramagnetic or diamagnetic material that is relatively highly conductive.
US07772838B2	Methods and apparatus for vibration detection Apparatus for detecting vibration of an object adapted to rotate includes one or more vibration processors selected from: a direction-change processor adapted to detect changes in a direction of rotation of the object, a direction-agreement processor adapted to identify a direction of rotation of the object in at least two channels and identify an agreement or disagreement in direction of rotation identified by the at least two channels, a phase-overlap processor adapted to identify overlapping signal regions in signals associated with the rotation of the object, and a running mode processor adapted to identify an unresponsive output signal from at least one of the at least two channels. A method for detecting the vibration of the object includes generating at least one of a direction-change output signal with the direction-change processor, a direction-agreement output signal with the direction-agreement processor, a phase-overlap output signal with the phase-overlap processor, and a running-mode-vibration output signal with the running-mode processor, each indicative of the vibration the object.
US07772835B2	AMR array magnetic design for improved sensor flexibility and improved air gap performance An AMR array magnetic position sensing system for improved sensor flexibility and improved air gap performance is disclosed. A pair of magnets can be enclosed in a magnet carrier that moves along a path and located above an array of AMR position sensors. The magnets are generally magnetized through the length of the magnets, and the magnets are positioned in the carrier such that an angle between the magnets exists in a manner similar to an angle made by AMR runners on a surface of the AMR positions sensors to create magnetic flux lines thereof. The AMR position sensors come into contact with the uniform magnetic flux lines to sense a change in linear and angular position associated with the magnet carrier. The output signal generated by the AMR position sensors have less susceptibility to variations in air gap as the angles of the magnetic flux lines generated by the magnets do note change with respect to air gap variation.
US07772834B2	Handler and process for testing a semiconductor chips using the handler A test handler includes a loading unit including a loading picker and a loading ascending/descending unit, an unloading unit including an unloading picker and an unloading ascending/descending unit, and a chamber system. A passage site connects the loading unit and the chamber system, and also connects the chamber system and the unloading unit. The arrangement of the handler reduces the time for the loading and unloading processes by performing the loading and unloading processes on separate test trays located at separate loading and unloading positions.
US07772833B2	Flexible on chip testing circuit for I/O's characterization The present invention provides a flexible on-chip testing circuit and methodology for measuring I/O characterization of multiple I/O structures. The testing circuit includes a register bank, a central processing controller (CPC), a character slew module, a delay characterization module, and a character frequency module. The register bank stores multiple instructions, and measurement results. The CPC fetches the instructions from the register bank. The CPC includes various primary and secondary state machines for interpreting the fetched instructions for execution. Depending on the input instruction the CPC applies stimulus to the IUT and the output of the IUT is used by the Local characterization modules (CHARMODULE) to extract the desired characterization parameters such as the character slew module which measures a voltage rise/fall time either for a single voltage IUT or a multi-voltage IUT. The Test Methodology for STIOBISC consists of an automated ATE pattern generation from verification test benches and automated result processing by converting the ATE data logs into the final readable format, thereby considerably reducing the test setup and output processing time. The testing circuit can operate in multiple modes for selecting one of these modules.
US07772831B2	Systems and methods for testing packaged dies A main die and a stacked die are included in the same component package. A transmission gate (370) is implemented on the main die, and can be enabled to receive leakage current in a connection (318) between the main die and the stacked die, and to conduct the leakage current to a bonding pad (344) that is accessible external to the package. Thus, the connectivity between the main die and the stacked die can be tested after the dies are packaged. The transmission gate is disabled during high-speed testing and normal operation. The package can also include a multiplexer (364) that is enabled during high-speed testing to input and output test signals at the package level. A direction signal is used to indicate whether test signals are being input to or output from the main die.
US07772830B2	Test handler automatic contactor cleaner methods and surrogate cleaning device Methods and devices are disclosed for cleaning contactors equipped with contact pins such as pogo pins include steps which may be performed in concert with common semiconductor device testing processes using automatic test equipment and associated handlers. The preferred embodiments of the invention include method steps for mounting a surrogate cleaning device in a tester load board socket and applying the contact pins associated with automatic test equipment to the surrogate cleaning device for cleaning.
US07772827B2	Measuring device, in particular, a vectorial network analyzer with phase regulation A method for operating a measuring device, in particular, a vectorial network analyzer, which can be connected via at least two ports to a device under test, with excitation units assigned to each port, wherein each excitation unit provides a signal generator, with which the assigned port can be supplied with an excitation signal, provides the following procedural stages: a measurement at measuring positions of the actual phase offset between the excitation signals output at the ports; and a variation of the frequency of at least one of the two signal generators during a correction interval so that a specified set phase offset is achieved at reference positions between the excitation signals output at the ports.
US07772826B2	Detection of lightning A lightning detector for lightning detection and a lightning detection method, wherein the lightning detector uses at least two separate channels or frequency bands for lightning detection, and wherein the lightning detector is a mobile RF device provided with radio interfaces for at least two communication channels or frequency bands, whereby at least one of which is normally a telecom channel/frequency range and wherein these channels/ranges are used in lightning detection.
US07772824B2	Control method for adjusting leading edge blanking time in power converting system A control method for adjusting leading edge blanking time in a power converting system is disclosed. The control method includes: receiving a feedback signal relative to a load connected to an output terminal of the power converting system; determining the leading edge blanking time to be a first value if the feedback signal has a magnitude about a first voltage; and determining the leading edge blanking time to be a second value if the feedback signal has a magnitude about a second voltage, wherein the first value is smaller than the second value, and the first voltage is greater than the second voltage.
US07772812B2	System and method for providing a DC voltage source within a power meter A power meter for measuring power consumption and detecting the presence of an unsafe line condition is disclosed. The power meter has a service disconnect switch, which is interposed between load contacts and source contacts, the disconnect switch interrupts the flow of power from the source contacts to the load contacts when the disconnect switch is in an open position. The power meter also has a processor coupled to a two input signal processing circuit. The two input signal processing circuit receives a first and second voltage signal from the load contacts. The two input signal processing circuit converts the first and second voltage signal into a first and second voltage value. The processor computes the power consumption using the first and second voltage values in combination with current values. The processor uses the first or second voltage valuea to determine the presence of an unsafe line condition when either the first or second voltage value exceeds a first voltage threshold or the first or second voltage value is below a second voltage threshold when the service disconnect switch is in the open position.
US07772808B2	Voltage regulating system and voltage regulator A voltage regulating system includes a generator, a battery, a warning light, a starting switch, and a voltage regulator. The voltage regulator includes an exciting driver connected to an exciting winding of the generator so as to excite the exciting winding; a voltage built-up/current leakage protection unit connected to a battery and the exciting driver so as to receive a battery voltage and drive the exciting driver for building the output voltage of the generator, while the generator at low speed operation. The voltage regulator further includes an exciting cut-off driver connected to the exciting driver and the voltage built-up/current leakage protection unit so as to cut the exciting driver off in response to the output voltage of the generator built by the voltage built-up/current leakage protection unit.
US07772805B2	Charge/discharge protection circuit utilizing a charger connection recovery circuit that cycles a discharge control transistor on and off while a battery is over-discharged during charging A charge/discharge protection circuit that protects a secondary battery from overcharge, over-discharge, charge over-current, and discharge over-current is disclosed. The charge/discharge protection circuit includes an overcharge detection circuit, an over-discharge detection circuit, a charge over-current detection circuit, a discharge over-current detection circuit, a charge control FET that is turned off when overcharge is detected and when charge over-current is detected, a discharge control FET that is turned off when over-discharge is detected and when discharge over-current is detected, and a charger connection recovery circuit that controls on/off operations of the discharge control FET. When connection with a charger is established at a time over-discharge is detected and the discharge control FET is turned off, the discharge control FET is forcefully turned on after a first predetermined time elapses.
US07772804B2	Method and apparatus for determining the health of an energy storage system A method for testing the health of locomotive battery blocks includes coupling a load to a first and a second battery block, the first and second battery blocks are coupled in series, activating a contactor coupled between the first and second battery blocks and the load to channel electrical energy from the load to the first and second battery blocks, and determining a voltage of the first and second battery blocks to determine the health of the locomotive battery blocks. A portable battery block health tester and a locomotive including a battery block health tester are also described herein.
US07772795B2	Motor position signal processing apparatus A motor position signal processing apparatus electrically connected to a signal processor and an optical encoder of a motor control system includes a first switch, a second switch, a first signal integration amplifier, a first separator, a second signal integration amplifier, a second separator, a third signal integration amplifier, a third separator, a fourth separator and an inverter. An enable signal outputted by the signal processor is processed by the inverter to switch the operation to the first switch or the second switch. An incremental signal outputted by the optical encoder, a motor mechanical position and a reset correction signal are processed by the first, second and third signal integration amplifiers and transmitted to the signal processor for controlling the operation of a motor.
US07772792B2	Rotation control device To rotate a rotary body at a constant velocity, a swing control device of an electric rotary excavator controls rotation of the rotary body with a small first torque command value. By contrast, when operating a swing lever for acceleration, the rotation is controlled with a larger second torque command value. The first torque command value is generated based on a deviation between a velocity command value for an electric motor that rotates the rotary body and a measured velocity of the rotary body, and the second torque command value has a larger absolute value than the first torque command value and is obtained by adding a feed-forward torque command value to the first torque command value.
US07772789B2	Motor controller The motor controller drives an electric motor including a rotor as a field magnet and stator coils of U-phase, V-phase and W-phase. The motor controller includes an exploration voltage application unit for applying an exploration voltage to the stator coils of U-phase, V-phase and W-phase such that a voltage vector expressed by the voltage applied to the stator coils rotates in a predetermined cycle with maintaining a constant magnitude, an electric current detection unit for detecting an electric current flowing through the electric motor during the period in which the exploration voltage is applied by the exploration voltage application unit, and a rotor rotation angle estimation unit for estimating a rotation angle of the rotor based on a phase of the voltage vector when a magnitude of the electric current detected by the electric current detection unit takes a local maximum value.
US07772785B2	Parallel lighting system for surface light source discharge lamps Disclosed is a low-cost parallel lighting system for discharge lamps for a surface light source, which reduces nonuniform brightness and static noise, and fulfills a requirement that lamp currents of individual cold-cathode fluorescent lamps should be uniform and stabilized. In a surface light source system having multiple discharge lamps, there is a module which lights the discharge lamps in parallel and whose input terminal and electrodes on an opposite side to that side of the discharge lamps which is connected to the module are driven by voltage waveforms different in phase by 180 degrees from each other, wherein an input terminal of an opposite phase of the surface light source system is connected to an inverter circuit having outputs of opposite phases via a single shunt transformer in such a way as to cancel out magnetic fluxes generated by currents respectively flowing in windings of the shunt transformer, whereby the resonance frequency of the inverter circuit having outputs of opposite phases is matched to balance the outputs.
US07772782B2	Light emitting diode (LED) driving device A light emitting diode (LED) driving device includes a power factor correction (PFC) circuit, a bridge switch circuit, a resonant circuit, a transformer and a feedback circuit. The PFC circuit adjusts an output signal thereof based on a feedback signal. The bridge switch circuit transforms the output signal of the PFC circuit into a pulse signal. The resonant circuit resonates and outputs a sinusoidal signal to a primary-side of the transformer based on the pulse signal. The feedback circuit outputs the feedback signal to the PFC circuit in response to a primary-side current of the transformer. Therefore, an output current of the LED driving device is adjusted through modulating the feedback circuit.
US07772780B2	Lamp igniter module and transformer carrier Disclosed are a lamp igniter module and method of assembling a lamp igniter module. The lamp igniter module comprises a transformer carrier, a slide-in electrical connector, a pc board, and a housing. Assembly of the lamp igniter module is accomplished by initially inserting a transformer carrier assembly within the housing and subsequently installing a slide-in electrical connector which may or may not be attached to the pc board.
US07772778B2	Method for forming electrodes and/or black stripes for plasma display substrate To provide a method for forming electrodes and/or black stripes for a plasma display substrate, wherein display electrodes, bus electrodes and optionally black stripes for a plasma display panel are formed of the same material by the same dry step, whereby a clear image having reflection prevented, can be displayed on a PDP display device with a low load on the environment, at low costs, with low resistance, without erosion by a dielectric.A method for forming electrodes and/or black stripes for a plasma display substrate, which comprises applying a laser beam to a mask layer formed on a transparent substrate to form openings at areas corresponding to the respective patterns of display electrodes, bus electrodes and optionally black stripes, then continuously forming an antireflection layer to provide an antireflection effect over the entire surface and an electrode layer, and applying again a laser beam to peel off the mask layer and at the same time to remove an unnecessary thin film layer.
US07772772B2	Green phosphor and plasma display panel using the same There is disclosed a green phosphor that is adaptive for improving its driving voltage and brightness characteristic, and at the same time, improving its color purity. A green phosphor according to an embodiment of the present invention includes a mixed phosphor composed of a first class phosphor of Zn2SiO4:Mn, a second class phosphor of at least one of LaPO4:Tb, Y3Al3(BO3)4Tb, Y(Al, Ga)5012:Tb, YBO3:Tb, (Y, Gd)BO3:Tb, and a third class phosphor of at least one of BaAl12O19:Mn, BaAl14O23:Mn, Ba(Sr, Ma)AlO:Mn, and the mixing rate of the third class phosphor to the total weight of the mixed phosphor is 1˜25 wt %.
US07772768B2	Polarizer and flat panel display apparatus including the same A polarizer and a flat panel display apparatus including the polarizer are provided. The polarizer includes: a base; and a plurality of grids on the base, the plurality of grids including a first component and a second component, and having a thickness in a thickness direction of the polarizer. The first component includes a dielectric material and the second component includes a metal. The first component and the second component have a concentration gradient in the thickness direction, wherein a concentration of the first component in the grids increases along a thickness direction toward the external light incidence side, and a concentration of the second component in the grids increases along a thickness direction away from the external light incidence side.
US07772767B2	Display device A display device includes; first, second and third pixel electrodes, each of the first, the second and the third pixel electrodes comprising a first edge and a second edge longer than the first edge, a first, a second and a third electrode connected to the first, second and third pixel electrodes respectively, a fourth electrode opposing the first electrode with respect to a fifth electrode, a sixth electrode opposing the second electrode with respect to a seventh electrode, and an eighth electrode opposing the third electrode with respect to a ninth electrode, wherein each of the first, fourth and fifth electrodes include a first portion disposed between the first and second pixel electrode and a second portion disposed outside of a space between the first and second pixel electrode, and the second, the sixth and the seventh electrodes are disposed outside of a space between the second and third pixel electrode.
US07772765B2	Double-sided organic electroluminescent display having optical shutter and information terminal using the same A double-sided organic electroluminescent display is constructed with an optical shutter. The organic electroluminescent display which includes an image displaying part comprising a plurality of pixels to display an image corresponding to a data signal and a selection signal, an optical shutter provided on the image displaying part to transmit or block light in response to a control signal, and a driver circuit to supply the data and selection signals to the plurality of pixels and the control signal to the optical shutter, respectively is excellent in visual recognition.
US07772761B2	Organic electrophosphorescence device having interfacial layers Techniques are described for forming an organic light emitting diode device with improved device efficiency. Materials having at least one energy level that is similar to those of a phosphorescent light emitting material in the diode are incorporated into the device to directly inject holes or electrons to the light emitting material.
US07772753B2	Electrodeless lamp core assembly including coil bobbin and lamp envelope protector In an electrodeless lamp, at least one core assembly is coupled to a tubular lamp envelope. The core assembly includes a lamp envelope protector disposed over an outer surface of the lamp envelope, and a core member surrounding the lamp envelope at a core mounting location such that lamp envelope protector is disposed between the core member and the lamp envelope. The core assembly further includes a coil bobbin coupled to the core member, and a coil wounded around the coil bobbin.
US07772748B2	Composite for forming ferroelectric thin film, ferroelectric thin film, method of manufacturing ferroelectric thin film, and liquid-jet head Provided are a composite for forming a ferroelectric thin film which is a colloidal solution applicable to the MOD method and capable of maintaining excellent dispersion stability and preservation stability of an organometallic compound over a long term, a ferroelectric thin film, a method of manufacturing a ferroelectric thin film, and a liquid-jet head. A composite for forming a ferroelectric thin film, which is made of a colloidal solution applicable to the MOD method containing an organometallic compound including metal constituting a ferroelectric thin film, and contains water other than water of crystallization in the organometallic compound is used when forming a ferroelectric thin film in accordance with the MOD method.
US07772747B2	Process for producing a piezoelectric film, film forming apparatus, and piezoelectric film A piezoelectric film is formed on a substrate by a sputtering technique at a film formation temperature higher than a Curie temperature. An electric field is formed across the piezoelectric film in a direction heading from a surface side of the piezoelectric film toward the substrate side before a temperature of the piezoelectric film having been formed falls to a temperature lower than the Curie temperature, polarization processing being caused to begin by the formation of the electric field across the piezoelectric film. The temperature of the piezoelectric film is allowed to fall to a temperature lower than the Curie temperature in the state in which the electric field is being formed.
US07772745B2	MEMS device with low operation voltage, large contact pressure force, and large separation force, and portable communication terminal with the MEMS device It is made possible to provide a MEMS device that has a low operation voltage, a large contact pressure force, and a large separation force. A MEMS device includes: a substrate; a supporting unit that is provided on the substrate; a fixed electrode that is provided on the substrate; an actuator that includes a first electrode, a first piezoelectric film formed on the first electrode, and a second electrode formed on the first piezoelectric film, one end of the actuator being fixed onto the substrate with the supporting unit, the actuator extending in a direction connecting the supporting unit and the fixed electrode, the first electrode being located to face the fixed electrode; and a stopper unit that is located above a straight line connecting the supporting unit and the fixed electrode, and is located on the substrate so as to face the first electrode.
US07772742B2	Boundary acoustic wave device A boundary acoustic wave device includes a first medium, a second medium, a third medium, and a fourth medium that are laminated in that order and, an electrode including an IDT electrode disposed at an interface between the first medium and the second medium, the temperature coefficient of delay time TCD of a boundary acoustic wave has a positive value, the fourth medium or the second medium has a positive temperature coefficient of sound velocity TCV, the first medium has a negative temperature coefficient of sound velocity TCV, and the sound velocity of transverse wave of the third medium is set to be less than the sound velocity of transverse wave of the fourth medium and/or the second medium.
US07772737B1	Two conductor winding for an induction motor circuit An electrical induction motor has a main winding formed with two electrical conductors having different electrical resistivities. The motor includes a stator having a structure about which a winding is formed, and the winding includes a first electrical conductor having a first end and a second end, and a second electrical conductor having a first end and a second end, the first end of the first electrical conductor and the first end of the second electrical conductor being coupled together and the second end of the first electrical conductor and the second end of the second electrical conductor being coupled together to form a parallel circuit with the first electrical conductor and the second electrical conductor, and the second electrical conductor having an electrical resistivity that is greater than an electrical resistivity of the first electrical conductor. In one embodiment, the first electrical conductor is copper and the second electrical conductor is aluminum.
US07772736B2	Permanent magnet synchronous motor, rotor of the same, and compressor using the same The inventive self-initiated permanent magnet synchronous motor has a rotor that has two-pole permanent magnets, as well as magnetic substances in a peripheral direction between the magnetic poles of the permanent magnets. The present invention provides a high-efficiency, high-torque permanent magnet synchronous motor with an improved power factor, its rotor, and a compressor using the permanent magnet synchronous motor, without a reduction in the maximum torque and an increase in costs.
US07772735B2	Embedded magnet type rotating electric machine A plurality of magnets are arranged in accommodating holes each extending in a radial direction. A rotor core is provided with an extension portion in a circumferential direction extending further outward in the circumferential direction with respect to the magnet from at least one of a radially outer end and a radially inner end in the accommodating hole, and a radial regulating portion regulating a movement of the magnet in the radial direction. The radial regulating portion extends in the radial direction so as to correspond to a center in the circumferential direction of the accommodating hole. The dimension in the circumferential direction of a portion of the radial regulating portion that is brought into contact with the magnet is smaller than the dimension in the circumferential direction of the magnet. A cross-sectional area of the radial regulating portion as seen from the radial direction is small, in comparison with the case in which the radial regulating portion extends entirely in the axial direction of the rotor core. Accordingly, it is possible to reduce a leakage flux in a rotating electric machine.
US07772729B2	Selectively configurable electric motor A selectively configurable electric motor comprises a stator and a plurality of poles electrically coupled to the stator. The selectively configurable electric motor also includes an actuator separated from the poles by an air gap and configured to move relative to the stator in the presence of an electromagnetic field. The selectively configurable electric motor further includes a plurality of electric conductors, each of the plurality of electric conductors substantially wound around one of the plurality of poles. The selectively configurable electric motor also includes a power converter, at least a portion of which is coupled to the plurality of electric conductors, including a plurality of switching elements configured to selectively couple one or more of the plurality of electric conductors in a predetermined electrical configuration.
US07772728B2	Electric drive system for floor conveyances An electric, drive system for floor conveyances with one or more vehicle chassis (3; 10, 11) in active connection with one another allowing relative movement and with at least one electric, drive motor and/or an electric, steering motor, with an electric transverter associated with each of these and an electronic, control system. At least one of these electric or electronic components is designed to be cooled by a liquid and is connected via an associated cooling circuit (5; 12) to at least one cooling device.
US07772723B1	Electrical panel having electrically isolated neutral stab An electrical panel is operable to receive electrical power from a first power supply and a second power supply. The electrical panel includes a neutral bus conductor having a stab configured to engage one or more switching devices and a separation formed in a bus conductor to electrically isolate one of the stabs.
US07772721B2	Method and apparatus for conserving energy stored in bypass capacitors during dynamic power collapse Energy stored in bypass capacitors in a portable device may be conserved when a power supply voltage is collapsed reducing the need to recharge the bypass capacitors and thereby saving power. A bypass charge saving circuit includes a bypass capacitor, a power source having an output supply voltage that is switchable, a load circuit of the portable device coupled to the output supply voltage, and the bypass capacitor operable to filter the output supply voltage. Also, a transistor switch is operable to decouple a discharge path of the bypass capacitor through the load circuit when the transistor switch is disabled. Further, a controller is operable to turn off the output supply voltage and the transistor switch in order to conserve energy stored in the bypass capacitor.
US07772720B2	Supercapacitor and charger for secondary power A secondary power source system, includes a first unit receiving a primary power input and restricting a current used for charging to a predetermined amount, a second unit including a device providing capacitance, receiving a first output from the first unit with restricted current, a third unit generating a second output of a certain voltage, and a fourth unit performing a logical OR operation with the primary power input, first output from the first unit and second output from the second unit, to generate a single third output of a certain voltage.
US07772719B2	Threshold voltage control circuit and internal voltage generation circuit having the same A threshold voltage control circuit includes a first voltage supplying unit for supplying a first power supply voltage, in response to an enable signal which is activated when a bank is enabled, as a back bias voltage of a first MOS transistor, wherein the first MOS transistor drives an internal voltage, and a second voltage supplying unit for supplying a second power supply voltage, in response to the enable signal, as the back bias voltage of the first MOS transistor.
US07772716B2	Distributed maximum power point tracking system, structure and process Distributed maximum power point tracking systems, structures, and processes are provided for power generation structures, such as for but not limited to a solar panel arrays. In an exemplary solar panel string structure, distributed maximum power point tracking (DMPPT) modules are provided, such as integrated into or retrofitted for each solar panel. The DMPPT modules provide panel level control for startup, operation, monitoring, and shutdown, and further provide flexible design and operation for strings of multiple panels. The strings are typically linked in parallel to a combiner box, and then toward and enhanced inverter module, which is typically connected to a power grid. Enhanced inverters are controllable either locally or remotely, wherein system status is readily determined, and operation of one or more sections of the system are readily controlled. The system provides increased operation time, and increased power production and efficiency, over a wide range of operating conditions.
US07772715B2	Power-station installation Power-generating units and compressor units are arranged in a compressed-air energy storage power station. According to one aspect of the invention, a common grid connection transformer is arranged, to which the power-generating units and the compressor units can selectively be connected. According to a further aspect of the invention, the power-station installation is subdivided into a power-generating area (I) in which the power-generating units are arranged, a switching and voltage-conversion area (II) in which a grid connection transformer is arranged, and a compressor area (III) in which the compressor units are arranged. The stated areas are arranged physically separately from one another. Power-station installations according to the invention can advantageously be combined to form modular power-station centers, which advantageously have common voltage rails and media rails.
US07772713B2	Method and system for controlling a wind turbine A control system for a wind turbine having a tower, a generator, and at least one rotor blade. The control system includes a sensor configured to measure an angle of inclination of the tower with respect to a surface, at least one pitch assembly configured to adjust a pitch angle of the rotor blade, and a controller configured to control at least one of the pitch assembly and the generator based on the measured angle of inclination.
US07772705B2	Low thermal resistance package Techniques for arranging ball grid arrays for producing low thermal resistance packages. One embodiment is for a ball grid array package that comprises a substrate, the substrate having a top surface and a bottom surface. A plurality of thermal balls are coupled to the bottom surface of the substrate, and at least one vias is positioned between every pair of the plurality of thermal balls. Other embodiments contemplate a ball grid array comprising thermal balls with a via located between every four thermal balls, wherein at least one vias is substituted for a thermal ball in the ball grid array.
US07772702B2	Dielectric spacers for metal interconnects and method to form the same Dielectric spacers for a plurality of metal interconnects and a method to form such dielectric spacers are described. In one embodiment, the dielectric spacers are adjacent to neighboring metal interconnects having flared profiles and are discontiguous from one another. In another embodiment, the dielectric spacers provide a region upon which un-landed vias may effectively land.
US07772696B2	IC package having IC-to-PCB interconnects on the top and bottom of the package substrate An integrated circuit package, according to one embodiment, includes a package substrate, an interface stratum and an integrated circuit die. Both the IC die and interface stratum are disposed on the package substrate. The integrated circuit die includes a microelectronic circuit having a plurality of inputs and outputs. A first set of the inputs and outputs are electrically coupled to a plurality of package-to-circuit connection regions on the package substrate. A second set of input and outputs are electrically coupled through the package substrate to package-to-circuit connection regions on the interface stratum.
US07772695B2	Semiconductor component of semiconductor chip size with flip-chip-like external contacts A semiconductor component and a method for its production in semiconductor chip size, can have a semiconductor chip, which has external contacts of the semiconductor component that are arranged in the manner of a flip-chip on its active upper side. The semiconductor chip can be encapsulated by a plastic compound at least on its rear side and its side edges. The outer contacts, which can be arranged on external contact connecting areas, can project from the active upper side.
US07772693B2	Panel, semiconductor device and method for the production thereof A panel has a baseplate with an upper first metallic layer and a multiplicity of a vertical semiconductor components. The vertical semiconductor components in each case have a first side with a first load electrode and a control electrode and an opposite second side with a second load electrode. The second side of the semiconductor components is in each case mounted on the metallic layer of the baseplate. The semiconductor components are arranged in such a way that edge sides of adjacent semiconductor components are separated from one another. A second metallic layer is arranged in separating regions between the semiconductor components.
US07772692B2	Semiconductor device with cooling member A semiconductor device comprises: a semiconductor element; a mounting substrate with the semiconductor element mounted thereon; a first high thermal conductivity member formed on a surface of the mounting substrate; and a first cooling member thermally connected to at least a part of the first high thermal conductivity member. The first high thermal conductivity member is thermally connected to the semiconductor element, and the first high thermal conductivity member has an outer edge which is located outside an outer edge of the semiconductor element.
US07772690B2	Insulating film An insulating film for semiconductor devices is obtained by curing, on a substrate, a high molecular compound obtained by polymerizing a cage-type silsesquioxane compound having two or more unsaturated groups as substituents and having a cyclic siloxane structure, wherein the structure of the cage-type silsesquioxane compound is not broken by curing, and the breakage of the cage structure can be detected by observing a peak at approximately 610 cm−1 in Raman spectrum of the film after curing.
US07772688B2	Electronic circuit unit The present invention relates to an electronic circuit unit having at least one semiconductor (15), that is situated on a substrate, and whose electrical connections are in electrical contact with printed circuit traces of the substrate, and having a housing, that accommodates the substrate, which has contact paths which are connected to the printed circuit traces of the substrate using electrical connections. It is provided that the electrical connections (20) each have a contact surface (17) situated on the substrate (12) which, when the substrate (12) and the housing (2) are joined together, comes to lie in an opposing position to the counter-contact surfaces (19) of the contact paths (21). The present invention also relates to a corresponding manufacturing method.
US07772686B2	Memory card fabricated using SiP/SMT hybrid technology A portable memory card formed from a multi-die assembly, and methods of fabricating same, are disclosed. One such multi-die assembly includes an LGA SiP semiconductor package and a leadframe-based SMT package both affixed to a PCB. The multi-die assembly thus formed may be encased within a standard lid to form a completed portable memory card, such as a standard SD™ card. Test pads on the LGA SiP package, used for testing operation of the package after it is fabricated, may also be used for physically and electrically coupling the LGA SiP package to the PCB.
US07772685B2	Stacked semiconductor structure and fabrication method thereof A stacked semiconductor structure and fabrication method thereof are provided. The method includes mounting and connecting electrically a semiconductor chip to a first substrate, mounting on the first substrate a plurality of supporting members corresponding in position to a periphery of the semiconductor chip, mounting a second substrate having a first surface partially covered with a tape and a second surface opposite to the first surface on the supporting members via the second surface, connecting electrically the first and second substrates by bonding wires, forming on the first substrate an encapsulant for encapsulating the semiconductor chip, the supporting members, the second substrate, the bonding wires, and the tape with an exposed top surface, and removing the tape to expose the first surface of the second substrate and allow an electronic component to be mounted thereon. The present invention prevents reflow-induced contamination, spares a special mold, and eliminates flash.
US07772684B2	Electronic device and production method thereof An object is to provide an electronic device of a multilayer structure with high density and high reliability that can be reduced in size while incorporating an electronic component therein, and further provide a production method for easily producing such an electronic device. An electronic device of the present invention includes wiring layers and electrically insulating layers stacked on a core board and establishes predetermined electrical conduction between the wiring layers through upper-lower side conducting vias provided in the electrically insulating layers. An electronic component incorporating layer formed by directly forming on a lower layer an insulating resin layer having a cutout portion for receiving an electronic component therein and upper-lower side conducting vias and by incorporating the electronic component in the cutout portion is provided at least between one of the wiring layers and one of the electrically insulating layers and/or between the core board and the electrically insulating layer. At least the uppermost-layer electronic component incorporating layer of electronic component incorporating layers has a metal frame body surrounding the electronic component and the upper-lower side conducting vias, and a metal cap having a flange portion fixed to the metal frame body of the uppermost-layer electronic component incorporating layer is provided.
US07772682B1	Moisture protection metal enclosure The present invention provides a substantially hermetically sealed enclosure about an active device area of a semiconductor substrate. The enclosure is created by forming a guard ring around the active device area on the substrate, and forming a metal panel over and in contact with the guard ring to enclose the active device area. The guard ring is a laminate of metal rings formed from alternating metal filled via rings and metal trace rings. The guard ring is formed on an ohmic contact ring on the surface of the substrate. An annealing process may be used to hermetically seal the guard ring to the ohmic contact ring.
US07772677B2	Semiconductor device and method of forming the same having a junction termination structure with a beveled sidewall A semiconductor device has a semiconductor substrate including an n-type high impurity concentration layer inhibiting a depletion layer from spreading, an n-type low impurity concentration drift layer, and a p-type high impurity concentration layer forming a p-n main junction between the drift layer. In the active region, an effective current flows in the direction of the thickness of the substrate. The device has an inclined trench that cuts the p-n main junction at a positive bevel angle from the semiconductor substrate surface on the side of the n-type high impurity concentration layer to penetrate through the substrate for separating it into chips. In the device, along the sidewall of the inclined trench in the n-type drift layer, an n-type surface region is formed with an impurity concentration lower than that in the n-type drift layer.
US07772675B2	Semiconductor device and manufacturing method of semiconductor device The present invention provides a thin and bendable semiconductor device utilizing an advantage of a flexible substrate used in the semiconductor device, and a method of manufacturing the semiconductor device. The semiconductor device has at least one surface covered by an insulating layer which serves as a substrate for protection. In the semiconductor device, the insulating layer is formed over a conductive layer serving as an antenna such that the value in the thickness ratio of the insulating layer in a portion not covering the conductive layer to the conductive layer is at least 1.2, and the value in the thickness ratio of the insulating layer formed over the conductive layer to the conductive layer is at least 0.2. Further, not the conductive layer but the insulating layer is exposed in the side face of the semiconductor device, and the insulating layer covers a TFT and the conductive layer. In addition, a substrate covering an element formation layer side is a substrate having a support on its surface is used in the manufacturing process.
US07772673B1	Deep trench isolation and method for forming same According to one exemplary embodiment, a semiconductor die including at least one deep trench isolation region for isolating an electronic device (for example, a bipolar device) includes a trench situated in a substrate of the semiconductor die, where the trench has sides surrounding the electronic device, and where the trench has at least one trench chamfered corner formed between and connecting the sides of the trench. The at least one trench chamferred corner is formed between a chamfered corner of an outside wall of said trench and a corner of an inside wall of the trench. A trench corner width at the at least one trench chamfered corner is less than a trench side width along the sides of the trench.
US07772668B2	Shielded gate trench FET with multiple channels A field effect transistor (FET) includes a pair of trenches extending into a semiconductor region. Each trench includes a first shield electrode in a lower portion of the trench and a gate electrode in an upper portion of the trench over but insulated from the shield electrode. First and second well regions of a first conductivity type laterally extend in the semiconductor region between the pair of trenches and abut sidewalls of the pair of trenches. The first and second well regions are vertically spaced from one another by a first drift region of a second conductivity type. The gate electrode and the first shield electrode are positioned relative to the first and second well regions such that a channel is formed in each of the first and second well regions when the FET is biased in the on state.
US07772667B2	Photoelectric conversion device and semiconductor device The present invention provides a photoelectric conversion device in which a leakage current is suppressed. A photoelectric conversion device of the present invention comprises: a first electrode over a substrate; a photoelectric conversion layer including a first conductive layer having one conductivity, a second semiconductor layer, and a third semiconductor layer having a conductivity opposite to the one conductivity of the second semiconductor layer over the first electrode, wherein an end portion of the first electrode is covered with the first semiconductor layer; an insulating film, and a second electrode electrically connected to the third semiconductor film with the insulating film therebetween, over the insulating film, are formed over the third semiconductor film, and wherein a part of the second semiconductor layer and a part of the third semiconductor layer is removed in a region of the photoelectric conversion layer, which is not covered with the insulating film.
US07772666B2	CMOS image sensor and method for manufacturing the same A CMOS image sensor and a method for manufacturing the same are provided. The CMOS image sensor may be capable of improved thickness uniformity form microlenses formed at a reduced distance from the photodiodes. The CMOS image sensor can include: a semiconductor substrate on which a pixel array is formed, the pixel array including photodiodes formed on the semiconductor substrate to different depths for sensing red, green, and blue signals, respectively; an interlayer dielectric formed on the semiconductor substrate and having a trench at an upper portion of the pixel array; an insulating layer sidewall formed at a side of the trench; and a plurality of microlenses formed on the interlayer dielectric in the trench at predetermined intervals.
US07772664B2	CMOS image sensor Disclosed is a CMOS image sensor, which can minimize a reflectance of light at an interface between a photodiode and an insulating film, thereby enhancing image sensitivity. Such a CMOS image sensor includes a substrate provided with a photodiode consisting of Si, an insulating film consisting of SiO2 and formed on the substrate, an anti-reflection film interposed between the substrate and the insulating film, and metal interconnections, color filters and micro lenses constituting individual unit pixels. The semi-reflection film has a refraction index value between those of the Si photodiode and the SiO2 insulating film.
US07772663B2	Method and apparatus for bitline and contact via integration in magnetic random access memory arrays In one embodiment, the invention is a method and apparatus for bitline and contact via integration in magnetic random access memory arrays. One embodiment of a magnetic random access memory according to the present invention includes a magnetic tunnel junction and a top wire that surrounds the magnetic tunnel junction on at least three sides.
US07772657B2	Three-dimensional force input control device and fabrication The present invention provides three-dimensional force input control devices for use in sensing vector forces and converting them into electronic signals for processing in a electronic signal processing system with all components within die fabricated from the single semiconductor substrate. In some embodiments, the die has an elastic element, a frame formed around said elastic element, at least three mechanical stress sensitive IC components located in the elastic element, at rigid island element which transfers an external vector force to the elastic element and through the IC components provides electrical output signal, this rigid island has a height bigger than the thickness of the frame element, an external force-transferring element coupling the rigid island element with an external force and electronic circuit for processing output signals from the mechanical stress sensitive IC components.
US07772656B2	Combination planar FET and FinFET device A semiconductor device. The device including: a planar FET formed in a single crystal-silicon substrate, the FET comprising a first channel region, first and second source drains on opposite sides of the first channel region and a gate, the gate over the channel region and electrically isolated from the channel region by a first gate dielectric layer; and a FinFET formed in single crystal silicon block on top of and electrically isolated from the substrate, the FinFET comprising a second channel region, third and fourth source drains on opposite first and second ends of a second channel region and the gate, the gate electrically isolated from the second channel region by a second gate dielectric layer.
US07772653B1	Semiconductor apparatus comprising bipolar transistors and metal oxide semiconductor transistors A method for manufacturing a semiconductor apparatus is disclosed. The apparatus comprises double poly bipolar transistors and double poly metal oxide semiconductor (MOS) transistors. The bipolar transistors and the MOS transistors are manufactured in a unified process in which a first polysilicon layer (Poly1) is doped to form the extrinsic bases in the bipolar transistors and to form the gates in the MOS transistors. A second polysilicon layer (Poly2) is doped to form emitters in the bipolar transistors and to form the sources and drains in the MOS transistors. The method of the invention minimizes the number of manufacturing process steps.
US07772650B2	Layout structure of electrostatic discharge protection circuit A layout structure of an electrostatic discharge protection circuit and a fabrication process thereof are provided. The electrostatic discharge protection circuit includes a substrate, a protection element and a resistor, wherein a part of or all of the area of the resistor is disposed in the region of the protection element, which saves the footprint of the resistor and reduces a junction parasitic capacitance formed in the protection element. Thus, the production cost of the electrostatic discharge protection circuit is reduced, and the influence of the electrostatic discharge protection circuit on the property of the entire internal circuit is minimized.
US07772649B2	SOI field effect transistor with a back gate for modulating a floating body A masking layer is applied over a top semiconductor layer and patterned to expose in an opening a shallow trench isolation structure and a portion of a top semiconductor region within which a first source/drain region and a body is to be formed. Ions are implanted into a portion of a buried insulator layer within the area of the opening to form damaged buried insulator region. The shallow trench isolation structure is removed and the damaged buried insulator region is etched selective to undamaged buried insulator portions to form a cavity. A dielectric layer is formed on the sidewalls and the exposed bottom surface of the top semiconductor region and a back gate filling the cavity is formed. A contact is formed to provide an electrical bias to the back gate so that the electrical potential of the body and the first source/drain region is electrically modulated.
US07772647B2	Structure and design structure having isolated back gates for fully depleted SOI devices Methods, structure and design structure having isolated back gates for fully depleted semiconductor-on-insulator (FDSOI) devices are presented. In one embodiment, a method may include providing a FDSOI substrate having a SOI layer over a buried insulator over a first polarity-type substrate, the first polarity-type substrate including a second polarity-type well therein of opposite polarity than the first polarity; forming a trench structure in the FDSOI substrate; forming an active region to each side of the trench structure in the SOI layer; and forming a PFET on the active region on one side of the trench structure and an NFET on the active region on the other side of the trench structure.
US07772646B2	Method of manufacturing a semiconductor device and such a semiconductor device There is a method of manufacturing a semiconductor device with a semiconductor body comprising a semiconductor substrate and a semiconductor region which are separated from each other with an electrically insulating layer which includes a first and a second sub-layer which, viewed in projection, are adjacent to one another, wherein the first sub-layer has a smaller thickness than the second sub-layer, and wherein, in a first sub-region of the semiconductor region lying above the first sub-layer, at least one digital semiconductor element is formed and, in a second sub-region of the semiconductor region lying above the second sub-layer, at least one analog semiconductor element is formed.According to an example embodiment, the second sub-layer is formed in that the lower border thereof is recessed in the semiconductor body in relation to the lower border of the first sub-layer Fully depleted SOI devices are thus formed.
US07772644B2	Vertical diffused MOSFET A LDMOS transistor having a channel region located between an outer boundary of an n-type region and an inner boundary of a p-body region. A width of the LDMOS channel region is less than 80% of a distance between an outer boundary of an n+-type region and the inner boundary of a p-body region. Also, a method for making a LDMOS transistor where the n-type dopants are implanted at an angle that is greater than an angle used to implant the p-type dopants. Furthermore, a VDMOS having first and second channel regions located between an inner boundary of a first and second p-body region and an outer boundary of an n-type region of the first and second p-body regions. The width of the first and second channel regions of the VDMOS is less than 80% of a distance between the inner boundary of the first and second p-body regions and an outer boundary of an n+-type region of the first and second p-body regions. Moreover, a method for making a VDMOS transistor where the n-type dopants are implanted at an angle that is greater than an angle used to implant the p-type dopants.
US07772642B2	Power trench gate FET with active gate trenches that are contiguous with gate runner trench A trench-gated field effect transistor (FET) is formed as follows. Using one mask, a plurality of active gate trenches and at least one gate runner trench are defined and simultaneously formed in a silicon region such that (i) the at least one gate runner trench has a width greater than a width of each of the plurality of active gate trenches, and (ii) the plurality of active gate trenches are contiguous with the at least one gate runner trench.
US07772641B2	Power semiconductor device with a plurality of gate electrodes A power semiconductor device includes: a semiconductor layer having a trench extending along a first direction in a stripe configuration; a gate electrode buried in the trench for controlling a current flowing in the semiconductor layer; and a gate plug made of a material having higher electrical conductivity than the gate electrode, the gate plug having the stripe configuration and being connected to the gate electrode along the first direction. The semiconductor layer includes: a first semiconductor layer of a first conductivity type; a second semiconductor layer of a second conductivity type provided partially in an upper face of the first semiconductor layer; a third semiconductor layer of the first conductivity type provided partially on the second semiconductor layer; and a fourth semiconductor layer of the second conductivity type provided on a lower face of the first semiconductor layer.
US07772639B2	Charge-trap nonvolatile memory devices Nonvolatile memory devices including device isolation patterns on a semiconductor substrate are provided. The device isolation patterns define a cell active region and a peripheral active region of the semiconductor substrate. Cell gate electrodes are provided that cross over the cell active regions. Memory cell patterns are provided between the cell gate electrodes and the cell active regions and extend toward the device isolation patterns. A tunnel insulation film is provided between the memory cell pattern and the cell active region. Related methods of fabricating nonvolatile memory devices are also provided herein.
US07772638B2	Non-volatile memory device Provided is a non-volatile memory device that can repetitively perform data write and erase operations in an embedded semiconductor device. In the non-volatile memory device, a device isolation region isolates a first active region and a second active region formed on a semiconductor substrate. A transistor electrode is formed on a first insulating layer in the first active region. A first capacitor electrode is formed on a second insulating layer in the first active region. A second capacitor electrode is formed on a third insulating layer in the second active region and electrically connected to the transistor electrode and the first capacitor electrode.
US07772637B2	Semiconductor devices including gate structures and leakage barrier oxides Methods of forming a semiconductor device may include forming a tunnel oxide layer on a semiconductor substrate, forming a gate structure on the tunnel oxide layer, forming a leakage barrier oxide, and forming an insulating spacer. More particularly, the tunnel oxide layer may be between the gate structure and the substrate, and the gate structure may include a first gate electrode on the tunnel oxide layer, an inter-gate dielectric on the first gate electrode, and a second gate electrode on the inter-gate dielectric with the inter-gate dielectric between the first and second gate electrodes. The leakage barrier oxide may be formed on sidewalls of the second gate electrode. The insulating spacer may be formed on the leakage barrier oxide with the leakage barrier oxide between the insulating spacer and the sidewalls of the second gate electrode. In addition, the insulating spacer and the leakage barrier oxide may include different materials. Related structures are also discussed.
US07772635B2	Non-volatile memory device with tensile strained silicon layer A non-volatile memory device has improved performance from a stressed, silicon nitride capping layer. The device is comprised of memory cells in a substrate that have source and drain regions. A tunnel dielectric is formed over the substrate between each pair of source and drain regions. If the memory device is an NROM, a nitride charge storage layer is formed over the tunnel dielectric. If the memory device is a flash memory, a floating gate is formed over the tunnel dielectric. An inter-gate insulator and control gate are then formed over the charge storage layer. The stressed, silicon nitride capping layer is formed over the control gate.
US07772634B2	Semiconductor device and manufacturing method thereof A channel stop region is formed immediately under an STI, and thereafter, an ion implantation is performed with conditions in which an impurity is doped into an upper layer portion of an active region, and at the same time, the impurity is also doped into immediately under another STI, and a channel dose region is formed at the upper layer portion of the active region, and another channel stop region is formed immediately under the STI.
US07772632B2	Memory arrays and methods of fabricating memory arrays A memory array includes a plurality of memory cells formed on a semiconductor substrate. Individual of the memory cells include first and second field effect transistors respectively comprising a gate, a channel region, and a pair of source/drain regions. The gates of the first and second field effect transistors are hard wired together. A conductive data line is hard wired to two of the source/drain regions. A charge storage device is hard wired to at least one of the source/drain regions other than the two. Other aspects and implementations are contemplated, including methods of fabricating memory arrays.
US07772630B2	Magnetic switching element of a magnetic memory cell having a ferromagnetic layer formed between a gate insulating film and a magnetic semiconductor layer A magnetic switching element includes a ferromagnetic layer which is substantially pinned in magnetization in one direction; and a magnetic semiconductor layer provided within a range where a magnetic field from the ferromagnetic layer reaches, where the magnetic semiconductor layer changes its state from a paramagnetic state to a ferromagnetic state by applying a voltage thereto, and a magnetization corresponding to the magnetization of the ferromagnetic layer is induced in the magnetic semiconductor layer by applying a voltage to the magnetic semiconductor layer.
US07772629B2	Ferroelectric memory configured to prevent penetration of hydrogen into a ferroelectric layer of the ferroelectric memory To securely prevent hydrogen from entering a ferroelectric layer of a ferroelectric memory. A first hydrogen barrier layer 5 is formed on the lower side of ferroelectric capacitors 7. Upper surfaces and side surfaces of the ferroelectric capacitors 7 are covered by a second hydrogen barrier layer. All upper electrodes 7c of the plural ferroelectric capacitors 7 to be connected to a common plate line P are connected to one another by an upper wiring layer 91. The upper wiring layer 91 is connected to the plate line P through a lower wiring 32 provided below the ferroelectric capacitors 7. A third hydrogen barrier layer 92 is formed on the upper wiring layer 91 such that all edge sections 92a of the third hydrogen barrier layer 92 come in contact with the first hydrogen barrier layer 5.
US07772628B2	Semiconductor device and method for manufacturing the same A lower electrode film is formed above a semiconductor substrate first, and then a ferroelectric film is formed on the lower electrode film. After that, an upper electrode film is formed on the ferroelectric film. When forming the upper electrode, an IrOx film containing crystallized small crystals when formed is formed on the ferroelectric film first, and then an IrOx film containing columnar crystals is formed.
US07772627B2	Image sensor with floating diffusion gate capacitor Pixel cells are provided which employ a gate capacitor associated with the floating diffusion node to selectively increase the storage capacity of the floating diffusion node. The gate capacitor can be formed at the same time as the same process steps used to form other gates of the pixel cells. The inherent capacity of the storage node alone may be sufficient under low light conditions. Higher light conditions may result in selective activation of the gate capacitor, thus increasing the capacity of the storage node with the additional capacity provided by the gate capacitor. The invention produces high dynamic range and high output signal without charge sharing or lag output signal. Methods of forming such pixel cells can be applied in CMOS and CCD imaging devices, image pixel arrays in CMOS and CCD imaging devices, and CMOS and CCD imager systems.
US07772625B2	Image sensor having an RPO layer containing nitrogen A semiconductor structure includes a transistor formed over a substrate. The transistor includes a transistor gate and at least one source/drain region. The semiconductor structure includes a pre-determined region coupled to the transistor. The semiconductor structure further includes a resist protection oxide (RPO) layer formed over the pre-determined region, wherein the RPO layer has a level of nitrogen of about 0.35 atomic % or less.
US07772622B2	Field effect transistor and manufacturing method thereof A manufacturing method of a field effect transistor in which, a patterned gate electrode is provided on a substrate, and a gate insulator is provided on the substrate and the gate electrode, a source electrode and a drain electrode are spaced apart from each other on the gate insulator, a region to be a channel between the source electrode and the drain electrode is provided, a boundary between the region and either one of the source electrode and the drain electrode is linear, a boundary between the region and either one of the drain electrode and the source electrode is non-linear, the boundary has a continuous or discontinuous shape, and the boundary part has a plurality of recess parts, the surface of the region has hydrophilicity and a peripheral region of the region prepares a member having water-repellency, and a solution including semiconductor organic molecules is supplied to the region, and the solution is dried.
US07772619B2	Semiconductor device having a fin structure and fabrication method thereof A semiconductor device includes a silicon on insulator (SOI) substrate, comprising an insulation layer formed on semiconductor material, and a fin structure. The fin structure is formed of semiconductor material and extends from the SOI substrate. Additionally, the fin structure includes a source region, a drain region, a channel region, and a gate region. The source region, drain region, and the channel region are doped with a first type of impurities, and the gate region is doped with a second type of impurities. The gate region abuts the channel region along at least one boundary, and the channel region is operable to conduct current between the drain region and the source region when the semiconductor device is operating in an on state.
US07772618B2	Semiconductor storage device comprising MIS transistor including charge storage layer A semiconductor memory device includes a memory cell block. The memory cell block includes a plurality of n-type first MIS transistors with current passages connected in series. Each of the first MIS transistors includes a source, a drain, and a charge storage layer formed on a (001)-plane of a semiconductor substrate with a gate insulating film interposed therebetween and is configured to store data. A direction from the source to the drain in each of the first MIS transistors is set parallel to a [001]-direction or [010]-direction of the semiconductor substrate.
US07772615B2	Anti stark electrooptic medium and electrooptically modulated optoelectronic device based thereupon Semiconductor electrooptic medium shows behavior different from a medium based on quantum confined Stark Effect. A preferred embodiment has a type-II heterojunction, selected such, that, in zero electric field, an electron and a hole are localized on the opposite sides of the heterojunction having a negligible or very small overlap of the wave functions, and correspondingly, a zero or a very small exciton oscillator strength. Applying an electric field results in squeezing of the wave functions to the heterojunction which strongly increases the overlap of the electron and the hole wave functions, resulting in a strong increase of the exciton oscillator strength. Another embodiment of the novel electrooptic medium includes a heterojunction between a layer and a superlattice, wherein an electron and a hole in the zero electric field are localized on the opposite sides of the heterojunction, the latter being effectively a type-II heterojunction. Yet another embodiment has a heterojunction between two superlattices, wherein an electron and a hole in a zero electric field are localized on the opposite sides of the heterojunction, the latter operating effectively as a type-II heterojunction.
US07772609B2	LED package with structure and materials for high heat dissipation LED packages are provided that include a material that is both thermally conductive and has a coefficient of thermal expansion that is matched to that of an LED. The material can be a ceramic such as aluminum nitride. The package has a body that includes a bottom surface and a cavity disposed into the body. The cavity has a floor for bonding to the LED so that the LED sits within the cavity. The thermally conductive material is disposed between the floor of the cavity and the bottom surface of the package. The body can be fabricated from a number of layers where the thermally conductive material is in a layer disposed between the floor and the bottom surface. The other layers of the body can also be fabricated from the thermally conductive material. A light emitting device is made by attaching the LED to the LED package.
US07772607B2	GaN-series light emitting diode with high light efficiency A GaN-series light emitting diode with high light efficiency utilizes a p-type semiconductor layer having a textured surface structure. The optical waveguide effect can be interrupted and formation of hexagonal shaped pits defect can be reduced due to the textured structure. The p-type semiconductor layer is formed on a light emitting layer and includes a p-type cladding layer, p-type transitional layer, and p-type ohmic contact layer. During the manufacturing of the GaN-series LED, the tension and compression of strain is controlled while the p-type cladding layer and the p-type transition layer are formed. Through the control of the epitaxial growth process, it is attained that the surface of the p-type semiconductor layer is textured to increase external quantum efficiency and the operation life of the light emitting device.
US07772602B2	Light emitting device having a plurality of light emitting cells and method of fabricating the same Disclosed is a light emitting device having a plurality of light emitting cells. The light emitting device comprises a thermally conductive substrate, such as a SiC substrate, having a thermal conductivity higher than that of a sapphire substrate. The plurality of light emitting cells are connected in series on the thermally conductive substrate. Meanwhile, a semi-insulating buffer layer is interposed between the thermally conductive substrate and the light emitting cells. For example, the semi-insulating buffer layer may be formed of AlN or semi-insulating GaN. Since the thermally conductive substrate having a thermal conductivity higher than that of a sapphire substrate is employed, heat-dissipating performance can be enhanced as compared with a conventional sapphire substrate, thereby increasing the maximum light output of a light emitting device that is driven under a high voltage AC power source. In addition, since the semi-insulating buffer layer is employed, it is possible to prevent an increase in a leakage current through the thermally conductive substrate and between the light emitting cells.
US07772598B2	Display device and manufacturing method therefor A display device, comprising an insulating substrate; a data conductor formed on the insulating substrate and comprising a conductive film; a thin film transistor having at least one source electrode electrically connected with the conductive film, and a drain electrode formed along a circumference of the source electrode and spaced therefrom; and a pixel electrode which is electrically connected with the conductive film.
US07772595B2	Nitride semiconductor substrate, method for forming a nitride semiconductor layer and method for separating the nitride semiconductor layer from the substrate There is provided a method of forming a nitride semiconductor layer, including the steps of firstly providing a substrate on which a patterned epitaxy layer with a pier structure is formed. A protective layer is then formed on the patterned epitaxy layer, exposing a top surface of the pier structure. Next, a nitride semiconductor layer is formed over the patterned epitaxy layer connected to the nitride semiconductor layer through the pier structure, wherein the nitride semiconductor layer, the pier structure, and the patterned epitaxy layer together form a space exposing a bottom surface of the nitride semiconductor layer. Thereafter, a weakening process is performed to remove a portion of the bottom surface of the nitride semiconductor layer and to weaken a connection point between the top surface of the pier structure and the nitride semiconductor layer. Finally, the substrate is separated from the nitride semiconductor layer through the connection point.
US07772592B2	Semiconductor thin film and semiconductor device After an amorphous semiconductor thin film is crystallized by utilizing a catalyst element, the catalyst element is removed by performing a heat treatment in an atmosphere containing a halogen element. A resulting crystalline semiconductor thin film exhibits {110} orientation. Since individual crystal grains have approximately equal orientation, the crystalline semiconductor thin film has substantially no grain boundaries and has such crystallinity as to be considered a single crystal or considered so substantially.
US07772591B1	Electrically-programmable transistor antifuses Integrated circuit antifuse circuitry is provided. A metal-oxide-semiconductor (MOS) transistor serves as an electrically-programmable antifuse. The antifuse transistor has source, drain, gate, and substrate terminals. The gate has an associated gate oxide. In its unprogrammed state, the gate oxide is intact and the antifuse has a relatively high resistance. During programming, the gate oxide breaks down, so in its programmed state the antifuse transistor has a relatively low resistance. The antifuse transistor can be programmed by injecting hot carriers into the substrate of the device in the vicinity of the drain. Because there are more hot carriers at the drain than at the substrate, the gate oxide is stressed asymmetrically, which enhances programming efficiency. Feedback can be used to assist in turning the antifuse transistor on to inject the hot carriers.
US07772590B2	Metal comb structures, methods for their fabrication and failure analysis The present disclosure relates to a metal comb structure including a first comb which includes a first set of metal fingers each of the metal fingers being connected at one end thereof by a connecting member from which the metal fingers extend. The metal comb structure also includes a second comb which includes a first set of metal fingers inter-digitated with the metal fingers of the first comb, a first set of vias associated with the metal fingers of the second comb and a connecting member connected to the vias thereby connecting the metal fingers of the second comb. The vias extend from the metal fingers of the second comb such that the connecting member of the second comb is located outside a plane defined by the metal fingers of the first and second combs.
US07772585B2	Nitride semiconductor substrate and method of producing same A nitride semiconductor crystal substrate is produced by forming a network mask repeating a closed loop unit shape upon an undersubstrate, growing a nitride semiconductor crystal in vapor phase, producing convex facet hills covered with facets on exposed parts Π, forming outlining concavities on mask-covered parts , not burying the facets, maintaining the convex facet hills on Π and the network concavities on , excluding dislocations in the facet hills down to the outlining concavities on , forming a defect accumulating region H on , decreasing dislocations in the facet hills and improving the facet hills to low defect density single crystal regions Z, producing a rugged nitride crystal, and slicing and polishing the nitride crystal into mirror nitride crystal wafers. After the fabrication of devices on the nitride wafer, dry-etching or wet etching of hot KOH or NaOH divides the device-carrying wafer into chips by corroding the network defect accumulating region H.
US07772584B2	Laterally grown nanotubes and method of formation A semiconductor device has lateral conductors or traces that are formed of nanotubes such as carbon. A sacrificial layer is formed overlying the substrate. A dielectric layer is formed overlying the sacrificial layer. A lateral opening is formed by removing a portion of the dielectric layer and the sacrificial layer which is located between two columns of metallic catalysts. The lateral opening includes a neck portion and a cavity portion which is used as a constrained space to grow a nanotube. A plasma is used to apply electric charge that forms an electric field which controls the direction of formation of the nanotubes. Nanotubes from each column of metallic catalyst are laterally grown and either abut or merge into one nanotube. Contact to the nanotube may be made from either the neck portion or the columns of metallic catalysts.
US07772580B2	Integrated circuit having a cell with a resistivity changing layer In an embodiment of the invention, an integrated circuit having a cell is provided. The cell may include a field effect transistor structure which includes a gate stack and a resistivity changing material structure disposed above the gate stack, wherein the resistivity changing material structure includes a resistivity changing material which is configured to change its resistivity in response to the application of an electrical voltage to the resistivity changing material structure.
US07772578B2	Diagnostic test device including photodetector and tether A diagnostic test device comprising means for sampling a liquid biological sample, means for reacting the sample with at least one reagent to provide one or more visible indicia and an optical detector for detecting the presence of said one or more indicia, the device further comprising a releasable tether which is released by contact with the liquid sample, thereby to cause the optical detector to detect the said one or more indicia.
US07772577B2	Particle beam therapy system A particle beam therapy system using a spot scanning method includes a synchrotron, a beam transport system, an irradiation system, and a controller. A controller is configured to turn on a radio frequency electromagnetic field to be applied to an extraction system when a charged particle beam is to be supplied to the irradiation system, and turn off the radio frequency electromagnetic field to be applied to the extraction system when the supply of the charged particle beam to the irradiation system is to be blocked by means of an electromagnet provided in the beam transport system or in the synchrotron. The controller is also adapted to turn off a radio frequency acceleration voltage to be applied to an acceleration cavity in synchronization with the turning-off of the radio frequency electromagnetic field to be applied to the extraction device.
US07772576B2	Shielding assembly for semiconductor manufacturing apparatus and method of using the same A shielding assembly for use in a semiconductor manufacturing apparatus, such as an ion implantation apparatus, includes one or more removable shielding members configured to cover inner surfaces of a mass analyzing chamber. The shielding assembly reduces process by-products from accumulating on the inner surfaces. In one embodiment, a shielding assembly includes first and second shielding members, each having a unitary construction and configured to cover a magnetic area in the mass analyzing chamber. The shielding members desirably are made entirely of graphite or impregnated graphite to minimize contamination of the semiconductor device being processed caused by metal particles eroded from the inner surfaces of the mass analyzing chamber.
US07772575B2	Stencil design and method for cell projection particle beam lithography A method and system for particle beam lithography, such as electron beam (EB) lithography, is disclosed. The method and system include selecting one of a plurality of cell patterns from a stencil mask and partially exposing the cell pattern to a particle beam, such as an electron beam, so as to selectively project a portion of the cell pattern on a substrate.
US07772567B2	Specimen holding device and charged particle beam device A specimen holding device has a plurality of electrodes, and a moving mechanism for moving upward and downward a part of the plurality of electrodes. Further, the moving mechanism moves the part of the plurality of electrodes downward to evacuate from a path through which a specimen is introduced. Further, the specimen holding device has a positioning member for the specimen so that the specimen is positioned after being mounted.
US07772565B2	Radiation-shielding assembly having container location feature A radiation-shielding assembly can contain any of multiple containers of different sizes in a predetermined, fixed location within the assembly. A clamping system in of the assembly is able to clamp any of the containers so that they are held in the same fixed location within the assembly. The containers, regardless of size, are always located in the desired position within the shield. The positive location is achieved with out the use of separate components not attached to the assembly.
US07772563B2	Gamma imagery device This device is a gamma imagery device including: a gamma camera with an observation field, a gamma spectrometry detector collimated with a collimator with an observation field extending around an axis and that is included in the observation field of the gamma camera beyond a given distance from it; a laser pointer with a line of sight, this laser pointer being located close to the gamma spectrometry collimator, such that the line of sight is substantially parallel to the axis of the observation field of the collimator and intersects the observation field of the collimator, means for localising a zone pointed at by the laser pointer.
US07772561B2	Apparatus and method for detecting an image In order to detect an image generated by an image source, a mirror arrangement is arranged between the image source and a detector. The mirror arrangement includes two spaced-apart deflection mirrors, which are parallel to each other or form an acute angle of less than 90° between them. In particular when the image source is a scintillator layer, shielding of X-rays from the detector with simultaneous compact dimensioning of the apparatus is achieved in this manner.
US07772556B2	Detection system for detecting an analyte in a fluid medium This invention relates to a detection system for detecting an analyte in a fluid medium. The detection system comprises a substrate that provides mechanical stability and is sized and shaped to intercept an infrared beam. A reactive material is coated on the substrate. When contacted with the analyte in the fluid medium, the reactive material reacts with the analyte and is altered. The detection system also comprises an infrared spectrometer producing the infrared beam that passes through the reactive material to a detector of the spectrometer. The alteration of the reactive material allows the spectrometer to identify and quantify the analyte. In one embodiment, the reactive material irreversibly reacts with the analyte. In another embodiment, the spectrometer is a non-ATR infrared spectrometer. In a further embodiment, the substrate is a disposable substrate.
US07772552B2	Methods and devices for atom probe mass resolution enhancement In an atom probe or other mass spectrometer wherein a specimen is subjected to ionizing pulses (voltage pulses, thermal pulses, etc.) which induce field evaporation of ions from the specimen, the evaporated ions are then subjected to corrective pulses which are synchronized with the ionizing pulses. These corrective pulses have a magnitude and timing sufficient to reduce the velocity distribution of the evaporated ions, thereby resulting in increased mass resolution for the atom probe/mass spectrometer. In a preferred arrangement, ionizing pulses are supplied to the specimen from a first counter electrode adjacent the specimen. The corrective pulses are then supplied from a second counter electrode which is coupled to the first via a passive or active network, with the network controlling the form (timing, amplitude, and shape) of the corrective pulses.
US07772542B2	Imaging apparatus having photoelectric conversion unit with position adjustment plate A photoelectric conversion element unit for use in an imaging apparatus including a photoelectric conversion element package containing a photoelectric conversion element, a wiring substrate where the photoelectric conversion element package is mounted on the first surface and an electronic component related to the photoelectric conversion element is mounted on a rear side of the first surface, and a support board attached to an attachment point in the imaging apparatus where the photoelectric conversion element package is fixed, wherein an opening smaller than an external form of the photoelectric conversion element package is formed in the support board, and the electronic component mounted on the wiring substrate is provided within the opening.
US07772541B2	Fiber optic position and/or shape sensing based on rayleigh scatter A fiber optic position and/or shape sensing device includes an optical fiber with either two or more single core optical fibers or a multi-core optical fiber having two or more fiber cores. In either case, the fiber cores are spaced apart so that mode coupling between the fiber cores is reduced, and preferably, minimized. The optical fiber is physically associated with an object. Strain on at least a portion of the optical fiber where it is associated with the object is determined by an OFDR using one or more Rayleigh scatter patterns for that portion of the optical fiber. The determined strain is used to determine a position and/or a shape of the object.
US07772538B2	Float activated optical switch An optical switch having a housing, a light source and a light detector. The light source and light detector are located remote from the housing, The light source is connected to the housing with a first light guide, and the light detector is connected to the housing with a second light guide. The first and second light guide cables have distal ends positioned through the housing and are optically aligned but separated by a gap. The switch includes a device to interrupt a light beam that is usually adapted to removably occupy the gap.
US07772534B2	Display device and projector for modulating irradiation light to form an optical image and displaying the optical image having a spatial light modulation element with plural sub-pixels A display device for modulating irradiation light with a spatial light modulation element to form an optical image, and displaying the optical image, includes a light source for emitting the irradiation light including four kinds of colored light having wavelength ranges, a temporal colored light separating section that spatially separates the irradiation light by the wavelength range to generate first irradiation light, and second irradiation light alternately every sub-frame period, a spatial colored light separating section that spatially separates the colored light included in each of the first irradiation light and the second irradiation light, and a spatial light modulation element provided with a plurality of sub-pixels, capable of independently modulating every sub-frame period.
US07772529B2	Selective permalloy anisotropy Methods and systems for improving permalloy sensitivity. One or more permalloy sensing components can be configured upon a substrate, and one or more conductors are located above a portion of the permalloy sensing component of interest. A current can then be initiated through the conductor. The substrate can then be heated such that the current creates a magnetic field that modifies the anisotropy of the portion of the permalloy sensing component of interest, thereby providing selective anisotropy and improving permalloy sensitivity thereof.
US07772527B2	Heat reflector and substrate processing apparatus comprising the same A substrate processing apparatus includes a process chamber including upper and lower quartz walls, a substrate support disposed in the process chamber, radiant heaters respectively provided above and below the quartz walls of the chamber, and heat reflectors disposed outside the process chamber for reflecting heat towards the substrate support. Each of the heat reflectors has heating has a first thermally reflective section oriented to reflect the heat towards an outer peripheral region of the substrate support and a second thermally reflective section oriented to reflect the heat towards a central region of the substrate support. Each heat reflector also has a reflection angle adjusting mechanism by which an angle at which the second thermally reflective section reflects heat can be adjusted. The angle is adjusted depending on the temperature distribution across the substrate so that the substrate can be processed uniformly.
US07772526B2	Hair styling device A hair styling device includes a hand unit having an air inlet, an outlet, and a blower between the inlet and outlet. The device further includes a storage case having a water reservoir and being configured to receive the hand unit. Tubing connects the water reservoir to the hand unit. A pump is included that selectively connects the water reservoir to the hand unit liquid inlet. A heater is situated between the water reservoir and the hand unit outlet to vaporize the contents of the water reservoir. The hair styling device includes controls in communication with the pump and blower, for actuating the pump and blower, respectively. The device may be used to selectively deliver hot hair, steam, or mist.
US07772521B2	Method and system for marking tires A system and associated method of marking a molded vehicle tire with laser engraved information to provide both human visible and machine readable data concerning the tire. Information contained in a barcode on the tire is read at a first station and supplied to a control unit. The physical location of human visible information previously molded into the tire is read from the tire at a second station and supplied to the control unit which uses this information to position a laser located at a third station for engaging additional human visible information pertaining to the manufacture of the tire adjacent the existing visible information to satisfy the Department of Transportation (DOT) tire marking requirements. The additional information also can be laser engraved into the tire in a machine readable encoded format, such as 2D symbols, for subsequent control and verification throughout the life of the tire.
US07772516B2	Method and apparatus for aligning a machine tool A machine tool is provided comprising a base, a slide assembly attached to the base for supporting a tool and translating the tool along an axis, and a workpiece holder attached to the base. At least one of the slide assembly and the workpiece holder are movable laterally with respect to the axis. Means are provided for aligning the slide assembly and the workpiece holder in a desired lateral relationship. A method of aligning a machine tool is also provided.
US07772515B2	Vacuum switchgear assembly and system Insulated vacuum switchgear and active switchgear elements therefor are provided with a composite overwrap for mechanically isolating a vacuum insulator from axial loads in use without reinforcing or insulating encapsulations. A dielectric buffer layer is provided to fill voids or discontinuities in the overwrap.
US07772509B2	Multi-directional switching assembly which prevents rattling of drive members Provided is an easily assembled multi-directional switching device that prevents the rattling of drive members, in which each pair of drive members mutually adjacent in the circumferential direction are connected to each other by an elastic arm member to form drive member units, and in which stem portions of the respective drive members are inserted in a casing from above corresponding guide holes to position the elastic arm members of the drive member units on the upper surface side of a top panel of the casing.
US07772508B2	Switch having a base, a slider, and a conductive coil spring A thin switch having a small floor area easy to be manufactured is provided. A switch includes a base including at least one switching fixed contact point exposed from a bottom surface and a concave part having at least one pair of opposing side walls; an operation lever pivotally supported by the side walls of the base; a slider slidably arranged on the bottom surface of the base for sliding while being guided by the opposing side walls of the base when pushed by a cam part of the operation lever; and a conductive coil spring arranged on the bottom surface of the base so as to extend and contract with push and release by the slider, including an arm part on a first end side arranged to be slidable on the bottom surface of the base and arranged so as to contact and separate with respect to the switching fixed contact point. A shaft center of the coil spring is arranged parallel to a moving direction of the slider.
US07772504B1	Laptop shield carrying case and cellular shield holster A unique laptop computer or similar device carrying case which can also shield an individual electromagnetic radiation including RF microwave radiation and also heat transfer from the laptop computers when opened or in the closed positions. The invention includes sewn insulating sections along the internal nylon face and an external leather face. A conductive fabric is positioned against the non-conductive plastic sheeting and is rolled up on itself, on four sides, to provide a larger effective virtual shield in the two side insulating sections, each of which includes an inner perforated metal shield and a solid metal shield in the base to protect against electromagnetic radiation. The sections fold inwardly to provide a carrying case held together with four Velcro® strips on the exterior of the case. A Cellular Shield, TCS Holster or other optional accessories can also be stored via the vertical Velcro® accessory strip, located midline on the side of the case, said holster including a neck tube for optional use for storing and protection from the cell phone.
US07772501B2	Flexible printed circuit board A flexible printed circuit board (FPC) is disclosed which can eliminate the need for forming through holes and ensure the strength required for mounting components. The FPC has a metal foil layer formed only on one side of an insulating layer via an adhesive layer. The FPC is configured such that the insulating layer and the adhesive layer are partially removed, and the surface of the metal foil layer on the side from which the insulating layer and the adhesive layer have been removed is flattened. In a region from which the insulating layer and the adhesive layer have been removed, an overcoat layer for reinforcing the metal foil layer is provided along the metal foil layer on a surface opposite to the flattened surface. A drive IC is mounted on a first metal foil face of the metal foil layer and on a second metal foil face which is the flattened surface of the metal foil layer, and is provided with electrical conduction by the metal foil layer. To form the FPC, the insulating layer and the metal foil layer can be directly affixed to each other without using the adhesive layer.
US07772500B2	Overhead and underground pole mount cable restraint insulator An improved pole mount cable restraint insulator is described featuring a pin and bolt locking mechanism that may be used to secure a medium voltage 5 kV to 35 kV electrical cable to the insulator and riser pole. The cable restraint insulator includes a seat to secure the cable. A further improvement over existing cable restraints is the polymer insulating materials used in the construction. Such materials are lighter in weight, electrically track resistant, lower in cost and non-breakable. The cable restraint insulator may be constructed by injection molding and/or casting with variety of electrically insulating polymers.
US07772498B2	Wire holder A wire fixing portion (17) is so formed with a slit (24) as to minimize a tightening diameter at the wire fixing portion (17) by narrowing the slit (24). Thus, there is no likelihood of displacing a fixing band (25) fastened to a middle part of the wire fixing portion (17) toward a side where the tightening diameter is larger. Accordingly, displacements of the fixing band (25) relative to the wire fixing portion (17) are restricted, wherefore displacements of the wires (W) relative to the wire fixing portion (17) are suppressed.
US07772495B2	Wire cable with saving energy A wire cable of electric conductor forming of multiple metals or alloys includes single (bundle) wire cable or double (bundle) wire cables, in which at least in one bundle of electric conductor, each bundle of electric conductor is composed of slim electric wire made by two or more than two metals or alloys, which is covered by insulator to form a wire cable of electric conductor.
US07772494B2	Web for separating conductors in a communication cable A telecommunications cable having a cable jacket defining an elongate cable core, a conductor assembly comprising four twisted pairs of conductors disposed along the core and parallel elongate distensions formed on an inner surface of the cable jacket. The distensions are spaced about an inner surface of the cable jacket and prevent the conductor assembly from coming into contact with the inner surface. The distensions can be the result of a series of filler elements placed between the cable jacket and the cable core and which wind helicoidally along and about the cable core. A separator spline has first and second elongate dividing strips having a substantially H shaped cross section and arranged side by side. The spline twists helicoidally along its length. The separator spline and the insulation surrounding the twisted pairs of conductors can be manufactured form a material having the same dielectric constant.
US07772490B2	Electrical device comprising a connecting cable and method for producing said device The invention relates to an electrical device (1), especially for a motor vehicle. Said device comprises an electrical component (2) and a connecting cable (5) which is connected to the component (2) and is surrounded by a sheathing (8), the end (9) of said sheathing being at a distance from the component (2). The sheath end (9) and the respectively connected regions (13, 14) of the sheathing (8) and the connecting cable (5) comprise a sealing coating (16). The aim of the invention is to improve the sealing and to increase the durability thereof. To this end, another section (10) of the sheathing (8), embodied in a sleeve-shaped manner, is arranged between the sheath end (9) and the component (2), and the coating (16) extends over a sleeve end (11) facing the sheath end (9) and over the region (17) of the sleeve-shaped section (10) of the sheathing (8) connected thereto. The invention also relates to a method for producing one such device.
US07772488B2	Case assembly structure and electronic device with same The present invention provides a case assembly structure of an electronic device. The case assembly structure includes a first case, a second case and a heat-dissipating element. The first case has an engaging hole and a first opening. The second case has an engaging element engaged with the engaging hole of the first case and a second opening aligned with the first opening of the first case. The heat-dissipating element includes a fastening hole aligned with the first opening of the first case and the second opening of the second case. The first case, the second case and the heat-dissipating element are combined together by penetrating a fastening element through the first opening, the second opening and the fastening hole.
US07772486B2	Photovoltaic device The present invention provides a photovoltaic device capable of keeping reduction of the yield in modularization in check. This photovoltaic device comprises a transparent conductive film, and a collector which is formed on the surface of the transparent conductive film so as to be in partial contact with a semiconductor layer.
US07772483B2	Sensor for measuring the temperature of flowing metals An immersion thermocouple is described. The immersion thermocouple includes a heat resistant sheathing, the interior of which is substantially filled with a heat resistant cement, a first U-shaped tube enclosing a thermocouple fixed in the heat resistant cement, and a second U-shaped tube fixed in the heat resistant cement. The second U-shaped tube bridges the first U-shaped tube at an angle of approximately ninety degrees. The immersion thermocouple also includes a shield circumferentially surrounding the first and the second U-shaped tubes proximate to where the first and the second U-shaped tubes are fixed to the heat resistant cement.
US07772481B2	Synthetic drum sound generation by convolving recorded drum sounds with drum stick impact sensor output Methods and apparatus for simulating the sound of an acoustic percussion instrument. A first stored waveform signal representative of the impulse response of an acoustic percussion instrument is convolved with a waveform produced by a sensor circuit attached to a physical playing surface. Undesirable response characteristics of the playing surface and sensor circuit may be filtered out by deconvolving sensor output, or the stored waveform representing the acoustic instrument, with the impulse response of the combination of the playing surface and the sensor circuit.
US07772478B2	Understanding music There are disclosed methods and apparatus for understanding music. A classifier machine may be trained for each of a plurality of selected terms using a first plurality of music samples. The classifier machines may then be tested using a second plurality of music samples. The results from testing the classifier machines may then be used to select a plurality of semantic basis function from the selected terms. A semantic basis classifier machine may then be trained for each semantic basis function.
US07772476B2	Device and method for visualizing musical rhythmic structures The present disclosure relates to methods and devices for visualizing the rhythmic structure of musical compositions. Circular symmetry and geometric shapes are utilized to visualize representations of rhythmic structures about a central axis. In general, lower frequency rhythm instruments are represented by small geometric shapes, while relatively higher frequency instruments are represented by shapes of larger diameter. The visualizations can be presented in two or three dimensions and may incorporate the use of animation. The result is a graphical representation that is more intuitive and entertaining than traditional music notation.
US07772475B2	Electronic musical instrument A main body 10 having a keyboard operated with player's hands is supported on both sides thereof by stand portions 22, 24. To the lower end of the stand portions 22, 24, a fixed unit 52 is fixed. On the fixed unit 52, a moving unit 60 is mounted so that the moving unit 60 can move frontward and backward. On the moving unit 60, a pedal 62 operated with a player's foot is mounted. Separately from the keyboard operated with the hands, as a result, the player is allowed to adjust his desired front-back directional position of the pedal 62.
US07772473B2	Rim riser The claimed device is a drum rim extension. Previously, drummers playing cross-stick, (that is, laying the stick across the rim of the drum to produce a clicking or tapping sound), had difficulty maintaining a good grip on the drumstick and finding a consistent sound throughout performances. The drum rim extension is a block of metal, wood or plastic that connects to a portion of the rim of and drum and provides the player up to several inches of free space above the drum, improving stick handling and playing consistency. The drum rim extension improves drumming where rim playing is prominent in musical pieces.
US07772467B1	Inbred maize line PHF3P A novel inbred maize variety designated PHF3P and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing inbred maize variety PHF3P with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PHF3P through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the inbred variety PHF3P or a trait conversion of PHF3P with another maize variety. Inbred maize varieties derived from inbred maize variety PHF3P, methods for producing other inbred maize varieties derived from inbred maize variety PHF3P and the inbred maize varieties and their parts derived by the use of those methods.
US07772465B2	Bacillus thuringiensis gene with lepidopteran activity The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding polypeptides having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, DNA constructs, and transformed microorganisms and plants comprising a nucleic acid of the embodiments. These compositions find use in methods for controlling pests, especially plant pests.
US07772457B2	Manufacturing method of absorbent body and absorbent body for disposable diaper obtained by the method A pair of rollers 2 and 3 are provided to be opposed to each other with a predetermined distance wherein at least one of the rollers 2 and 3 is a press print processing roller 2 that has a plurality of processing projections 2a with a predetermined layout on a circumference surface, and a stripe-shaped absorbent body base 1 including an absorbent element 7 obtained by mixing at least pulp 8 with super absorbent polymer 9 is sent and transferred between the pair of rollers 2 and 3 so that at least one surface of the absorbent body base 1 has a plurality of linear pattern elements 1a provided by being squeezed by the processing projections 2a, so as to have a groove-like shape when seen from the top, and are individually spaced from one another and dispersed in a staggered manner.
US07772456B2	Stretchable absorbent composite with low superaborbent shake-out An article comprises a stretchable absorbent composite (30) that includes a quantity of superabsorbent particles (32) which are operatively contained within a matrix of elastomeric polymer fibers (34). In particular aspects, the composite article can include at least about 60 wt % of the superabsorbent particles and not more than about 40 wt % of the elastomeric polymer fibers, based on a total weight of the composite. In other aspects, the composite article can provide a high stretchability. Additional aspects can provide a low shake-out. Particular configurations can, for example, provide a stretchability value of at least about 30%. Additional aspects can include a configuration that provides a shake-out value of not more than about 2%. In further aspects, the absorbent composite can include superabsorbent particles having a coating of treatment-material that is thermally processible. Additional aspects can include a treatment-material which is water soluble.
US07772453B2	Method for the recycling of municipal solid wastes The present invention refers to a method and a system for the complete recycling of municipal solid wastes with minimal environmental impact and with the exploitation of the wasted solid recovery fuel (WSRF) for the production of electric energy and/or hydrogen. Those results are achieved by means of the gasification of the WSRF in a reactor where the volatile and the inorganic components are combusted separately thus allowing contemporary the further treatment of the synthesised gas and the recovery of mineral and metallic molten granulates.
US07772436B2	Process for producing 2,2′-bis(trifluoromethyl)-4,4′-diaminobiphenyl A process for producing 2,2′-bis (trifluoromethyl)-4,4′-diaminobiphenyl which is useful as a raw material for polyimide resin, etc.In benzidine rearrangement of 3,3′-bis(trifluoromethyl) hydrazobenzene in the presence of an inorganic acid such as sulfuric acid aqueous solution or concentrated hydrochloric acid, use of a water-immiscible organic solvent such as toluene as reaction solvent can increase the yield of the product.3,3′-bis(trifluoromethyl) hydrazobenzene can be synthesized by reduction of m-nitrobenzotrifluoride.
US07772435B2	Method of forming a dry quaternary ammonium salt mixture Disclosed herein is a method comprising: (a) adding an aqueous solution comprising a quaternary ammonium salt to an organic solvent in a vessel under an inert atmosphere, thereby forming a first mixture comprising the quaternary ammonium salt and the solvent; and (b) mixing the first mixture at a temperature and for a time sufficient to remove water and a portion of the solvent from the first mixture, wherein the mixing is performed in an inert atmosphere and the temperature is less than the decomposition temperature of the quaternary ammonium salt.
US07772431B1	Performance of energy storage devices: potential areas for dendritic chemistry involvement A compound consists of a fractal-like, plain or organometallic array useful for energy storage devices. A dendrimer useful in the synthesis of the fractal-like compound includes a single ligating moiety bound to a surface of each quadrant of the dendrimer. A method of making metallo-based (macro) molecules includes the steps of combining monomers selected from the group consisting of bipyridal- and terpyridal-based ligands with connecting metals and self assembling macrocycles wherein the monomes are interconnected by the metals.
US07772423B2	Process for the production of alkyl alkoxyacetates A process for the production of lower alkyl alkoxyacetates, preferably methyl methoxyacetate, by reaction of a di-(lower alkoxy)methane, preferably dimethoxymethane, with the acid form of a medium-pore or large-pore zeolite catalyst, preferably the acid form of faujasite, ZSM-5, mordenite, or beta, in the gas phase at atmospheric or near-atmospheric pressures.
US07772420B2	(Meth)acrylic esters of monoalkoxylated polyols, and production thereof Disclosed are novel (meth)acrylic esters of monoalkoxylated polyols, a process for their preparation and their use for preparing crosslinked swellable hydrogel-forming polymers and crosslinked swellable hydrogel-forming polymers.
US07772419B2	Carbonylation of ester A vinyl ester alkoxycarbonylation process comprising reacting a vinyl ester with carbon monoxide in the presence of an alkanol and a catalyst system. The catalyst system used is obtainable by combining: a) a metal of Group VIII B or a compound thereof, and b) a bidentate ligand of general formula (I) R is a covalent bridging group; R1 together with Q2 to which form an optionally substituted 2-Q2-tricyclo[3.3.1.1{3,7}]decyl group or derivative thereof (2-PA); R2 and R3 independently represent univalent radicals up to 20 atoms or jointly form a bivalent radical of up to 20 atoms; and Q1 and Q2 each independently represent phosphorous, arsenic or antimony. The process is carried out for the production of a 3-hydroxy propanoate ester or acid of formula (II) CH2(OH)CH2C(O)OR28 (II). or for the production of a lactate ester or acid of formula III.
US07772418B1	Process for producing 3,4′ diacetoxybenzophenone A process for producing 3,4′diacetoxybenzophenone by first synthesizing 3,4′dihydroxybenzophenone by reacting meta-hydroxybenzoic acid and phenol in the presence of a Lewis acid, and a protonic acid followed by reacting the 3,4′dihydroxybenzophenone with an acetylating agent in the presence of an inorganic acid and activated carbon.
US07772414B1	Process for producing biodiesel fuel products A method for producing a biodiesel fuel product from biological material is disclosed which comprises extracting lipids from the biological material with a pure or alcohol-modified supercritical fluid in an extractor, passing the extract directly into a reactor wherein a transesterification reaction is induced between the extracted lipids and alcohol with additional alcohol added if needed, forming glycerol and fatty acid alkyl esters, passing the mixture into one or more separators to remove the glycerol and fatty acid alkyl ester products, removing wastes, and recycling the critical fluid solvent and unreacted alcohol to the extractor. An improvement to biodiesel preparation is afforded by the simplification of the extraction and reaction processes into a single flowing system. According to the invention, a biodiesel fatty acid alkyl ester product can be prepared directly from biological material feedstock, such as oil-containing seeds, without the need for prior isolation of the oil.
US07772411B2	Process for the preparation of (3R,3aS,6aR)-hexahydrofuro [2,3-b] furan-3-yl (1S,2R)-3[[(4-aminophenyl) sulfonyl] (isobutyl) amino]-1-benzyl-2-hydroxypropylcarbamate The present invention relates to a process for the preparation of (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl (1S,2R)-3-[[(4-aminophenyl)sulfonyl](isobutyl) amino]-1-benzyl-2-hydroxypropylcarbamate as well as intermediates for use in said process. More in particular the invention relates to processes for the preparation of (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl (1S,2R)-3-[[(4-aminophenyl)sulfonyl](isobutyl)amino]-1-benzyl-2-hydroxypropylcarbamate which make use of 4-amino-N-((2R,3S)-3-amino-2-hydroxy-4-phenylbutyl)-N-(isobutyl)benzene sulfonamide intermediate, and to processes amenable to industrial scaling up. (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl (1S,2R)-3-[[(4-aminophenyl)sulfonyl](isobutyl)amino]-1-benzyl-2-hydroxypropylcarbamate is particularly useful as HIV protease inhibitors.
US07772406B2	Process for production of benzyloxypyrrolidine derivative, and process for production of hydrochloride salt powder of optically active benzyloxypyrrolidine derivative Provided are: a process for production of a benzyloxypyrrolidine derivative in high yield and safety, and a process for production of a hydrochloride powder of a benzyloxypyrrolidine derivative in high yield and safety; the process for production of a benzyloxypyrrolidine derivative expressed by the general formula (2) [Chemical formula 2], in reacting a pyrrolidinol derivative represented by the general formula (1) [Chemical formula 1] with a benzyl halide derivative in the presence of an alkali metal hydroxide, wherein the reaction is carried out in either of the following conditions A or B; condition A: an aprotic polar solvent, and condition B: an aliphatic ether solvent containing a phase transfer catalyst:
US07772405B2	3-alkyl-5- (4-alkyl-5-oxo-tetrahydrofutran-2-yl) pyrrolidin-2-one derivatives as intermediates in the synthesis of renin inhibitors The invention related to a novel process, novel process steps and novel intermediates useful in the synthesis of pharmaceutically active compounds, especially renin inhibitors, such as Aliskiren. Inter alia, the invention relates to a process for the manufacture of a compound of the formula II, or a salt thereof, and a compound of formula VI or a salt thereof, wherein R3 and R4 as well as Act are as defined in the specification, and processes of manufacturing these. Additionally transformation of compounds (VI) with metallo organic compounds (VII) give rise to the new compounds (VIII) which are direct precursors for the preparation of Aliskiren.
US07772404B2	Crystalline form 2 of the chemotherapeutic N-[4-(3-amino-1H-indazol-4-yl)phenyl]-N′-(2-fluoro-5-methylphenyl)urea N-[4-(3-Amino-1H-indazol-4-yl)phenyl]-N′-(2-fluoro-5-methylphenyl)urea Crystalline Form 2, ways to make it, formulations comprising it and made with it and methods of treating patients having disease using it are disclosed.
US07772401B2	Process for the preparation of lercanidipine The invention provides a novel process for the preparation of lercanidipine or a pharmaceutical acceptable salt using novel intermediates. Thus, 2,N-dimethyl-N-(3,3-diphenylpropy1)-1-amino-2-propanol is reacted with trimethylsilyl chloride in presence of triethyl amine in methylene chloride to give 2,N-dimethyl-2-(trimethylsilyloxy)-N-(3,3-diphenylpropy1)-1-propanamine, which is then reacted with 2,6-dimethyl-5-methoxycarbonyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3-carbonyl chloride for 2 hours and crystallized to obtain lercanidipine hydrochloride.
US07772399B2	Process for amorphous form of donepezil hydrochloride The present invention provides a novel process for the preparation of amorphous form of donepezil hydrochloride.
US07772397B2	Biologically active peptides and compositions, their use This invention relates to derivatives of hemiasterlin or Geodiamolide G having anti-mitotic activities and useful in treating cancer. These derivatives are represented by general formula I, wherein Y, n, R1, R2, R3, R6, R7, R70, R71, R72, R74, and R75 are as defined in the specification.
US07772391B2	Ethersuccinylated hydroxyl polymers Ethersuccinylated hydroxyl polymers, processes for making ethersuccinylated hydroxyl polymers, and uses of ethersuccinylated hydroxyl polymers are provided.
US07772390B1	Lipid mediated nucleic acid synthesis Methods and compositions for synthesizing polymers, such as nucleic acids, are provided. Aspects of the invention include methods in which lipids and monomeric precursors, e.g., mononucleotides, of the desired polymeric products are combined to produce a reaction mixture. The reaction mixture is then subjected to one or more steps of drying and rehydrating to produce a desired polymeric product, e.g., nucleic acid. Also provided are the polymeric products themselves, e.g., nucleic acid products, as well as systems and kits for practicing embodiments of the invention.
US07772389B2	Anti-microRNA oligonucleotide molecules The invention relates to isolated anti-microRNA molecules. In another embodiment, the invention relates to an isolated microRNA molecule. In yet another embodiment, the invention provides a method for inhibiting microRNP activity in a cell.
US07772387B2	Oligonucleotides comprising a modified or non-natural nucleobase One aspect of the present invention relates to a double-stranded oligonucleotide comprising at least one non-natural nucleobase. In certain embodiments, the non-natural nucleobase is difluorotolyl, nitroindolyl, nitropyrrolyl, or nitroimidazolyl. In a preferred embodiment, the non-natural nucleobase is difluorotolyl. In certain embodiments, only one of the two oligonucleotide strands comprising the double-stranded oligonucleotide contains a non-natural nucleobase. In certain embodiments, both of the oligonucleotide strands comprising the double-stranded oligonucleotide independently contain a non-natural nucleobase. In certain embodiments, the oligonucleotide strands comprise at least one modified sugar moiety. Another aspect of the present invention relates to a single-stranded oligonucleotide comprising at least one non-natural nucleobase. In a preferred embodiment, the non-natural nucleobase is difluorotolyl. In certain embodiments, the ribose sugar moiety that occurs naturally in nucleosides is replaced with a hexose sugar, polycyclic heteroalkyl ring, or cyclohexenyl group. In certain embodiments, at least one phosphate linkage in the oligonucleotide has been replaced with a phosphorothioate linkage.
US07772385B2	Chimeric T1R1 taste receptor encoding nucleic acid sequences and vectors Newly identified mammalian taste-cell-specific G protein-coupled receptors, and the genes and cDNA encoding said receptors are described. Specifically, T1R G protein-coupled receptors active in taste signaling, and the genes and cDNA encoding the same, are described, along with methods for isolating such genes and for isolating and expressing such receptors. Methods for representing taste perception of a particular tastant in a mammal are also described, as are methods for generating novel molecules or combinations of molecules that elicit a predetermined taste perception in a mammal, and methods for simulating one or more tastes. Further, methods for stimulating or blocking taste perception in a mammal are also disclosed.
US07772383B2	Chemical PCR: Compositions for enhancing polynucleotide amplification reactions A composition for performing a polynucleotide amplification reaction at low temperature, including a polynucleotide amplification reaction mixture into which is incorporated a sufficiently high concentration of a low molecular weight compound selected from the group consisting of amides, sulfones, sulfoxides and diols, to accomplish the amplification at the low temperature.In another embodiment, a composition for enhancing a polynucleotide amplification reaction, including a polynucleotide amplification reaction mixture into which is incorporated a low molecular weight diol in an amount effective to enhance the polynucleotide amplification.
US07772378B2	Glucopyranosyl-substituted ((hetero)arylethynyl-benzyl)-benzene derivatives, medicaments containing such compounds, their use and process for their manufacture Glucopyranosyl-substituted (hetero)arylethynyl-benzene derivatives of the general formula I where the groups R1 to R6 as well as R7a, R7b, R7c are defined according to claim 1, including the tautomers, the stereoisomers thereof, the mixtures thereof and the salts thereof. The compounds according to the invention are suitable for the treatment of metabolic disorders.
US07772377B2	Colorant compositions Disclosed is a colorant composition of the formula wherein R is an alkyl group, an aryl group, an arylalkyl group, or an alkylaryl group, and wherein R can be joined to the phenyl moiety to form a ring, R′ is an aromatic- or heteroaromatic-containing group, each Ra, independently of the others, is a halogen atom, an alkyl group, an alkoxy group, a nitrile group, a nitro group, an amide group, or a sulfonamide group, w is an integer of 0, 1, 2, 3, or 4, n is an integer representing the number of carbon atoms in each repeat alkylene oxide unit, and x is an integer representing the number of repeat alkylene oxide units, wherein said colorant has no more than one —OH, —SH, or primary or secondary amino group per molecule.
US07772376B2	Manufacturing process A process for the preparation of a desired chemical compound in a continuous reactor in which a part of the product stream exits the reactor and part of the product stream is recycled around the reactor in order to reduce the amount of buffer that would otherwise be required.
US07772371B2	Stimulators of Factor X activated (FXa) as new topical antihemorrhagic agents The activated coagulation Factor X (FXa) stimulating agents may be used in the treatment of hemorrhages in a subject. Compounds and combinations are described which are particularly useful for the topical treatment of hemorrhaging in healthy subjects or in patients with hemorrhagic diathesis.
US07772370B2	Antifungal polypeptides Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.
US07772368B2	Deletion forms of IGE-dependent histamine releasing factor having histamine releasing activity, HRF-binding peptides and the uses thereof The present invention relates to IgE-dependent histamine releasing factor (HRF) and HRF-binding peptides, more precisely, deletion forms of HRF which are able to be formed as dimers containing amino acid sequence represented by SEQ ID NO:3, genes encoding thereof and novel HRF-binding peptides having an activity of inhibiting HRF. The deletion forms of HRF which are able to be formed as dimers of the present invention induces intracellular secretion of histamine and IL-8, making an excellent candidate for a drug for inhibiting allergic reaction triggered by HRF and a kit for detecting HRF in serum of an allergy patient. In addition, novel HFR-binding peptides of the present invention bind to HRF to inhibit the actions of HFR, so they can be effectively used for the prevention and the treatment of allergic diseases of animals including asthma and rhinitis or malaria.
US07772367B2	C-terminal p53 palindromic peptide that induces apoptosis of cells with aberrant p53 and uses thereof Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.
US07772365B2	Soluble receptor BR43x2 Soluble, secreted tumor necrosis factor receptor polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed. The polypeptides comprise one cysteine-rich repeat that is homologous to other tumor necrosis factor receptors, such as transmembrane activator and CAML-interactor (TACI). The polypeptides may be used for detecting ligands, agonists and antagonists. The polypeptides may also be used in methods that modulate B cell activation.
US07772362B2	Treatment method for imparting self-healing and shape memory properties to certain CBDO copolymers A method of treating an amorphous CBDO polymer to impart self healing and shape memory properties by heat treatment, and products resulting from such method are described. An amorphous CBDO copolymer may include a copolyester prepared by reacting an aromatic dicarboxylic acid or ester or anhydride thereof, a 2,2,4,4-tetraalkyl-1,3-cyclobutanediol and 1,3-propanediol, 1,4-butanediol, or mixture thereof. The method may include heating said copolymer to a temperature above its glass transition temperature to impart self healing and shape memory properties.
US07772356B2	Infrared absorption filter The present invention discloses an infrared absorption filter which enables a coloring matter having infrared absorptivity to be contained or dispersed uniformly in a high concentration and has excellent durability, and an infrared absorption panel comprising this infrared absorption filter. The infrared absorption filter comprises a polycarbonate resin which contains 20 to 100 mol % of a recurring unit having a fluorene skeleton represented by the formula (1) and 0 to 80 mol % of a recurring unit represented by the formula (2), and a coloring matter having infrared absorptivity.
US07772353B2	Fast curing aliphatic RIM elastomers This invention relates to polyurethane elastomers and to a process for their production. These elastomers comprise the reaction product of a (cyclo)aliphatic isocyanate component having an NCO group content of about 20 to about 45%, with an isocyanate-reactive component comprising one or more polyether polyols which is free of amine groups, and a low molecular weight organic compound containing two hydroxyl groups and which is free of amine groups, in the presence of one or more catalysts.
US07772345B2	Modified novolak resin for use as tackifier The invention is related to a hydrocarbylphenol-formaldehyde linear novolak resin modified with a vinyl monomer. A modified, hydrocarbylphenol-formaldehyde linear novolak resin of the invention is prepared by reacting a hydrocarbyl phenol-formaldehyde linear novolak resin with a vinyl monomer in the presence of an acid catalyst. The invention also relates to a rubber compositions with improved tack comprising a rubber or mixture of rubbers, and the modified, hydrocarbylphenol-formaldehyde linear novolak resin.
US07772343B2	Polymeric product for film formation The present invention relates to core/shell vinyl polymers wherein an at least partially crosslinked core is formed from a monovinyl monomer and/or a di/tri/ or higher multivinyl monomer wherein the degree of crosslinking in the core ranges from slight to high depending on the ratio of monovinyl and/or di/tri/ or higher multivinyl monomers, and wherein the outer shell is formed from a monovinyl and/or a di/tri/ or higher multi-vinyl monomer that optionally may be crosslinked, and wherein the outer shell has on its surface linear or branched C.sub.3-C.sub.30 alkyl chains formed from substituted vinyl monomers.
US07772341B2	Norbornene compounds with cross-linkable groups and their derivatives The present invention provided a norbornene compound with cross-linkable groups and their derivative polymers, wherein said cross-linkable groups were olefin or epoxy groups. Norbornene polymers with cross-linkable side chain and their block copolymers as well as modified derivatives were prepared via living ring-open metathesis polymerization method. The resulting polymers with excellent solubility and optic properties had narrow molecular weight distribution, well-controlled molecular weight, small refraction index and high transparency. They were also suitable for preparing hybrid materials with high thermal stability and chemical resistance.
US07772339B2	Electrophoretic particles and production process thereof A process for producing electrophoretic particles containing core particles includes a step of forming the core particles by polymerization of a composition comprising a colorant, a first polymerizable monomer, a second polymerizable monomer having a functional group which is capable of reacting with a living radical polymerization initiation group precursor, and a polymerization initiator; a step of providing a living radical polymerization initiation group at a surface of each core particle by reacting a compound having the living radical polymerization initiation group precursor with the functional group; and a step of providing a polymer chain to the living radical polymerization initiation group by living radical polymerization.
US07772338B2	Use of a Ziegler-Natta catalyst to make a polypropylene homopolymer or random copolymer having a high melt flow rate The present invention relates to a process for the production of a high melt flow propylene homopolymer or random copolymer with low odor and low volatiles content, which is suitable for thin-walled injection molding applications, said process comprising the step of polymerizing propylene and one or more optional comonomers in presence of a Ziegler-Natta catalyst comprising a titanium compound having at least one titanium-halogen bond, and a diether compound as internal electron donor, both supported on a magnesium halide in active form, an organoaluminium compound and an optional external donor.
US07772337B2	Method of formulating a molecular sieve catalyst composition by controlling component addition This invention provides a method of making a molecular sieve catalyst composition comprising the steps of: a) combining molecular sieve crystals with binder and liquid to form a binder-sieve mixture; b) combining the binder-sieve mixture with matrix material to form a binder-sieve-matrix mixture; c) mixing the binder-sieve-matrix mixture under conditions sufficient to form a slurry having a solids content of at least 40 wt %, based on total weight of the slurry; d) progressing the mixing until slurry viscosity decreases without significant additional dilution of the slurry, so that the slurry solids content does not significantly decrease; and e) drying the decreased viscosity slurry to produce a dried molecular sieve catalyst composition having an attrition rate index of not greater than 1 wt %/hr. The aforementioned catalyst compositions can be used in processes for making olefin product from oxygenate feedstock, which olefin products can be further used for making (co)polymer products.
US07772334B2	Crosslinker of reactive functional groups and nonionic metal coordinating structure-containing alkyl or aromatic compound A crosslinker for polymerizing a film-forming material including an alkyl or aromatic compound comprising at least two functional groups reactive with a film-forming resin and at least one pendent group having a nonionic metal coordinating structure. Coating compositions can include a film-forming material and the crosslinker. The coating compositions can be used to coat a substrate, such as a metal substrate. Applied coating layers on substrates can be cured to form coating films.
US07772333B2	Film-forming material containing resin with -Si(OR)3 and crosslinkable groups Film-forming materials include resins and/or crosslinkers having a —Si(OR)3 group. Film-forming resins can include epoxy, acrylic, polyurethane, polycarbonate, polysiloxane, polyvinyl, polyether, aminoplast, and polyester resins. A process to produce a film-forming resin includes reacting various polymers to incorporate a pendent group comprising a —Si(OR)3 group. Film-forming resins can be used in methods of producing coating compositions. Coating compositions can be used to coat a substrate, such as a metal substrate, by electrodeposition. Applied coatings containing the film-forming resins can be cured to form crosslinked films on substrates.
US07772332B2	Curable composition An object is to provide a curable composition having a good curability by use of an organotin-free catalyst, and the object is solved by a curable composition, comprising: (A) a polymer having a silicon group which can be crosslinked through formation of a siloxane bond, (B) fluorosilanes represented by general formula (1): R14-aSiFa (1) (wherein R1's, the number of which is 4-a, are each independently a substituted or unsubstituted hydrocarbon group having 1 to 20 carbon atoms, or at least one selected from the group consisting of siloxy groups represented by R23SiO— (wherein R2's are each independently a substituted or unsubstituted hydrocarbon group having 1 to 20 carbon atoms or a fluorine atom), and a is any of 1, 2 or 3), and (C) an amine based compound.
US07772329B2	Toughened nylon, the process of preparing it and its use A toughened nylon that comprises a matrix nylon and a long-chain nylon is described. The matrix nylon is prepared by the homopolymerization or copolymerization of cyclic lactams monomers and their corresponding amino acids. The structure of said cyclic lactams is represented by Formula (I) and the structure of amino acids is represented by (I′). In Formula (I) and (I′) A is H or alkyl with 1-8 carbon and 3≦n≦11. The long-chain nylon is selected from nylons that contain repeating units having structures represented by Formula (II), (III) or (IV). In Formula (II) D is —(CH2)x—, in which H may be substituted with C1-4 alkyl optionally; E is —(CH2)y— or phenylene, in which H may be substituted with C1-4 alkyl optionally; 4≦x≦34 and 4≦y≦34. In Formula (IV) 5≦u≦34, 5≦v≦34, and u≠v. The proportion of said long-chain nylon in the total weight of toughened nylon is 2-45%. As the toughened nylon has very good interface combination, only one melting peak is detected with differential scanning calorimetry. Besides the preparation process and application of the toughened nylon are described hereafter too.
US07772315B2	Triboluminescent materials and golf balls made from such materials A golf ball made from a composition that includes at least one triboluminescent material. In one embodiment, the golf ball includes a core; an outer cover layer; one or more intermediate layers; and a coating layer disposed on the outer cover layer, wherein at least one of the core, the outer cover layer, the intermediate layer, or the coating layer comprises at least one triboluminescent material. In another embodiment, the golf ball includes a core; an outer cover layer; and one or more intermediate layers; wherein at least one of the core, the outer cover layer, or the intermediate layer comprises at least one triboluminescent material.
US07772314B2	Masking material for holes of a component Process of masking cooling holes of a gas turbine component with an external surface, comprising a cavity and a plurality of cooling holes before coating the gas turbine component, comprising the steps of first applying a mask material to the cooling holes so that the cooling holes are filled at least closest to the external surface, whereby the mask material contains a substance which fluoresces under ultraviolet light and a filler material. Then the mask material within the cooling holes is thickening. An inspection using ultraviolet light to locate any unwanted residual mask material on the external surface is carried out and unwanted residual mask material is removed before the coating is applied to the external surface of the component and the masked cooling holes. In the end the mask material is removed from the cooling holes.
US07772313B2	Pumpable heat-processable liquid dispersions for forming fused thermoplastic solids A composition that includes first solid particles including a first polymer, second solid particles including a second polymer, and a liquid into which the first solid particles and the second solid particles are dispersed, wherein the composition is a pumpable liquid dispersion at room temperature, wherein the first polymer, the second polymer and the liquid become compatible and form a substantially homogeneous molten blend when the pumpable liquid dispersion is heated and mixed, wherein the substantially homogeneous molten blend forms a fused thermoplastic solid when the substantially homogeneous molten blend cools to a solidification temperature, wherein the liquid is retained in the fused thermoplastic solid and wherein the first polymer is at least partially incompatible with the liquid retained in the fused thermoplastic solid.
US07772312B2	Reinforced polyurethane-urea elastomers and their use The invention relates to reinforced polyurethane-urea elastomers with a specific urea content and a specific urethane content, to sheet polyurethane moldings with high surface energy and good lacquer adhesion produced therefrom, and to their use.
US07772311B2	Non-stick finish composition A composition is provided that is applicable for providing a non-stick abrasion-resistant coating on a surface, but not as a primer layer, said composition comprising fluoropolymer and an effective amount of ceramic particles having an average size of at least about 10 micrometers to improve the abrasion resistance of said coating on said surface by at least 10% as determined by the dry SBAR method, said composition optionally containing adhesion promoter in an amount up to about 10 wt % of the wt. of said fluoropolymer.
US07772309B2	Thermoplastic polyurethanes containing a salt of zirconium phosphate Thermoplastic polyurethane (TPU) compositions are disclosed comprising TPU polymer, polyisocyanate, and a salt of zirconium phosphate. The compositions have enhanced thermal properties, good processability, and good hydrolysis resistance. Processes are also disclosed to combine the ingredients by melt mixing or to prepare the compositions in-situ as the TPU is being polymerized.
US07772304B2	Plasticizing component and a curable coating composition including the same A curable coating composition includes a plasticizing component. The plasticizing component includes an isocyanurate core and at least one low surface tension group pending from the isocyanurate core. The low surface tension group may be a) a fatty chain includes at least 6 carbon atoms, b) a silicon-containing group having at least 1 silicon atom, c) a fluorocarbon, and combinations thereof. The low surface tension group may have cross-linkable functional groups pending therefrom. In addition to the plasticizing component, the curable coating composition further includes a resin component and a crosslinking agent that is reactive with the resin component. The curable coating composition including the plasticizing component is capable of forming a cured film that has resistance to both cracking and etching that, to date, has not been achieved with known plasticizing components.
US07772301B2	Low volatile adhesive for roofing systems A bitumen based adhesive that includes asphalt and/or coal tar and at least one silylated polymer and/or silyl-terminated polymer. The bitumen based adhesive can also include a plasticizer.
US07772296B2	Antimicrobial polyurethane resins and products made therefrom The present invention provides novel antimicrobial polyurethane compositions having excellent mechanical and biocompatibility properties, and methods to prepare them. The antimicrobial polyurethane compositions include a homogenous distribution of silver ions by incorporating this antimicrobial agent into the composition prior to the complete polymerization of the polyurethane. In preferred embodiments, the silver ion is associated with a carrier, such as zirconium phosphate or soluble glass powder. The present invention also includes components made from the antimicrobial polyurethane compositions, such as medical devices.
US07772295B2	Resin compositions, cured article obtained therefrom, and sheet To provide a resin composition excellent in conformability to special shapes and in holding power without the need of containing a low molecular softener such as a plasticizer, other than a polysiloxane, and a cured product and a sheet using it.A resin composition characterized by comprising (a) an acrylic rubber, (b) a compound containing at least two mercapto groups per molecule, (c) a compound containing at least two acryloyl and/or methacryloyl groups per molecule, (d) an acrylate and/or methacrylate having a C2-12 alkyl group, and (e) acrylic acid or methacrylic acid. The above resin composition which contains a thermally conductive filler. A cured product and sheet using it.
US07772294B2	Fire resistant materials A method for forming a fire resistant material is disclosed. The method comprises providing a plurality of expandable beads of a polymeric material. The beads are coated with an exfoliable graphite. The exfoliable graphite is adhered to the beads with a resin having a solubility parameter of the polymeric material. The beads are thereafter caused or allowed to expand and fuse.
US07772291B2	Production of liquid and, optionally, gaseous hydrocarbons from gaseous reactants into an expanded slurry bed A process for producing liquid and, optionally, gaseous products from gaseous reactants includes feeding at a low level a gaseous reactants feed comprising at least CO and H2 into an expanded slurry bed of solid non-shifting hydrocarbon synthesis catalyst particles suspended in a suspension liquid, the expanded slurry bed having an aspect ratio of less than 5. The gaseous reactants and any recycled gas are allowed to react with a per pass CO plus H2 conversion of at least 60% as they pass upwardly through the slurry bed at a gas velocity of at least 35 cm/s, thereby to form liquid and, optionally, gaseous products, and with the gaseous reactants and any recycled gas and any gaseous product assisting in maintaining the solid catalyst particles in suspension in the suspension liquid, and with the liquid product forming together with the suspension liquid, a liquid phase of the slurry bed.
US07772290B2	Method to prepare a nanosized-structure film of multi-phobic effects and its application A method to prepare multi-phobic effects nanosized-structure film and its application are described, which features nanosized silica, titanium oxide and zinc oxide compounded materials of previous size 3-100 nm are in-situ combined with substrate through fluorocarbon surfactants and perfluoro alkyl filming substance under specific conditions to form a nanosized-structure film. The reaction between fluorocarbon surfactants and hydroxyl groups on surfaces of nanosized particles renders the modified nanosized particle and nanosized film having extremely high chemical stability, resistance, and the capacity to repel and disperse water, oil, bacteria, organic dust, gas, electricity, magnetism and light (i.e., multi-phobic effects). This technology may be widely used in surface modification of fabric, chemical fiber, cotton, wool, glass product, brick-stone concrete and wood wall.
US07772284B2	Method for the treatment or prevention of virus infection using polybiguanide-based compounds An inexpensive, easily available, and convenient method of treating or preventing a virus infection is provided. The present invention relates to a method for the treatment or prevention of virus infections using polybiguanide-based compounds administering a therapeutically effective amount of a compound or a pharmaceutically acceptable salt thereof. The invention relies on the unique biochemical reaction in which polybiguanide-based compounds interfere with the spread of virus within or between organisms. The compositions and formulations described in the present invention are effective means to reduce the infectivity of the human immunodeficiency virus type 1 (HIV-1), and human herpes simplex viruses, and also to kill the causative organisms of many other sexually transmitted diseases (STDs).
US07772283B2	Synergistic insecticidal compositions The present invention provides a synergistic insecticidal composition comprising as essential active ingredients a neuronal sodium channel antagonist in combination with one or more compounds selected from the group consisting of pyrethroids, pyrethroid-type compounds, recombinant nucleopolyhedroviruses capable of expressing an insect toxin, organophosphates, carbamates, formamidines, macrocyclic lactones, amidinohydrazones, GABA antagonists and acetylcholine receptor ligands.Also provided are methods for synergistic insect control and crop protection.
US07772281B2	Synergistic insecticidal compositions The present invention provides a synergistic insecticidal composition comprising as essential active ingredients a neuronal sodium channel antagonist in combination with one or more compounds selected from the group consisting of pyrethroids, pyrethroid-type compounds, recombinant nucleopolyhedroviruses capable of expressing an insect toxin, organophosphates, carbamates, formamidines, macrocyclic lactones, amidinohydrazones, GABA antagonists and acetylcholine receptor ligands.Also provided are methods for synergistic insect control and crop protection.
US07772278B2	Nitrosated and nitrosylated prostaglandins, compositions and methods of use The invention describes novel nitrosated and/or nitrosylated prostaglandins, and novel compositions comprising at least one nitrosated and/or nitrosylated prostaglandin, and, optionally, at least one compound that donates, transfers or releases nitric oxide, elevates endogenous levels of endothelium-derived relaxing factor, stimulates endogenous synthesis of nitric oxide or is a substrate for nitric oxide synthase, and/or at least one vasoactive agent. The invention also provides novel compositions comprising at least one prostaglandin and at least one S-nitrosothiol compound, and, optionally, at least one vasoactive agent. The prostaglandin is preferably a prostaglandin E1 compound, more preferably alprostadil, and the S-nitrosothiol compound is preferably S-nitrosoglutathione. The invention also provides methods for treating or preventing sexual dysfunctions in males and females, for enhancing sexual responses in males and females, and for treating or preventing cerebrovascular disorders, cardiovascular disorders, benign prostatic hyperplasia (BPH), glaucoma, peptic ulcers or for inducing abortions.
US07772277B2	Formulations comprising fenofibrate and a statin, and related methods of treatment The invention provides novel omega-3 oil formulations comprising fenofibrate and a statin. These formulations are effective in small volumes. Related methods of treatment are also described.
US07772272B2	Method for enhancing glucose uptake into warm-blooded animal adipocytes The present invention provides a pharmaceutical composition for enhancement of glucose uptake into warm-blooded animal cells, treatment of diabetes, treatment or prevention of diabetes complications etc., treatment or prevention of diabetes or diabetes complications caused by insulin resistance syndrome, and the like, comprising as an active ingredient an HMG-CoA reductase inhibitor.
US07772271B2	Methods for treating hepatitis C The present invention provides compounds, pharmaceutical compositions, and methods of using such compounds or compositions for treating infection by a virus, or for affecting viral IRES activity.
US07772269B2	Pyrazole analogs The invention relates to the compounds of formula (I): or a pharmaceutically acceptable salt and solvate thereof, wherein R1 is F or H and to processes for the preparation of, intermediates used in the preparation of, compositions containing the uses of, such compounds. The compounds according to the present invention are useful in numerous diseases, disorders and conditions, in particular allergic and respiratory diseases, disorders and conditions.
US07772262B2	Substituted benzoylguanidines, method for production and use thereof as medicament or diagnostic and medicament comprising the same The present invention relates to substituted benzoylguanidines of the formula I: in which R1 to R8 and X and Y are as described in the specification, and their pharmaceutically acceptable salts are substituted acylguanidines as inhibitors of the cellular sodium-proton antiporter (Na+/H+ exchanger, NHE).
US07772252B2	Heterocyclic substituted carbonyl derivatives and their use as dopamine D3 receptor ligands The invention relates to heterocyclic substituted carbonyl derivatives that display selective binding to dopamine D3 receptors. In another aspect, the invention relates to a method for treating central nervous system disorders associated with the dopamine D3 receptor activity in a patient in need of such treatment comprising administering to the subject a therapeutically effective amount of said compounds for alleviation of such disorder. The central nervous system disorders that may be treated with these compounds include Psychotic Disorders, Substance Dependence, Substance Abuse, Dyskinetic Disorders (e.g. Parkinson's Disease, Parkinsonism, Neuroleptic-Induced Tardive Dyskinesia, Gilles de la Tourette Syndrome and Huntington's Disease), Dementia, Anxiety Disorders, Sleep Disorders, Circadian Rhythm Disorders and Mood Disorders. The subject invention is also directed towards processes for the preparation of the compounds described herein as well as methods for making and using the compounds as imaging agents for dopamine D3 receptors.
US07772249B2	Imidazo[1,2-b]pyridazine compound The present invention provides a novel compound having an excellent corticotrophin-releasing-factor receptor antagonistic activity. That is, it provides a compound represented by the following formula or a salt thereof. Wherein R1 denotes a hydrogen atom, a C1-6 alkyl group, a C1-6 alkoxy group and the like; R2 denotes a halogen atom, a cyano group, a nitro group, a C1-10 alkyl group, a C2-10 alkenyl group, C2-10 alkynyl group and the like; R3 denotes a C6-14 aromatic hydrocarbon cyclic group or a 5- to 14-membered aromatic heterocyclic group, each of which may have a substituent; and X, Y and X are independent of each other and each denotes N or CR4 (wherein R4 denotes a hydrogen atom, a halogen atom, a cyano group, a nitro group, an optionally halogenated C1-6 alkyl group and the like) and, in this case, at least two of X, Y and Z denote CR4.
US07772248B2	Preparation and utility of substituted imidazopyridine compounds with hypnotic effects The present disclosure is directed to modulators of GABAA receptors and pharmaceutically acceptable salts and prodrugs thereof, the chemical synthesis thereof, and the medical use of such compounds for the treatment and/or management of sleep disorders and/or for providing a patient in need with a hypnotic, anxiolytic or anti-convulsive effect are described.
US07772244B2	Therapeutic agents for the treatment of migraine The present invention relates to compounds of Formula (I) as antagonists of calcitonin gene-related peptide receptors (“CGRP-receptor”), pharmaceutical compositions comprising them, methods for identifying them, methods of treatment using them and their use in therapy for treatment of neurogenic vasodilation, neurogenic inflammation, migraine and other headaches, thermal injury, circulatory shock, flushing associated with menopause, airway inflammatory diseases, such as asthma and chronic obstructive pulmonary disease (COPD), and other conditions the treatment of which can be effected by the antagonism of CGRP-receptors.
US07772240B2	Trans-1(6-chloro-3-phenylindan-1-yl)-3,3-dimethylpiperazine A compound 4-((1R,3S)-6-Chloro-3-phenylindan-1-yl)-2,2-dimethylpiperazine and salts thereof, pharmaceutical compositions comprising the compound and salts, and medical use thereof, including for treatment of schizophrenia and other psychotic disorders.
US07772239B2	Benzoimidazolone-carboxamide compounds as 5-HT4 receptor agonists The invention provides novel benzoimidazolone-carboxamide 5-HT4 receptor agonist compounds. The invention also provides pharmaceutical compositions comprising such compounds, methods of using such compounds to treat diseases associated with 5-HT4 receptor activity, and processes and intermediates useful for preparing such compounds.
US07772236B2	Substituted pyrazoles Substituted pyrazoles, methods of manufacturing them, compositions containing them, and methods of using them to treat, for example, autoimmune diseases mediated by cathepsin S.
US07772234B2	Bicyclic inhibitors of MEK and methods of use thereof Disclosed are compounds of the Formula I and pharmaceutically acceptable salts and prodrugs thereof, wherein R1, R2, R8, R9 and R10, W, X, and Z are as defined in the specification. Such compounds are MEK inhibitors and useful in the treatment of hyperproliferative diseases, such as cancer and inflammation, in mammals, and inflammatory conditions. Also disclosed are methods of using such compounds in the treatment of hyperproliferative diseases in mammals and pharmaceutical compositions containing such compounds.
US07772231B2	Substituted pyrazolo[3,4-d]pyrimidines as protein kinase inhibitors Compounds of formula (25) that inhibit protein kinases, compositions containing the compounds and methods of treating diseases using the compounds are disclosed.
US07772230B2	Chroman compound, processes for its preparation, and its pharmaceutical use The present invention provides a chroman compound of formula (I) and its pharmaceutical salt, methods of its preparation and its pharmaceutical applications. Wherein: X is O or S; n is for 2, 3 or 4; R1 is 6-substituted or 7-substituted halogen, C1-4alkyl, C1-4alkoxyl, benzyloxy, carbamoyl; R2 is nitrogen-containing five-membered or six-membered substituted heterocyclic ring selected from piperidinyl, morpholinyl, N-methyl-piperazinyl, N-(2-ethoxyl)piperazinyl, pyrrolyl, pyrazolyl or imidazolyl. The compounds are useful to prepare medicaments for treating cardiovascular diseases, their preparation employs mild reaction conditions, the raw material are plenty and easy to be obtained, and the operation and post-treatment in the preparation are simple.
US07772227B2	Tricyclic 1-[(indol-3-yl)carbonyl]piperazine derivatives as cannabinoid CB1 receptor agonists The invention relates to tricyclic 1-[(indol-3-yl)carbonyl]piperazine derivative having the general Formula (I) wherein X is CH2, O or S; R represents 1-3 substituents independently selected from H, (C1-4)alkyl, (C1-4)alkyloxy and halogen; R1 is (C5-8)cycloalkyl; R2 is H or (C1-4)alkyl; R3, R3′, R4′ R4′, R5, R5′ and R6′ are independently hydrogen or (C1-4)-alkyl, optionally substituted with (C1-4)alkyloxy, OH or halogen; R6 is hydrogen or (C1-4)alkyl, optionally substituted with (C1-4)alkyloxy, OH or halogen; or R6 forms together with R7 a 4-7 membered saturated heterocyclic ring, optionally containing a further heteroatom selected from O and S; R7 forms together with R6 a 4-7 membered saturated heterocyclic ring, optionally containing a further heteroatom selected from O and S; or R7 is H, (C1-4)alkyl or (C3-5)cycloalkyl, the alkyl groups being optionally substituted with OH, halogen or (C1-4)alkyloxy; or a pharmaceutically acceptable salt thereof. The invention also relates to pharmaceutical compositions comprising said tricyclic 1-[(indol-3-yl)carbonyl]piperazine derivatives, and to the use of these derivatives in the treatment of pain, such as peri-operative pain, chronic pain neuropathic pain, cancer pain, and pain and spasticity associated with multiple sclerosis.
US07772225B2	N-sulfamoyl-piperidineamides for the treatment or inhibition of obesity and related conditions The present invention relates to novel N-sulfamoyl-piperidineamides of Formula I and their physiologically acceptable acid addition salts, to pharmaceutical compositions comprising them, processes for their preparation, and their use for the treatment of obesity and its concomitant and/or secondary diseases and related or other conditions.
US07772222B2	Polar hydrophilic prodrugs of amphetamine and other stimulants and processes for making and using the same Disclosed are polar, hydrophilic stimulant prodrug compositions comprising at least one stimulant chemically attached to a polar hydrophilic ligand, a salt thereof, a derivative thereof, or a combination thereof. Methods of making and using the same are also disclosed.
US07772218B2	Synthesis of anti-estrogenic and other therapeutic steroids from 21-hydroxy-19-norpregna-4-en-3-one Syntheses of steroids such as 3-hydroxy-7α-methyl-21-[2′-methoxy-4′-(diethylaminomethyl)-phenoxy]-19-norpregna-1,3,5(10)triene citrate (“SR 16234”) and analogs thereof are provided, wherein 21-hydroxy-19-norpregna-4-en-3-one serves as a starting material or intermediate. The latter compound may be readily prepared from estrone-3-methyl ether. Certain intermediates in these syntheses also have value as therapeutic agents, for example in the treatment of prostate disorders such as prostatic cancer.
US07772211B2	Production of carrageenan and carrageenan products The methods of the present invention prepare carrageenan products from processed seaweed material having a solids content of less than 25% by weight solids, using shear stress treatment. The carrageenan products comprise at least about 60% by weight of carrageenan and at least about 2% by weight of acid insoluble material. The carrageenan products of the present invention are useful as components in food products, such as, dairy products, meats, and dessert gels as well as non-food products, such as, toothpaste formulations, cosmetics, paints, films and delivery capsules.
US07772210B2	Cystitis treatment with high dose chondroitin sulfate Interstitial cystitis and related GAG-deficient conditions of the bladder and urinary tract are treated by instillation of high dose chondroitin sulfate, such as 400 mg/20 mL. The higher dose of chondroitin is effective for the rapid reduction of symptoms, particularly in patients with severe and otherwise recalcitrant cystitis.
US07772206B2	Methods and compositions for the treatment of autoimmune disorders using clofarabine This invention relates to methods of treating or preventing an autoimmune disorder comprising the administration of clofarabine or a pharmaceutically acceptable salt, hydrate, solvate, clathrate, prodrug or metabolite thereof to a patient in need of such treatment. The invention further relates to methods of treating or preventing an autoimmune disorder comprising the administration of clofarabine or a pharmaceutically acceptable salt, hydrate, solvate, clathrate, prodrug or metabolite thereof and an additional therapeutic agent to a patient in need of such treatment.
US07772203B2	Methods and compositions for controlling efficacy of RNA silencing Based at least in part on an understanding of the mechanisms by which small RNAs (e.g., naturally-occurring miRNAs) mediate RNA silencing in plants, rules have been established for determining, for example, the degree of complementarity required between an RNAi-mediating agent and its target, i.e., whether mismatches are tolerated, the number of mismatches tolerated, the effect of the position of the mismatches, etc. Such rules are useful, in particular, in the design of improved RNAi-mediating agents which allow for more exact control of the efficacy of RNA silencing.
US07772202B2	Methods for treating breast cancer using NRIF3 related molecules Disclosed herein is the discovery that administration of the NRIF3 family of transcriptional coregulators (NRIF3 and related molecules) to breast cancer cells induce rapid and profound apoptosis (nearly 100% cell death within 24 h). A novel death domain (DD1) was mapped to a short 30 amino acid region common to all members of the NRIF3 family. Two other death domains (DD2 and DD3) were also found to have effective breast cancer killing activities. Mechanistic studies showed that DD1-induced apoptosis occurred through a novel caspase-2 mediated pathway that involved mitochondria membrane permeabilization but did not require other caspases. Interestingly, cytotoxicity of NRIF3 related molecules was cell-type specific, as they selectively killed breast cancer or related cells but not other examined cells of different origins, suggesting the presence in breast cancer cells of a specific death switch that can be selectively triggered by NRIF3 and related molecules. Also disclosed are strategies utilizing NRIF3 related molecules and/or targeting this death switch for the development of novel and more selective therapeutics against breast cancer.
US07772192B2	Compositions and methods for treatment of disease with acetylated disaccharides Compositions and methods for treatment of disease with acetylated disaccharides and analogs thereof are provided.
US07772191B2	Processes for preparing of glucopyranosyl-substituted benzyl-benzene derivatives and intermediates therein The present invention relates to processes for preparing the compounds of general formula I, wherein the groups R1 and R3 are defined according to claim 1. Furthermore this inventions relates to intermediates obtained in these processes.
US07772190B2	Didepsipeptide-based endoparasiticides, new didepsipeptides and process for preparing the same The present invention relates to the use of didepsipeptides of the general formula (I) and their salts in which the radicals have the meaning given in the description, and to new didepsipeptides and processes for their preparation.
US07772187B2	Substances directed against a specific sequence essential for heparanase catalytic activity and uses thereof as heparanase inhibitors An amino acid sequence derived from the N′ terminus region of the 50 Kd subunit of heparanase, preferably, the sequence including amino acid residues Lys158-Asn171 of human heparanase and any functional fragments thereof. Compositions for the inhibition of heparanase glycosidase catalytic activity, having as an active ingredient an isolated and purified peptide as the amino acid sequence. An antibody directed to the sequence and compositions and uses thereof as heparanase inhibitor. The use of the amino acid sequence in a screening method for specific heparanase inhibitors. Compositions including the heparanase inhibitors and methods for the treatment of heparanase related disorders.
US07772184B2	Use of a cyclosporin for the treatment of hepatitis C infection and pharmaceutical composition comprising said cyclosporin This invention relates to the use in the treatment of HCV infection, either as single active agents or in combination with another active agent, of a cyclosporin having increased cyclophilin binding activity and essentially lacking immunosuppressive activity.
US07772181B2	Personal care compositions comprising modified variant Bowman Birk Protease Inhibitors The present invention relates to compositions that comprise modified variant Bowman Birk Protease Inhibitor proteins (BBPIs). The modified variant BBPIs comprise peptides that bind target proteins, and that are further modified to have greater protease inhibitory activity and/or be produced at greater yields than the unmodified BBPIs. The invention encompasses the compositions comprising the modified variant BBPIs, and the methods for making and using the compositions in personal care.
US07772175B2	Detergent compositions for cleaning and fabric care comprising a benefit agent, deposition polymer, surfactant and laundry adjuncts Detergent compositions comprising selected deposition polymers for improved deposition of fabric care benefit agents, such as organosilicones, polyolefin dispersions, polymer latexes, microencapsulated fabric care actives, onto fabrics through the laundering operation.
US07772171B2	Method of lubricating an internal combustion engine and improving the efficiency of the emissions control system of the engine An internal combustion engine with a catalyst-containing exhaust-gas aftertreatment device is lubricated with a composition of a base oil; and a zinc salt of a mixture of phosphorus-containing compounds having hydrocarbyl groups R1 and R2 where the average total number of carbon atoms in R1 plus R2 for the mixture of phosphorus-containing compounds is at least 9.5, where 4 to 30 weight percent of such groups contain 2 to 4 carbon atoms and where in less than 8 mole percent of the phosphorus-containing molecules in the mixture of phosphorus-containing compounds each of R1 and R2 contain 2 to 4 carbon atoms.
US07772168B2	Vegetable oil lubricating composition A lubricating composition includes, in weight %, at least 90 percent of a vegetable oil, and an additive composition including: (a) about 1.5 to 2 percent triphenylphosphorothionate (TPPT), (b) about 0.1 to 3 percent hindered phenolic antioxidant, (c) about 0.05 to 0.25 percent 1-[di(phenyl)aminomethyl]tolutriazole, and (d) about 0.05 to 0.5 percent alkyl succinic acid half ester rust inhibitor.
US07772165B2	Polycationic viscoelastic compositions Viscoelastic compositions are disclosed herein containing an effective amount of one or more random or structurally defined polycationic quaternary ammonium compounds for controlling the viscoelasticity of the composition. In at least one aspect, the present technology provides polycationic quaternary ammonium compounds comprising dissymmetric bis-quaternary compounds. In another aspect, the present technology provides viscoelastic compositions comprising polycationic quaternary ammonium compounds that comprise dissymmetric bis-quaternary compounds. In yet another aspect, the present technology provides polycationic quaternary ammonium compounds comprising a carboxylate functional polycationic quaternary ammonium compound. Preferred viscoelastic compositions of the present technology maintain viscoelasticity at a temperature greater than about 80° C., preferably greater than about 100° C. or about 110° C. when the amount of the one or polycationic quaternary compounds is less than about 10% by weight based on the total weight of the composition.
US07772163B1	Well treating composite containing organic lightweight material and weight modifying agent Well treating composites are composed of an organic lightweight material and a weight modifying agent. The organic lightweight material preferably forms the continuous phase and the weight modifying agent forms the discontinuous phase. The apparent specific gravity (ASG) of the organic lightweight material is less than the ASG of the well treating composite. The composite of the invention is particularly useful in hydraulic fracturing fluids as lightweight proppants as well as in sand control methods, such as gravel packing and frac packing A subterranean formation may be treated by injecting the well treating composite into the formation in order to increase fracture conductivity, reduce the generation of fines, reduced unwanted water production and/or reduce particulate production.
US07772160B2	Method for controlled placement of additives in oil and gas production Pellets can be injected into oil and gas production equipment that may contain stagnant or slow moving system fluids to treat the stagnant or slow moving system fluids to prevent conditions such as corrosion. The pellets have a density such that they may be moved through the equipment by system fluids passing therethrough. When the pellets come into contact with the stagnant or slow moving system fluids, sufficient pellets enter the stagnant or slow moving system fluids to treat it. It is emphasized that this abstract is provided to comply with the rules requiring an abstract which will allow a searcher or other reader to quickly ascertain the subject matter of the technical disclosure. It is submitted with the understanding that it will not be used to interpret or limit the scope or meaning of the claims.
US07772159B2	Solution and solid phase synthesis of pyrrolinones and polypyrrolinones The invention provides a new process for the preparation of polypyrrolinones (I) of various sizes which have found to be useful peptidomimetics. One aspect of the invention is a new process utilizing α-amino-α-substituted-valerolactones as synthons. A second aspect of the invention is a process for the synthesis of polypyrrolinones using solid-phase techniques.
US07772154B2	Methods for making immobilized aryl-containing ligands Organic ligands that contain at least one aryl group are immobilized on a solid support. The organic ligands are of the type used to form a catalyst complex suitable for carrying out a catalytic reaction, preferably an asymmetric reaction. To immobilize the organic ligands, a tethering group is bonded to the ligand using, for example, a Friedel-Crafts acylation or alkylation reaction. The immobilization of the organic ligand can be carried out using a single reaction with the organic ligand.
US07772153B2	Separating agent for enantiomeric isomers The present invention provides a separating agent for enantiomeric isomers which exhibits high optical resolving power together with solvent resistance. That is, the present invention provides a separating agent for enantiomeric isomers including a polysaccharide derivative such as a carbamate derivative or ester derivative of cellulose or amylose carried on a porous carrier such as silica gel, in which the porous carrier having an epoxy group and part of the hydroxyl groups of the polysaccharide derivative are chemically bonded.
US07772152B2	Composite polymer-coated sorbent with a bidisperse pore size distribution for the simultaneous separation and desalting of biopolymers A composite polymer-coated sorbent with a bidisperse or oligodisperse distribution of pore sizes and having an at least partial coating on its surface, which coating comprises essentially polyanilines or derivatives of polyanilines and use thereof for the simultaneous separation and desalting of bio-macromolecules.
US07772147B2	Catalyst carrier substrate coated with washcoat comprising fibrous material A solid catalyst carrier substrate coated with a surface area-enhancing washcoat composition including a catalytic component, a metal oxide and a refractory fibrous or whisker-like material having an aspect ratio of length to thickness in excess of 5:1.
US07772146B2	Artificial bone and joint compositions The present invention provides a ceramic porous body for in-vitro and in-vivo use comprising a composition comprising a calcium aluminate (CA) containing phase and optionally at least one of an accelerator, a retarder, a surfactant, a foaming agent, a reactive alumina, water, a fiber, and a biologically active material, and combinations thereof. Ceramic compositions are provides as well as method of using the ceramic compositions and methods of manufacturing a ceramic porous body. The ceramic porous bodies of this invention may be used as artificial bones, joints, in-vitro support structures, and in-vivo support structures for cells, tissues, organs, and nerve growth and regeneration.
US07772144B2	Glass composition for improved refining and method A soda-lime-silica based glass composition for manufacturing on a float line that has a faster refining rate due to the introduction of alkali earth oxides such as BaO, ZnO and/or SrO in the amount of from about 1-4% in total. These oxides replace part or all of the MgO in the base glass composition thereby decreasing the overall MgO content in the glass composition to about 2% or less. The glass can realize a lower viscosity at high temperatures so that refining of the melt may occur faster.
US07772137B2	Breathable materials comprising low-elongation fabrics, and methods Breathable materials comprise a low-elongation fabric layer and a microporous coating thereon. The microporous coating comprises a crystalline polymer composition and a filler. The materials are suitable for use in various applications including housewrap and other construction embodiments. Methods of making a breathable material comprise extrusion coating a low-elongation fabric layer with a composition comprising a crystalline polymer composition and a filler to form a coating on the low-elongation fabric layer, and incrementally stretching the coated nonwoven layer to render the coating microporous.
US07772133B2	Method and equipment for forming oxide film An oxide film forming equipment is provided with a reactor 10 in which a heater unit 14 holding a substrate 100 is stored, a piping 11 provided with a material gas introducing valve V1 for introducing a material gas containing organic silicon or organic metal into the reactor, a piping 12 provided with an ozone containing gas introducing valve V2 for introducing an ozone containing gas into the reactor 10, and a piping 13 provided with an exhaustion valve 13 for exhausting a gas in the reactor 10. When the material gas introducing valve V1, the ozone containing gas introducing valve V2, and the exhaustion valve V3 perform open-and-closure operations to alternately supply the material gas and the ozone containing gas into the reactor 10, the ozone containing gas introducing valve V2 operates to fall an ozone concentration of the ozone containing gas in a range from 0.1 vol % to 100 vol % and the heater unit adjusts a temperature of the substrate from a room temperature to 400° C.
US07772130B2	Insulation film forming method, insulation film forming system, and semiconductor device manufacturing method In a CVD apparatus (111), a reforming process is performed on a porous low dielectric constant film containing silicon, by heating a semiconductor wafer W by a heater, introducing 1,3,5,7-tetramethylcyclotetrasiloxane (TMCTS), and performing heat treatment without applying a high frequency voltage. Then, in the same CVD apparatus (111), an insulation film having high density and hardness is formed on the porous low dielectric constant film, by heating the semiconductor wafer W, introducing TMCTS, and generating a plasma of a gas containing TMCTS while applying a high frequency voltage.
US07772129B2	Method for manufacturing a semiconductor device It is made possible to restrain generation of defects at the time of insulating film formation. A method for manufacturing a semiconductor device, includes: placing a semiconductor substrate into an atmosphere, thereby forming a nitride film on a surface of the semiconductor substrate, the atmosphere containing a first nitriding gas nitriding the surface of the semiconductor substrate and a first diluent gas not actually reacting with the semiconductor substrate, the ratio of the sum of the partial pressure of the first diluent gas and the partial pressure of the first nitriding gas to the partial pressure of the first nitriding gas being 5 or higher, and the total pressure of the atmosphere being 40 Torr or lower.
US07772126B2	Hard mask arrangement, contact arrangement and methods of patterning a substrate and manufacturing a contact arrangement An interlayer is disposed on a pattern surface of a substrate. A buried hard mask may be provided on the interlayer. The buried hard mask includes a template opening having a template length along a line axis and a template width perpendicular thereto. The buried hard mask is filled with a fill material. A top mask is provided above the filled buried hard mask. The top mask includes a trim opening crossing the template opening and having a trim width along the line axis that is smaller than the template length. By etching the fill material and the interlayer using the top and buried hard mask a process section of the pattern surface may be exposed such that a target length and width of the process section result from the template and the trim widths. The planar dimensions of the process section may be decoupled from each other.
US07772125B2	Structure in which cylindrical microstructure is maintained in anisotropic groove, method for fabricating the same, and semiconductor device, TFT driving circuit, panel, display and sensor using the structure in which cylindrical microstructure is maintained in anisotropic groove A method for fabricating a structure according to the present invention includes the steps of: forming a groove in a substrate, dropping a solution in which microstructures such as nanowires are dispersed into the groove and the step of evaporating the solution to arrange the microstructures in the groove in a self-organizing manner.
US07772122B2	Sidewall forming processes An etch layer underlying a patterned photoresist mask is provided. A plurality of sidewall forming processes are performed. Each sidewall forming process comprises depositing a protective layer on the patterned photoresist mask by performing multiple cyclical depositions. Each cyclical deposition involves at least a depositing phase for depositing a deposition layer over surfaces of the patterned photoresist mask and a profile shaping phase for shaping vertical surfaces in the deposition layer. Each sidewall forming process further comprises a breakthrough etch for selectively etching horizontal surfaces of the protective layer with respect to vertical surfaces of the protective layer. Afterwards, the etch layer is etched to form a feature having a critical dimension that is less than the critical dimension of the features in the patterned photoresist mask.
US07772120B2	Chemical vapor deposition method for the incorporation of nitrogen into materials including germanium and antimony A chemical vapor deposition (CVD) method for depositing materials including germanium (Ge), antimony (Sb) and nitrogen (N) which, in some embodiments, has the ability to fill high aspect ratio openings is provided. The CVD method of the instant invention permits for the control of nitrogen-doped GeSb stoichiometry over a wide range of values and the inventive method is performed at a substrate temperature of less than 400° C., which makes the inventive method compatible with existing interconnect processes and materials. In some embodiments, the inventive method is a non-selective CVD process, which means that the nitrogen-doped GeSb materials are deposited equally well on insulating and non-insulating materials. In other embodiments, a selective CVD process is provided in which the nitrogen-doped GeSb materials are deposited only on regions of a substrate in a metal which is capable of forming an eutectic alloy with germanium.
US07772119B2	Dual liner capping layer interconnect structure A high tensile stress capping layer on Cu interconnects in order to reduce Cu transport and atomic voiding at the Cu/dielectric interface. The high tensile dielectric film is formed by depositing multiple layers of a thin dielectric material, each layer being under approximately 50 angstroms in thickness. Each dielectric layer is plasma treated prior to depositing each succeeding dielectric layer such that the dielectric cap has an internal tensile stress.
US07772116B2	Methods of forming blind wafer interconnects Methods for forming blind wafer interconnects (BWIs) from the back side of a previously thinned substrate structure such as a semiconductor wafer to the underside of a bond pad on its active surface includes the formation of a blind hole from the back side, application of a passivating layer therein, anisotropically etching to remove passivation material from the blind hole bottom, blanket-depositing at least one conductive layer within the blind hole and over the back side, blanket-depositing a resist in the blind hole and over the back side, planarizing the back side to remove resist and the at least one conductive layer, removing resist from the blind hole, and filling the blind hole with solder or other conductive material or a dielectric material. Variations in the methods include formation of a conductive pad adjacent the back side surface, disposition of a solder ball or other conductive structure on the BWI, or forming an end thereof in the form of an extended slug protruding from the back side (for ball-less attachment) as the outer terminus of the BWI.
US07772114B2	Method for improving uniformity and adhesion of low resistivity tungsten film Methods of improving the uniformity and adhesion of low resistivity tungsten films are provided. Low resistivity tungsten films are formed by exposing the tungsten nucleation layer to a reducing agent in a series of pulses before depositing the tungsten bulk layer. According to various embodiments, the methods involve reducing agent pulses with different flow rates, different pulse times and different interval times.
US07772112B2	Method of manufacturing a semiconductor device A method of forming an insulating layer on an conductive layer; forming a first mask layer and a second mask layer on the insulating layer; forming a resist layer on the second mask layer; patterning the resist layer; patterning the second mask layer by using the resist layer as a mask; etching the first mask layer halfway through its thickness by using the resist layer and the second mask layer as a mask; removing the resist layer; etching a remaining portion of the first mask layer using the second mask layer as a mask; forming an interconnect groove by etching the insulating layer using the first mask layer as a mask; and forming an electrically conductive material into the interconnect groove, thereby forming an interconnect layer connected to the conductive layer.
US07772103B2	Method of forming a wire structure In a method of forming a wire structure, first active regions and second active regions are formed on a substrate. Each of the first active regions has a first sidewall of a positive slope and a second sidewall opposed to the first sidewall. The second active regions are arranged along a first direction. An isolation layer is between the first active regions and the second active regions. A first mask is formed on the first active regions, the second active regions and the isolation layer. The first mask has an opening exposing the first sidewall and extending along the first direction. The first active regions, the second active regions and the isolation layer are etched using the first mask to form a groove extending along the first direction and to form a fence having a height substantially higher than a bottom face of the groove. A wire is formed to fill the groove. A contact is formed on the wire. The contact is disposed toward the second active regions from the fence.
US07772100B2	Method of manufacturing a semiconductor device having a buried doped region A method of providing a region of doped semiconductor (40) which is buried below the surface of a semiconductor substrate (10) without the requirement of epitaxially deposited layers is provided. The method includes the steps of forming first and second trench portions (26,28) in a semiconductor substrate and then introducing dopant (100) into the trench portions and diffusing the dopant into the semiconductor substrate such that a region of doped semiconductor (40) is formed extending from the first trench portion to the second trench portion. A diffusion barrier, for example formed of two barrier trenches (16, 18), is provided in the substrate adjacent the doping trenches to inhibit lateral diffusion of dopant from the doping trenches so as to maintain an undoped region (30) above the region of doped semiconductor. Advantageously, the electrical properties of the buried layer can be adjusted by varying the depths and size/spacing of the doping trenches and diffusion barrier(s), and the doping and diffusion parameters. The doping trenches can later be filled with polysilicon to provide electrical contact to the buried doped region.
US07772097B2	Methods of selectively depositing silicon-containing films An embodiment provides a method for selectively depositing a single crystalline film. The method includes providing a substrate, which includes a first surface having a first surface morphology and a second surface having a second surface morphology different from the first surface morphology. A silicon precursor and BCl3 are intermixed to thereby form a feed gas. The feed gas is introduced to the substrate under chemical vapor deposition conditions. A Si-containing layer is selectively deposited onto the first surface without depositing on the second surface by introducing the feed gas.
US07772096B2	Formation of SOI by oxidation of silicon with engineered porosity gradient A method is provided for making a silicon-on-insulator substrate. Such method can include epitaxially growing a highly p-type doped silicon-containing layer onto a major surface of an underlying semiconductor region of a substrate. Subsequently, a non-highly p-type doped silicon-containing layer may be epitaxially grown onto a major surface of the p-type highly-doped epitaxial layer to cover the highly p-type doped epitaxial layer. The overlying non-highly p-type doped epitaxial layer can have a dopant concentration substantially lower than the dopant concentration of the highly p-type doped epitaxial layer. The substrate can then be processed to form a buried oxide layer selectively by oxidizing at least portions of the highly p-type doped epitaxial layer covered by the non-highly p-type doped epitaxial layer, the buried oxide layer separating the overlying monocrystalline semiconductor layer from the underlying semiconductor region. Such processing can be performed while simultaneously annealing the non-highly p-type doped epitaxial layer.
US07772095B2	Integrated circuit having localized embedded SiGe and method of manufacturing An integrated circuit (IC) with localized SiGe embedded in a substrate and a method of manufacturing the IC is provided. The method includes forming recesses in a substrate on each side of a gate structure and remote from a shallow trench isolation structure. The method further includes growing a stress material within the recesses such that the stress material is bounded on its side only by the substrate.
US07772092B2	Wafer processing method A method of processing a wafer having a plurality of devices which are composed of a laminate consisting of an insulating film and a functional film on the front surface of a substrate, along streets for sectioning the plurality of devices, the method comprising a first blocking groove forming step for forming a first blocking groove for dividing the laminate in a one-side portion in the width direction of a street of the wafer held on a chuck table by moving the chuck table in a first direction in the processing-feed direction while activating a first laser beam application means; and a second blocking groove and dividing groove forming step for forming a second blocking groove which divides the laminate in the other-side portion in the width direction of the street of the wafer which has undergone the first blocking groove forming step by moving the chuck table in a second direction in the processing-feed direction while activating the first laser beam application means and at the same time, forming a dividing groove in the laminate and the substrate along an intermediate portion between the first blocking groove and the second blocking groove formed in the street of the wafer by activating second laser beam application means.
US07772090B2	Methods for laser scribing wafers A method for singulating dies from a wafer includes laser scribing a continuous line on each side of the die, and laser ablating an area adjacent the laser scribed continuous line on each side of the die. The laser ablations in the area adjacent the laser scribed continuous line on each side of the die being spaced from one another. The method also includes sawing the laser abated area adjacent the continuous line. A method for singulating dies from a wafer includes laser scribing a first continuous line, laser scribing a second continuous line spaced apart from the first continuous line, and laser scribing a third continuous line. The third continuous line positioned between the first continuous line and the second continuous line. The third continuous line overlaps the second continuous line and the third continuous line.
US07772087B2	Method of catastrophic transfer of a thin film after co-implantation The invention relates to a method of catastrophic transfer of a thin film including implanting in a source substrate a first species of ions or gas at a given depth and a second species of ions or gas, the first species being adapted to generate defects and the second species being adapted to occupy those defects. The process further includes applying a stiffener in intimate contact with the source substrate, applying a heat treatment to that source substrate, at a given temperature for a given time, so as to create, substantially at the given depth, a buried weakened zone, without initiating the thermal splitting of a thin film, and applying a localized amount of energy, for example mechanical stresses, to that source substrate so as to provoke the catastrophic splitting of a thin film, the thin film having a substantially planar face opposite to the face surface of the source substrate.
US07772067B2	Methods of forming phase-changeable memory devices using growth-enhancing and growth-inhibiting layers for phase-changeable materials Methods of forming phase-changeable memory devices include techniques to inhibit void formation in phase-changeable materials in order to increase device reliability. These techniques to inhibit void formation use an electrically insulating growth-inhibiting layer to guide the formation of a phase-changeable material region within a memory cell (e.g., PRAM cell). In particular, methods of forming an integrated circuit memory device include forming an interlayer insulating layer having an opening therein, on a substrate, and then lining sidewalls of the opening with a seed layer (i.e., growth-enhancing layer) that supports growth of a phase-changeable material thereon. An electrically insulating growth-inhibiting layer is then selectively formed on a portion of the interlayer insulating layer surrounding the opening. The formation of the growth-inhibiting layer is followed by a step to selectively grow a phase-changeable material region in the opening, but not on the growth-inhibiting layer.
US07772064B2	Method of fabricating self-aligned contact A method of fabricating a self-aligned contact is provided. A first dielectric layer is formed on a substrate having a contact region thereon. Next, a lower opening corresponding to the contact region is formed in the first dielectric layer. Thereafter, a second dielectric layer is formed on the first dielectric layer, and then an upper opening self-aligned to and communicated with the lower opening is formed in the second dielectric layer, wherein the upper opening and the lower opening constitute a self-aligned contact opening. Afterwards, the self-aligned contact opening is filled with a conductive layer.
US07772060B2	Integrated SiGe NMOS and PMOS transistors A method of fabricating an integrated BiCMOS circuit is provided, the circuit including bipolar transistors 10 and CMOS transistors 12 on a substrate. The method comprises the step of forming an epitaxial layer 28 to form a channel region of a MOS transistor and a base region of a bipolar transistor. Growing of the epitaxial layer includes growing a first sublayer of silicon 28a, a first sublayer of silicon-germanium 28b onto the first sublayer of silicon, a second sublayer of silicon 28c onto the first sublayer of silicon-germanium, and a second sublayer of silicon-germanium 28d onto the second sublayer of silicon. Furthermore, an integrated BiCMOS circuit is provided, which includes an epitaxial layer 28 as described above.
US07772054B2	Method for manufacturing semiconductor device A highly responsive semiconductor device in which the subthreshold swing (S value) is small and reduction in on-current is suppressed is manufactured. A semiconductor layer in which a thickness of a source region or a drain region is larger than that of a channel formation region is formed. A semiconductor layer having a concavo-convex shape which is included in the semiconductor device is formed by the steps of forming a first semiconductor layer over a substrate; forming a first insulating layer and a conductive layer over the first semiconductor layer; forming a second insulating layer over a side surface of the conductive layer; forming a second semiconductor layer over the first insulating layer, the conductive layer and the second insulating layer; etching the second semiconductor layer using a resist formed partially as a mask; and performing heat treatment to the first semiconductor layer and the second semiconductor layer.
US07772050B2	Method of manufacturing flat panel display The present invention relates to a method for manufacturing a flat panel display. Herein, the same mask is used to form contact holes and pixel electrodes in the display substrate. Hence, the number of masks needed for manufacturing the flat panel display can be reduced to decrease the manufacturing cost.
US07772048B2	Forming semiconductor fins using a sacrificial fin A semiconductor device is made by steps of removing portions of a first capping layer, removing portions of a sacrificial layer, recessing sidewalls, and forming fin structures. The step of removing portions of the first capping layer forms a first capping structure that covers portions of the sacrificial layer. The step of removing portions of the sacrificial layer removes portions of the sacrificial layer that are not covered by the first capping structure to define an intermediate structure. The step of recessing the sidewalls recesses sidewalls of the intermediate structure relative to edge regions of the first capping structure to form a sacrificial structure having recessed sidewalls. The step of forming fin structures forms fin structures adjacent to the recessed sidewalls.
US07772043B2	Plating apparatus, plating method and manufacturing method for semiconductor device A semiconductor device with plating film layers for semiconductor device leads is described. A first plating film layer that includes Sn as a main material is formed on a semiconductor device lead in which Cu or Fe—Ni is a main material. The outermost surface of the lead includes a plating film layer in which Sn—Bi is the main material. The plating film layer is formed from a plating liquid in which Bi is introduced from a lead hold means. The Bi content relative to Sn in the first plating film layer is approximately 0 wt. % to 1 wt. %.
US07772041B2	Method of sealing or welding two elements to one another A method of sealing or welding two elements to one another in a chamber under vacuum or controlled atmosphere. The method comprises steps consisting of: producing a wettability area on opposing faces of the elements to be welded, with one of the areas comprising a layer of gold and having a surface area greater than the surface area of the other wettability area; depositing a quantity of suitable sealing material comprising indium on one of the areas; bringing the wettability area of the other element into contact with the material thus deposited; and raising the temperature of the chamber containing the elements to be welded or sealed to at least 250° C. in a non-oxidizing atmosphere, in order to seal the two elements effectively to one another by means of remelting.
US07772039B2	Procedure for arranging chips of a first substrate on a second substrate The invention relates to a method for arranging chips of a first substrate on a second substrate, in which the chips are grouped at least into first chips and into second chips, the first chips of the first substrate are singulated and the singulated first chips are arranged on the second substrate in such a way that each of the first chips on the second substrate is unambiguously assigned to the associated first chip on the first substrate.
US07772038B2	CMOS process for fabrication of ultra small or non standard size or shape semiconductor die A method for the singulation of integrated circuit die, the method including: etching a semiconductor layer disposed on a silicon oxide dielectric layer, thereby forming a trench defining a boundary of the die; depositing a silicon nitride layer in the trench; coating the semiconductor layer with an oxide layer such that the trench is filled; removing part of the oxide layer from the semiconductor layer such that the oxide layer only remains in the trench; mounting the semiconductor layer to a carrier; removing the silicon oxide dialectic layer, the nitride layer, and the oxide layer; and releasing the die from the carrier. The method is suitable for irregularly shaped or extremely small die and is compatible with traditional CMOS processes.
US07772037B2	Method for producing a multilayer system on a carrier, in particular in an electrochromic element A method for producing a multilayer system on a substrate, wherein a first and a second layer are applied on the substrate, in each case by means of a vacuum coating process, provides adherence of the layers on each other, even if at least one of the layers of the multilayer system is porous. The layer applied first is, after its application and prior to the application of the other layer, partly removed again through an ion etching operation.
US07772036B2	Lead frame based, over-molded semiconductor package with integrated through hole technology (THT) heat spreader pin(s) and associated method of manufacturing A method and apparatus are provided for manufacturing a lead frame based, over-molded semiconductor package (7) with an exposed pad or power die flag (70) having multiple integrated THT heat spreader pins (71) configured for insertion into one or more vias (77) formed in a printed circuit board (78). The through hole heat spreader pins (71) may be formed as an integral part of the exposed pad (52) or may be solidly connected with the exposed pad (62).
US07772034B2	Fabrication method of semiconductor device A fabrication method of semiconductor device includes providing a substrate which has a plurality of electrical connection pads and is covered with an insulative layer, wherein the insulative layer has an opening formed for exposing the electrical connection pads; forming a filling material on the insulative layer of the substrate and compressing a semiconductor chip to the substrate through a plurality of bumps, the bumps electrically connecting the electrical connection pads and the filling material filling spacing between the semiconductor chip and the substrate so as to form a filling layer. By replacing the conventional underfilling process with the preprinting process of the filling material, the fabrication cost of the semiconductor device is reduced and the fabrication process is simplified.
US07772031B2	Semiconductor apparatus manufacturing method The semiconductor apparatus includes a semiconductor chip, and a source electrode and a gate electrode which are formed on the semiconductor chip and electrically connected with a lead frame. The source electrode is electrically connected with the lead frame by being laser-welded with a thin-film shaped connecting portion formed at an end of the lead frame. This enables the provision of a semiconductor apparatus with enhanced productivity and yields which exhibits high electrical operability and reliability.
US07772030B2	Multipurpose decapsulation holder and method for a ball grid array package A method and apparatus for the decapsulation of integrated circuit packages. The apparatus includes a support member, the support member having an open region and an adjustable device coupled to the support member. The adjustable device can be adapted to hold a BGA package such that a surface region of the BGA package is spatially disposed to face a decapsulation source and a plurality of balls on the BGA package remain free from contact from the decapsulation source and free from contact from a thermal source capable of causing damage to one or more of the balls. The decapsulation source is provided to subject a portion of the surface region of the BGA package for removal of the portion of the BGA package.
US07772029B2	Memory element and memory device comprising memory layer positioned between first and second electrodes A memory element 10 includes a memory layer 4 positioned between a first electrode 2 and a second electrode 6, in which an element selected from Cu, Ag, and Zn is contained in the memory layer 4 or in a layer 3 in contact with the memory layer 4, a resistance of the memory element 10 is changed by a voltage applied to the memory element 10 to perform recording of information, and in an erasing process of changing from a recorded state of low resistance value of the memory element 10 to an erased state of high resistance value of the memory element 10, a fluctuation, which is caused by an increase of the voltage applied to the memory element 10, of the resistance value of the memory element 10 at the end of the erasing process is within ten times at a maximum.
US07772026B2	MEMS device package and method for manufacturing the same A micro electro-mechanical system (MEMS) device package and a method of manufacturing the same are provided. The inventive MEMS device package includes: a device substrate with a MEMS active device being formed on the top surface thereof; internal electrode pads, each of which is positioned on the opposite side of the MEMS active device to provide a space where the MEMS active device is positioned and an electrical path for the MEMS active device, each of the internal electrode pads, and comprises first and second pads arranged opposite to one another with a clearance therebetween; sealing pads positioned outside of the internal electrode pads; a closure substrate joined to the device substrate through the sealing pads, the closure substrate having via holes formed at the areas where the internal electrode pads are positioned; connection members each formed on the inner surfaces of the via holes to be in contact with the internal electrode pads at one ends thereof; and external electrode pads formed on the top surface of the closure substrate in such a way that the external electrode pads are in contact with the other ends of the connection members.
US07772022B2	Method of aligning optical components with waveguides A method of fabricating a photonic device comprises the steps of providing a core pattern of waveguide core material (1) on a base layer (3) and applying a cladding layer (2) over the core material 1 and the base layer (3). The height of the surface of the cladding layer (2) over the base layer (3) varies in dependence on the pattern of core material (1). The core pattern is designed with at least two reference regions, each having a width w that is selected to provide a peak of the cladding layer (2) with a predetermined height h1 over each reference region. The core pattern is further designed such that a line between the peaks of the reference regions is higher than any intervening peaks of the cladding layer, whereby the peaks of the reference regions provide a vertical alignment reference.
US07772020B2	Method of fabricating vertical devices using a metal support film A vertical topology device includes a conductive adhesion structure having a first surface and a second surface, a conductive thick film support formed on the first surface, and a semiconductive device having an upper electrical contact and located over the conductive adhesion layer. Electrical current can flow between the conductive thick film and the upper electrical contact.
US07772019B2	Method for packaging LED device A method for packaging LED device comprises following steps: (1) A substrate with a cavity is provided; (2) A electrode layer is formed and located on the cavity and the surface of the substrate; (3) A opening through the cavity is formed, whereby a anode and a cathode are separated by the opening; (4) A LED chip is disposed on the bottom of the cavity and the opening, where the led chip is electrically connected to the anode and the cathode; (5) The cavity with the opening is filled with packaging material; (6) The packaging material is hardened, thereby the hardened packaging material with a recess that corresponding to the top of the chip; and (7) The LED device is formed by performing a cutting process along a cutting line in the cavity.
US07772014B2	Semiconductor device having reduced single bit fails and a method of manufacture thereof One aspect of the invention provides a method of manufacturing a FeRAM semiconductor device having reduce single bit fails. This aspect includes forming an electrical contact within a dielectric layer located over a semiconductor substrate and forming a first barrier layer over the dielectric layer and the electrical contact. The first barrier layer is formed by depositing multiple barrier layers and densifying each of the barrier layers after its deposition. This forms a stack of multiple barrier layers of a same elemental composition. The method further includes forming a second barrier layer over the first barrier layer and forming a lower capacitor electrode, a ferroelectric dielectric layer over the lower capacitor, and forming an upper capacitor electrode over the ferroelectric dielectric layer. A device made by this method is also provided herein.
US07772009B2	Room temperature phosphorescence apparatus and methods A method for monitoring a chemical component in an industrial water system comprises irradiating a liquid sample from an industrial water system, containing at least one chemical component to be monitored, with light from an excitation light source. Room temperature phosphorescence emitted from the sample is detected after irradiation. The concentration of the chemical component to be monitored is then calculated from the detected room temperature phosphorescence. The liquid sample includes at least one room temperature phosphorescent material (RTPM) and at least one heavy atom perturber (HAP) dissolved therein. The HAP is present in the sample at a concentration sufficient to induce phosphorescence activity in the RTPM. The liquid sample is irradiated in a manner sufficient to induce the RTPM within the sample to emit room temperature phosphorescence, and the calculated concentration of the chemical component to be monitored is a function of the room temperature phosphorescence intensity or temporal metric. A phosphorimeter for measuring room temperature phosphorescence is also described.
US07772002B1	Method for cellular tissue multiplication from Jatropha curcas The method of the present invention comprises: Obtaining an explant from the seeds of Jatropha curcas; Putting the explant derived from the seed of Jatropha curcas in a culture medium; Breaking the intercellular unions of the explants tissue, which generates individuals cells; Incubating for a determined time the culture medium with the generated individual cells, that were multiplied; and, Extracting oil from the cells that multiplied from the individual cells generated from the explants derived from the Jatropha curcas seed.
US07771999B2	Disease model incorporation into an artificial immune system (AIS) The present invention relates to methods of constructing an integrated artificial immune system that comprises appropriate in vitro cellular and tissue constructs or their equivalents to mimic the tissues of the immune system in mammals. The artificial immune system can be used to test the efficacy of vaccine candidates and other materials in vitro and thus, is useful to accelerate vaccine development and testing drug and chemical interactions with the immune system, coupled with disease models to provide a more complete representation of an immune response.
US07771998B2	Pharmaceutical composition for inducing an immune response in a human or animal The present invention relates to a pharmaceutical composition for inducing an immune response in a human or animal, comprising dendritic cells loaded with at least five cancer/testis antigen and no lineage specific differentiation antigens or substantially no lineage specific differentiation antigens provided from at least one cancer cell line, as well as to isolated cell lines expressing a multiplicity of cancer testis antigens and no differentiation antigens, and to a method of inducing an immune response in a human or animal using the composition of the invention.
US07771996B2	FVII or FVIIa variants Variants of FVII or FVIIa comprising at least one amino acid modification in position 196, 237 or 341 relative to hFVII or hFVIIa. The variants exhibit an increased clotting activity, i.e. reduced clotting time, compared to rhFVIIa.
US07771994B2	Automatic eukaryotic artificial chromosome vector The present invention is directed to novel recombinant nucleic acids for introducing yeast chromosomal elements into the genomes of bacteria. The invention provides methods to convert the modified bacterial genomes into artificial yeast chromosomes by fusing the bacteria with yeast that linearize the modified bacterial genomes, to produce artificial chromosomes.
US07771993B2	Microutrophin and uses thereof A microutrophin containing a utrophin having internal deletions (relative to a native utrophin) in the hinge regions and a C-terminal deletion is provided. Also provided are vectors and compositions useful for delivering the microutrophin for the treatment of muscular disorders, including Duchenne Muscular Dystrophy.
US07771992B2	Apparatus and method for preparing tissue samples for histological examination The present invention is directed to an assembleable unit of cassettes for containing specimens for histological examination. The cassettes are each designed for stacking relation one to another by snap locking means which are preferably configured to provide an audible sound and “click” feeling when stacked. A cover is provided to complete a stack, thereby providing an integral unit for case management. The unit is so integrated that it can be handled and will not disengage the stacked cassettes in the usual handling process in the laboratory. It is also readily processed in a paraffin bath for preparing the contained specimens for microtomy. Thus, a stabilized unit is provided for multiple specimens from a single source and maintaining them in sequential order without individual handling.
US07771989B2	Micromachined diagnostic device with controlled flow of fluid and reaction This invention relates to a micromachined microfluidics diagnostic device that comprises one or multiple assaying channels each of which is comprised a sample port, a first valve, a reaction chamber, a second valve, a fluid ejector array, a third valve, a buffer chamber, a capture zone and a waste chamber. Each of these device components are interconnected through microfluidic channels. This invention further relates to the method of operating a micromachined microfluidic diagnostic device. The flow of fluid in the microchannels is regulated through micromachined valves. The reaction of sample analytes with fluorescent tags and detection antibodies in the reaction chamber are enhanced by the micromachined active mixer. By ejecting reaction mixture onto the capture zone through micromachined fluid ejector array, the fluorescent tagged analytes bind with capturing antiodies on capture zone. The fluid ejector array further ejects buffer fluid to wash away unbound fluorescent tags.
US07771987B2	Acoustic wave sensor assembly utilizing a multi-element structure An acoustic wave sensor assembly includes piezoelectric material, a first acoustic wave resonator element structure mounted on the piezoelectric material for interacting with an electrical signal, the acoustic wave resonator element structure being operable to interact with an acoustic wave propagating within the piezoelectric material to produce a first frequency response. Further acoustic wave resonator element structures are mounted on the piezoelectric material for interacting with electrical signals, the further acoustic wave resonator element structures being operable to interact with further acoustic waves propagating within the piezoelectric material to produce subsequent frequency responses. The first acoustic wave resonator element structure and further acoustic wave resonator element structures are combined to form a ladder or lattice filter network to produce an overall frequency response. Sensitive areas are mounted on the piezoelectric material and associated with the acoustic wave resonator element structures which, if predetermined effects to be sensed or detected are present, are modified thereby to control the nature of the frequency responses with resultant specific perturbations of the combined frequency response and thereby provide information with respect to the predetermined effects to be sensed or detected.
US07771986B2	System and apparatus for use in detecting microorganisms A system and an apparatus for use in detecting a target microorganism or agent is disclosed which involves a solid support carrying a binding partner specific for the particular microorganism or agent and the solid support being characterised in that it defines means for protecting the binding partner from being dislodged or scraped off the solid support by physical means. The provision of protection against the binding partner being dislodged from or scraped off the solid support improves the reliability of tests such as immunoassays being conducted with the solid support and also enables such tests to be automated. Modules and machines for use with the solid support, and the automated conduct of tests are also disclosed.
US07771985B2	Mesoscale detection structures Disclosed are devices for detecting the presence of a preselected analyte in a fluid sample. The devices comprise a substrate microfabricated to define a sample inlet port, and a mesoscale flow system that includes a sample flow channel extending from the inlet port. The mesoscale flow system further includes an analyte detection region in fluid communication with the flow channel comprised of a binding moiety for specifically binding the analyte. The detection region is constructed with a mesoscale dimension sufficiently small to enhance binding of the binding moiety and the analyte. The binding moiety may be immobilized in the detection region. The mesoscale detection systems of the invention may be used in a wide range of applications, including the detection of cells or macromolecules, or for monitoring reactions or cell culture growth.
US07771967B2	Nucleic acid encoding apolipoprotein E-I3 The present invention provides nucleic acids comprising a nucleotide sequence encoding an apolipoprotein E (apoE) splice variant, e.g., an unprocessed apoE, that retains intron 3; and vectors and host cells comprising same. The present invention further provides screening methods to identify agents that inhibit cleavage of intron-3 from the apoE splice variant. The present invention further provides methods of treating apoE-related neurological disorders, involving administering an agent that inhibits removal of intron-3 from a precursor apoE mRNA.
US07771961B2	Cytochrome c acetylation Modulation of cytochrome c acetylation, e.g., with a SIR polypeptide, enables interventions that modulate lifespan regulation and cell proliferation, e.g., by modulating apoptosis and/or mitochondrial function such as respiration.
US07771960B2	Feline pancreatic lipase Isolated nucleic acid molecules having a nucleotide sequence encoding feline pancreatic lipase polypeptides, splice variants, allelic variants, and fragments thereof. Isolated feline pancreatic lipase polypeptides, splice variants, allelic variants, and fragments thereof. Host cells comprising a vector containing the polynucleotide sequences and methods for expressing the polypeptides. The generation of monoclonal antibodies that specifically binds to the feline pancreatic lipase polypeptides, and cell lines secreting the monoclonal antibodies. Methods for determining the presence or amount of feline pancreatic lipase in a biological sample. The methods include using standards or calibrators of recombinant feline pancreatic lipase to quantify the lipase in a sample. Devices and kits for performing methods for detecting feline pancreatic lipase in biological samples.
US07771958B2	Method for predicting response to epidermal growth factor receptor-directed therapy This invention provides methods for determining or predicting response to cancer therapy in an individual.
US07771957B2	Method for diagnosing alzheimer's disease The invention relates to method of diagnosing Alzheimer's disease or detecting a predisposition to Alzheimer's disease including providing a test cell sample from a subject, exposing the test cell sample to labeled amyloid beta peptides, and determining the level of labeled amyloid beta peptides in the test cell sample, wherein lower levels of labeled amyloid beta peptides in the test cell sample compared to a control cell sample are indicative of Alzheimer's disease.
US07771954B2	Systemic marker for monitoring anti-inflammatory and antioxidant actions of therapeutic agents A diagnostic method of monitoring anti-inflammatory and/or antioxidant actions of therapeutic agents comprises determining the level of at least one systemic marker indicative of inflammation or oxidation in a bodily sample taken from a subject at base line or following administration of the therapeutic agent. The marker includes at least one of MPO activity, MPO mass, select MPO-generated oxidation products, and combinations thereof. The level of the systemic marker is compared with a predetermined value to monitor the anti-inflammatory and/or antioxidant actions of the therapeutic agent.
US07771952B2	Modulators and modulation of the interaction between RGM and Neogenin This invention relates to drug screening using mammalian repulsive guidance molecules and mammalian Neogenin. In addition, the invention provides for methods of preventing, alleviating or treating various disorders of the nervous system, angiogenic disorders or disorders of the cardio-vascular system and malignancies of different etiology by disrupting the interaction between RGM and Neogenin.
US07771950B2	Methods and compositions for diagnosing and monitoring auto immune and chronic inflammatory diseases Methods of diagnosing or monitoring autoimmune and chronic inflammatory diseases, particularly systemic lupus erythematosis and rheumatoid arthritis, in a patient by detecting the expression level of one or more genes in a patient, are described. Diagnostic oligonucleotides for diagnosing or monitoring autoimmune and chronic inflammatory diseases, particularly systemic lupus erythematosis and rheumatoid arthritis and kits or systems containing the same are also described.
US07771941B2	Method for determining the specific growth rate of distinct microbial populations in a non-homogeneous system The present invention pertains to a molecular biology-based method and kit for measuring the specific growth rate (or cell doubling time) of distinct microbial populations. The method and kit can be used to analyze mixed culture samples that have been exposed to chloramphenicol or other protein synthesis inhibitors for defined times. In a preferred embodiment, the method of the invention (also referred to herein as FISH-RiboSyn) is an in situ method that utilizes fluorescence in situ hybridization (FISH) with probes that target: (1) the 5′ or 3′ end of precursor 16S rRNA; or (2) the interior region of both precursor 16S rRNA and mature 16S rRNA. Images can be captured for a defined exposure time and the average fluorescent intensity for individual cells can be determined. The rate of increase of the whole cell fluorescent intensity is used to determine the specific growth rate. The method of the invention can be attractive for rapidly measuring the specific growth rate (or cell doubling time) of distinct microbial populations within a mixed culture in industries such as environmental systems (water and wastewater treatment systems), bioremediation (optimization of conditions for microbial growth), public health (identification of rapidly growing infectious microbes), and homeland security (identification of rapidly growing bioterrorism agents).
US07771940B2	Methods of detecting a plurality of sequence specific DNA binding proteins with oligonucleotide detection duplexes Compositions and methods are provided for detecting and measuring DNA-binding proteins. The compositions and methods permit the simultaneous or near-simultaneous detection of multiple DNA-binding proteins in a multiplex or array format, and can be used to generate profiles of DNA binding activity by proteins, specifically, transcription factors. Multiple protein-DNA binding events in a single sample may be detected and quantitated in a high-throughput format.
US07771939B2	Correcting an assay image of an array of signals generated from a multiplexed hybridization-mediated assay Described are methods of assay design and assay image correction, useful for multiplexed genetic screening for mutations and polymorphisms, including CF-related mutants and polymorphs, using an array of probe pairs (in one aspect, where one member is complementary to a particular mutant or polymorphic allele and the other member is complementary to a corresponding wild type allele), with probes bound to encoded particles (e.g., beads) wherein the encoding allows identification of the attached probe. The methods relate to avoiding cross-hybridization by selection of probes and amplicons, as well as separation of reactions of certain probes and amplicons where a homology threshold is exceeded. Methods of correcting a fluorescent image using a background map, where the particles also contain an optical encoding system, are also disclosed.
US07771936B2	Differential enzymatic fragmentation The present invention provides methods for detecting the presence of methylation at a locus within a population of nucleic acids.
US07771929B2	Tag library compounds, compositions, kits and methods of use Families of compositions are provided as labels, referred to as eTag reporters for attaching to polymeric compounds and assaying based on release of the eTag reporters from the polymeric compound and separation and detection. For oligonucleotides, the eTag reporters are synthesized at the end of the oligonucleotide by using phosphite or phosphate chemistry, whereby mass-modifying regions, charge-modifying regions and detectable regions are added sequentially to produce the eTag labeled reporters. By using small building blocks and varying their combination large numbers of different eTag reporters can be readily produced attached to a binding compound specific for the target compound of interest for identification. Protocols are used that release the eTag reporter when the target compound is present in the sample.
US07771928B2	Immunoassay device and immunoassay method using the same Disclosed are an immunoassay device which comprises a labeled substance dotting portion and a specimen dotting portion provided thereon, and an immunoassay method using the device.
US07771926B2	Embossed cell analyte sensor and methods of manufacture An analyte measurement system is provided having sensors with embossed test chamber channels. In one embodiment, the sensors are elongate test strips for in vitro testing, each test strip having a substrate, at least one electrode, an embossed channel in the electrode, and lidding tape covering at least a portion of the embossed channel. Methods of manufacture are also disclosed for filling the sensor channels with reagent, and for trimming the ends of the sensors to eliminate the need for a calibration code during use of the sensors with a meter.
US07771924B2	Methods for determining the relative benefits and/or evaluating quantitative changes of products on epithelial tissue A method for determining the relative benefits of products which affect animal epithelial tissue is provided. Also provided is a method for evaluating quantitative changes on one or more affected surfaces of epithelial tissue of a subject caused by a test product.
US07771921B2	Separation systems of frozen-thawed spermatozoa into X-chromosome bearing and Y-chromosome bearing populations Devices, compositions, and methods for handling, separating, packaging, and utilization of spermatozoa (1) that can be derived from previously frozen sperm samples collected from a male mammal. Specifically, techniques to uniformly stain (2) spermatozoal DNA even when derived from previously frozen sperm and separation techniques to separate and isolate spermatozoa even when derived from previously frozen sperm samples into X-chromosome bearing and Y-chromosome bearing populations having high purity.
US07771918B2	Semiconductor manufacturing apparatus and pattern formation method In a pattern formation method employing immersion lithography, after a resist film is formed on a wafer, pattern exposure is performed by selectively irradiating the resist film with exposing light with a liquid including an unsaturated aliphatic acid, such as sunflower oil or olive oil including oleic acid, provided on the resist film. After the pattern exposure, the resist film is developed so as to form a resist pattern made of the resist film.
US07771915B2	Two-photon absorbing optical recording material and two-photon absorbing optical recording and reproducing method A two-photon absorbing optical recording material comprising at least one two-photon absorbing compound and a recording component is provided. Recording is made on it by utilizing the two-photon absorption of the two-photon absorbing compound in the material, and then the material is irradiated with light to thereby detect the difference in the reflectance between the recorded area and the unrecorded area thereof, and the recorded information is thereby reproduced from the material, and also provided are a photosensitive polymer composition and a photon-mode recording method for the material.
US07771913B2	Resist composition and patterning process using the same There is disclosed a resist composition comprising, at least, a polymer including repeating units represented by the following general formula (1). There can be provided a resist composition that has a good barrier property against water, prevents resist components from leaching to water, has high receding contact angle against water, does not require a protective film, has an excellent process applicability, suitable for the liquid immersion lithography and makes it possible to form micropatterns with high precision.
US07771911B2	Process for producing photoresist composition, filter, coater and photoresist composition A technique to acquire a photoresist composition which can reduce occurrence of defects of a resist pattern after development is provided. Further, a technique to obtain a photoresist composition having excellent storage stability characteristics as a resist solution (storage stability); and a technique to obtain a photoresist composition which reduces the change of sensitivity and resist pattern size after treatment almost completely are provided. A photoresist composition containing a resin component (A), an acid-generating component (B) for generating an acid under exposure, and an organic solvent (C) is passed through a first filter 2a equipped with a first membrane having zeta potential of more than −20 mV but no more than 15 mV in distilled water of pH 7.0.
US07771909B2	Titanyl phthalocyanine photoconductors A photoconductor that includes a photogenerating layer, and at least one charge transport layer where the photogenerating layer contains a titanyl phthalocyanine prepared, for example, by dissolving a Type I titanyl phthalocyanine in a solution comprising a trihaloacetic acid and an alkylene halide; adding the resulting mixture of the dissolved Type I titanyl phthalocyanine to a solution of an alcohol and an alkylene halide thereby precipitating a Type Y titanyl phthalocyanine; and treating the Type Y titanyl phthalocyanine with a monohalobenzene, and wherein the photogenerating layer is prepared from a dispersion of the titanyl phthalocyanine Type V and a chlorinated solvent of at least one of a dichloroethane and a dichloropropane.
US07771907B2	Overcoated photoconductors A photoconductor containing an optional supporting substrate, a photogenerating layer, a charge transport layer, and a top overcoating layer in contact with and contiguous to the charge transport layer.
US07771905B2	Method and program for calculating exposure dose and focus position in exposure apparatus, and device manufacturing method A method for calculating an offset of an exposure dose and a focus position in an exposure apparatus that exposes a substrate via an original includes the steps of obtaining information of a shape of a pattern formed on the substrate using the exposure apparatus, calculating a shift amount between a critical dimension contained in the information of the shape of the pattern and a reference value of the critical dimension, and calculating an offset of the focus position based on the information of the shape of the pattern, and calculating the offset of the exposure dose based on the shift amount and the offset of the focus position.
US07771902B2	Photomask, fabrication method for the same and pattern formation method using the same A mask pattern including, for example, a light-shielding portion 101 and a first transparent portion 104A surrounded with a semi-light-shielding portion 102 are provided on a transparent substrate 100. The mask pattern includes a first pattern region and a second pattern region opposing each other with the semi-light-shielding portion 102 and the first transparent portion 104A sandwiched therebetween.
US07771899B2	Method for repairing photomask pattern defects A method for repairing photomask pattern defects includes patterning a target layer on a transparent substrate, thereby forming first patterns, detecting a defect die including a defect pattern by inspecting the first patterns; forming a mask layer on the transparent substrate, forming a mask pattern that selectively exposes the defect die by performing an exposure process and a development process on the mask layer; etching the target layer of the exposed defect die using the mask pattern as an etching mask to expose the transparent substrate, depositing a target layer on the exposed defect die of the transparent substrate, and patterning the deposited target layer, thereby forming a second pattern on the defect die.
US07771893B2	Photomask blank, photomask and fabrication method thereof A light-shielding film for exposure light is formed on one principal plane of a transparent substrate made of quartz or the like that serves as a photomask substrate. The light-shielding film can serve not only as the so-called “light-shielding film” but also as an anti-reflection film. In addition, the light-shielding film has a total thickness of 100 nm or less, 70% or more of which is accounted for by the thickness of a chromium compound that has an optical density (OD) per unit thickness of 0.025 nm−1 for light having a wavelength of 450 nm. In the case where the photomask blank is used for fabricating a mask designed for ArF exposure, the thickness and composition of the light-shielding film are selected in such a manner that the OD of the light-shielding film is 1.2 to 2.3 for 193 or 248 nm wavelength light.
US07771892B2	Double exposure method and photomask for same A double exposure method forms first and second patterns on a cell region and a peripheral circuit region of a wafer, respectively. The method comprises performing a primary exposure through two-beam imaging of 0 order light and −1 order light or +1 order light using a photomask to form the first pattern, and performing a secondary exposure through three-beam imaging of the 0 order light and ±1 order light using the photomask to form the second pattern. Since the double exposure method is performed using the single photomask together with different illuminating systems, exposure time and the number of exposures are both decreased, thereby simplifying the overall process of manufacturing a semiconductor device.
US07771891B2	Ionic conductor, process for production thereof, and electrochemical device Disclosed herein are an ionic conductor including a proton conductor, a process for production thereof, and an electrochemical device (such as fuel cell) with said ionic conductor, said ionic conductor being superior in ionic conductivity, water resistance, and film forming properties. The ionic conductor is formed from a polymer in which carbon clusters having ion dissociating functional groups are bonded to each other through connecting groups. The polymer is less water-soluble and more chemically stable than a derivative composed solely of carbon clusters; therefore, it permits many ion dissociating functional group to be introduced thereinto. Moreover, if ion dissociating functional groups are introduced into also the connecting group, it is possible to prevent the concentration of ion dissociating functional groups from decreasing as the result of polymerization. The polymer can be easily synthesized by simple condensation, substitution, and hydrolysis. Therefore, the process is suitable for mass production in high yields.
US07771889B2	Fuel cartridge and direct liquid feed fuel cell system having the same A liquid fuel cartridge and a direct liquid feed fuel cell system having the liquid fuel cartridge. The direct liquid feed fuel cell system includes: a housing having a cartridge inserting groove and a longitudinal opening in the cartridge inserting groove; a fuel cell located in the housing and composed of cathode and anode electrodes and an electrolyte membrane; a liquid fuel cartridge that contains a liquid fuel, inserted into the cartridge inserting groove, to supply the liquid fuel to the anodes; and a fuel transport unit to transport the liquid fuel from the liquid fuel cartridge to the anodes, wherein the liquid fuel is supplied to the fuel transport unit when the liquid fuel cartridge is rotated in a first direction and the supply of the liquid fuel is disconnected when the liquid fuel cartridge is rotated in an opposite direction.
US07771886B2	Fuel cell A solid oxide fuel cell comprising a fuel cell unit which comprises an anode layer made of an electrically conducting mesh and an anode-forming material carried by this mesh, a cathode layer made of an electrically conducting mesh and a cathode-forming material carried by this mesh, and a solid electrolytic layer in the form of a thin film arranged between and supported by the anode layer and the cathode layer.
US07771884B2	Solid oxide fuel cell stack having an integral gas distribution manifold An SOFC stack module including an integral individual stack manifold containing all of the gas pathways necessary for supply and exhaust of fuel gas and cathode air to and from the stack chimneys. The stack is mounted and hermetically joined directly to the manifold without an intermediate base plate. Flanges at the inlet and outlet ports couple to system distributary manifolds via high temperature sealing joints. The manifold preferably is fabricated of a ferritic stainless steel, and may be formed in a one-piece casting, a combination of multiple castings and stamped plates metallurgically joined (brazed or welded together), or stamped from sheet metal stock. Preferably, the manifold includes fin structures extending into adjacent fuel gas and cathode air chambers to enhance balancing of temperatures by heat exchange therebetween. Heat exchange may be further improved by configuring the manifold to have a plurality of interleaved anode and cathode gas supply chambers.
US07771883B2	Virtual compressor operational parameter measurement and surge detection in a fuel cell system A fuel cell system that employs surge prevention by electronically mapping the compressor for discharge pressure versus mass airflow. In one embodiment, the fuel cell system employs a mass flow meter that measures the airflow to the compressor. A controller receives a signal from the mass flow meter indicative of the flow rate of the charge airflow to the compressor, and determines the outlet pressure and temperature of the compressor from the compressor speed and the measured airflow. This gives the compressor map location at which the compressor is operating. In another embodiment, the fuel cell system employs a pressure sensor that measures the output pressure of the compressor, and provides a pressure signal to the controller. The controller determines the mass airflow to the compressor to determine the compressor map location.
US07771879B2	Method of producing nanoparticle-filled phase inversion polymer electrolyte Provided is a method of producing a nanoparticle-filled phase inversion polymer electrolyte. The method includes mixing a nanoparticle inorganic filler and a polymer with a solvent to obtain a slurry; casting the obtained slurry to form a membrane; obtaining an inorganic nanoparticle-filled porous polymer membrane by developing internal pores in the cast membrane using a phase inversion method; and impregnating the inorganic nanoparticle-filled porous polymer membrane with an electrolytic solution. The polymer electrolyte produced using the method can be used in a small lithium secondary battery having a high capacity, thereby providing an excellent battery property.
US07771876B2	Anode active material method of manufacturing the same and nonaqueous electrolyte secondary battery using the same An anode active material having a high discharge capacity and a superior capacity retention ratio during a charge-discharge cycle is provided. The anode active material includes an alloy material including an element M capable of being alloyed with Li and at least one kind of element R selected from elements with an atomic number of 20 or less, except for H, Li and a noble gas. As the element M, for example, Sn and at least one kind, such as, of Ni, Cu, Fe, Co, Mn, Zn, In and Ag are included. As the element R, B, C, Al, Si, P, S or the like is included. The anode active material can have a low-crystalline or amorphous structure by the element R, thereby Li can be smoothly inserted and extracted. The content of the element R is preferably within a range from about 10 wt % to about 50 wt %.
US07771872B2	Silver oxide powder for alkaline battery and method of producing the same Alkaline battery silver oxide powder when soaked in a 50° C. KOH 40% aqueous solution for 24 hours experiences dissolution of Ag into the solution of 40 mg/L. Alkaline battery silver oxide powder exhibits substantially no Ag peak by X-ray diffraction even after soaking in a 50° C. KOH 40% aqueous solution for 72 hours. This powder has a crystallite size calculated from the half value breadth of the (111) plane peak by powder X-ray diffraction of greater than 250 Angstrom and equal to or less than 1000 Angstrom, particle diameter such that the average diameter of secondary particles is equal to or greater than 1 μm and equal to or less than 500 μm and that of primary particles forming the secondary particles is equal to or greater than 0.1 μm and equal to or less than 10.0 μm, and specific surface area of 5 m2/g or less.
US07771869B2	Secondary battery A secondary battery for electronic appliance to be accommodated in an electronic appliance, thereby feeding an electric power to the electronic appliance, is disclosed, which includes a battery cell in which a positive electrode, a negative electrode and an electrolyte are accommodated in a pack, and a positive electrode terminal and a negative electrode terminal from the positive electrode and the negative electrode, respectively are lead out from the same side face of the pack; a metallic battery can in which one opening from which the battery cell is inserted is formed and which accommodates the battery cell therein such that one side face from which the positive electrode terminal and the negative electrode terminal are lead out is faced towards the opening side; and a lid made of a synthetic resin in which a positive electrode terminal part and a negative electrode terminal part to be connected to the electrodes of the electronic appliance upon being connected to the positive electrode terminal and the negative electrode terminal and being faced outwardly are provided and which plugs the opening of the battery can, the battery cell being accommodated in the battery can while the positive electrode terminal and the negative electrode terminal being curved between the positive electrode terminal and the negative electrode terminal and the lid.
US07771866B2	Battery-locking mechanism for electronic apparatus An arrangement configuration of a battery locking mechanism in an electronic apparatus is taken into consideration to make further downsizing of the electronic apparatus possible. The battery locking mechanism includes a battery mounting section (25) provided on a back surface side of an image pickup apparatus (1) for removably receiving a battery (24) thereon, a locking member (140) disposed along a rear surface side of the battery mounting section (25) and partly projecting to a battery mounting surface of the battery mounting section (25) for engaging with the battery (24) mounted on the battery mounting section (25) to lock the battery (24), and an unlocking member (150) disposed for sliding movement in a direction perpendicular to the battery mounting surface of the battery mounting section (25) for engaging with the locking member (140) to release the locking of the battery (24). The locking member (140) and the unlocking member (150) are disposed in an L shape.
US07771864B2	Method of detecting and responding to a cooling system failure in a power supply device A cooling fan of a secondary battery and a cooling fan of a DC/DC converter are arranged in parallel to share the same air discharge path. A temperature sensor on an air intake side and a temperature sensor on an air discharge side are attached to the secondary battery. When the cooling fan is in failure, a temperature deviation between the air intake side and the air discharge side in the secondary battery increases because a backflow component of a discharge air is generated through the discharge path as the cooling fan operates. Based on this phenomenon, when operation commands for both of the cooling fans are issued, the control circuit senses a failure in the cooling fan by monitoring the temperature difference between temperatures detected by the temperature sensors. Failure detection is thereby possible without providing a sensor at each of the cooling fans.
US07771863B2	Cylindrical secondary battery A cylindrical secondary battery where safety can be secured even when an external pressure accompanying rapid deformation of the battery acts on the battery is provided in a battery having a large capacity. A lithium ion secondary battery has a capacity of 14 Ah, where an upper lid is fixed to a battery can which receives an electrode winding grope therein. The upper lid includes a diaphragm 2 formed with a rupturing valve and an upper lid cap whose peripheral edge portion is fixed to a peripheral edge portion of the diaphragm 2. The rupturing valve includes a rupturing groove 8 with a V-shaped section formed on a surface of the diaphragm 2 positioned on the side of the upper lid cap and a rupturing groove 18 with a U-shaped section formed on a surface of the diaphragm 2 positioned on the side of the electrode winding group so as to correspond to the position of the rupturing groove 8.
US07771861B2	Method of using an electrochemical cell The silicon as an anode material for use in lithium ion batteries according to the present invention provides a method for cell manufacturing. The degree to which the silicon is lithiated during cycling can be controlled, thereby lowering the volume expansion while maintaining an acceptable volumetric capacity, and reducing the failure rate of the silicon containing anodes in lithium ion batteries. The crystalline silicon anode is first charged so that the anode becomes partially lithiated. The voltage of the anode during this charging step is typically less than the lithiation potential of crystalline silicon at ambient temperatures, for example, less than 170 mV versus lithium metal. The total number of charge-discharge cycles during conditioning is at least two or more.
US07771860B2	Catalyst of a fuel cell, and membrane-electrode assembly and fuel cell system including catalyst A fuel cell catalyst includes a carbon-containing core, and an active metal shell attached to the carbon core by an ionomer. The catalyst has a high catalyst utility, and facilitates a highly efficient and high power fuel cell. The ionomer is disposed between the active metal and the carbon core. The carbon core and the active metal are present in a mixing ratio ranging from 0.0001:99.9999 wt % to 0.05:99.95 wt %.
US07771858B2	Coated steel bipolar plates In accordance with one embodiment of the present invention, an electrochemical conversion assembly comprises a plurality of electrochemical conversion cells and a plurality of electrically conductive bipolar plates. The electrochemical conversion cells are configured to communicate with first and second reactant supplies. Adjacent ones of the electrochemical conversion cells are separated by respective ones of the plurality of bipolar plates. The bipolar plates comprise an alloy comprising Fe and Cr. Respective surface portions of the bipolar plates are provided with electrically conductive, corrosion resistant layers that are placed in contact with portions of the electrochemical conversion cells. The corrosion resistant electrically conductive layers may comprise graphitic layers characterized predominantly by sp2 hybridized carbon-carbon bonding, molybdenum doped indium oxide layers, an electrically conductive Cr+N layer, or an electrically conductive MoSi2 layer.
US07771854B2	Fuel cell system and method of detecting failure in a fuel gas channel of fuel cell system When an ignition switch is turned off, a hydrogen supply valve is closed. Operation of a compressor continues, and an air supply valve and an air discharge valve are opened to supply the compressed air into a fuel cell through a hydrogen supply port. The scavenging process of removing the fuel gas and the water remaining in the fuel gas channel is performed through the air discharge valve, a drain valve, and a hydrogen purge valve. Then, all the valves connected to the fuel gas channel are closed. The pressure when the valves are closed, and the pressure when a short time has elapsed after closing the valves are detected by a pressure sensor. Based on the pressure difference, a failure due to the leakage in the fuel gas channel is detected.
US07771853B2	Patterned magnetic medium, magnetic recording medium and magnetic storage device A patterned magnetic medium includes: a substrate; a soft magnetic underlying film, a nonmagnetic film, an intermediate film and a recording layer which are formed on a principal surface of the substrate; a first protective film formed in contact with the recording film; a second protective film formed in contact with the first protective film; and a third protective film formed in contact with the second protective film. Moreover, the recording layer has a pattern structure formed by making a magnetic film come into contact with a concavo-convex pattern of a nonmagnetic material. The first protective film and the third protective film include carbon as the main constituent element and the second protective film is a wet-coated polymer film. High adhesion between carbon and the wet-coated polymer film can prevent peeling off and the wet-coated polymer film as a cushioning material absorbs impact.
US07771851B2	Gypsum-containing products containing alpha hemihydrate The invention provides gypsum wallboard, made from gypsum-containing slurries having outstanding hydration rate characteristics comprising alpha-hemihydrate ground to a particular particle size distribution range and having a Blaine surface area in the range from about 3100 cm2/g to about 9000 cm2/g, alone or in combination with beta-hemihydrate.
US07771847B2	cBN sintered body for high surface integrity machining, cBN sintered body cutting tool, and cutting method using the same To provide a high cBN content ratio sintered body that improves fatigue life of the machined part and has a longer tool lifespan than conventional cBN sintered body tools by suppressing the production of the affected layer by machining formed on the machined surface of the workpiece to be cut and by promoting residual compression stress. That is a cBN sintered body according to the present invention is a cBN sintered body for high surface integrity machining having a cBN component of not less than 87% and not more than 99% by volume % and a thermal conductivity of 100 W/m·K or more; and the outermost surface of the cBN sintered body 1 is coated with a heat resistant film 2 having a thickness of 0.5 μm to 12 μm comprising a compound of at least one element selected from 4a, 5a, 6a group elements and Al, and at least one element selected from C, N, and O.
US07771846B2	Method and Apparatus for High-Permeability Magnetostrictive/Piezo-Fiber Laminates Having Colossal, Near-Ideal Magnetoelectricity An ME composite laminate of at least one (1-3) piezo-fiber layer coupled with high-permeability alloy magnetostrictive layers, optionally formed of FeBSiC or equivalent. The composite laminate alternates the (1-3) piezo-fiber and high-permeability alloy magnetostrictive layers in a stacked manner. Optionally, the magnetization direction of the high-permeability alloy magnetostrictive layers and polarization direction of the piezo-fiber layer are an (L-L) arrangement. Optionally, thin film polymer layers are between the (1-3) piezo-fiber layer and high-permeability alloy magnetostrictive layers. Optionally, piezo-electric fibers within the (1-3) piezo-fiber layer are poled by inter-digitated electrodes supported by the thin film polymer, arranged as alternating symmetric longitudinally-poled “push-pull” units.
US07771844B2	Organic metal complex and photoelectronic device, light-emitting element and light-emitting device using the same It is an object of the present invention to provide a substance that can emit phosphorescence. Further, it is an object of the present invention to provide a light emitting element with favorable color purity. The present invention provides an organometallic complex having a structure represented by a general formula (1). A light emitting element that can exhibit red or reddish emission of light with favorable color purity can be obtained by using the organometallic complex of the present invention as aluminescent substance. In addition, a light emitting element that can emit light efficiently can be obtained by using the organometallic complex of the present invention as a sensitizer.
US07771841B2	Ultrathin copper foil with carrier and printed circuit board using same An ultrathin copper foil with a carrier not causing blistering at a release layer interface, having a low carrier peeling force, friendly to the environment, and enabling easy peeling of a carrier foil and an ultrathin copper foil even under a high temperature environment and a printed circuit board enabling a stable production quality of a base of a printed circuit board for fine pattern applications using the ultrathin copper foil with the carrier, that is, a ultrathin copper foil with a carrier comprising a carrier foil, a diffusion prevention layer, a release layer, and an ultrathin copper foil, wherein the release layer is formed by a metal A for retaining a release property and a metal B for facilitating plating of the ultrathin copper foil, a content a of the metal A and a content b of the metal B forming the release layer satisfying an equation: 10≦a/(a+b)*100≦70 and a printed circuit board prepared by using such a ultrathin copper foil with a carrier.
US07771840B2	Aluminum alloy plate and heat exchanger formed thereof There are provided an aluminum alloy plate having high strength and excellent corrosion resistance even though the plate is made thinner, and a heat exchanger formed thereof. In an aluminum alloy plate having a core material and a surface material cladded on at least one side of the core material, the surface material includes 0.030-0.30% by mass of Fe, 0.40-1.9% by mass of Mn, 0.40-1.4% by mass of Si, and 2.0-5.5% by mass of Zn, the rest comprises Al and inevitably included impurities, and an area ratio of an intermetallic compound containing Al and Mn to a whole surface of the surface material is 1% or less.
US07771833B2	Anti-fouling materials containing cationic polysiloxanes Polyamine cross-linked polysiloxanes, such as functionalized polysiloxane cross-linked with a polyalkylenepolyamine are described herein. The polyamine cross-linked polysiloxanes may be used in an antifouling composition to prevent biological fouling in marine environments.
US07771831B2	Infrared shielding film-coated glass plate and process for its production An infrared shielding film-coated glass plate comprising a glass substrate and an infrared shielding film formed thereon, wherein the infrared shielding film comprises fine ITO particles having an average primary particle diameter of at most 100 nm dispersed in a matrix containing silicon oxide as the main component and containing nitrogen in an amount of at least 2 at % based on Si and has a film thickness of from 200 to 3,000 nm.
US07771824B2	Bridged graphite oxide materials Bridged graphite oxide material comprising graphite sheets bridged by at least one diamine bridging group. The bridged graphite oxide material may be incorporated in polymer composites or used in adsorption media.
US07771822B2	Conductive material comprising an Me-DLC hard material coating The invention relates to a conductive material consisting of an alloy that contains copper, for use as a plug-in or clip connection. Said material comprises a cover layer that is deposited on at least some sections of the contact surface, said layer consisting at least of a support layer and an adhesive layer. The anti-friction layer has a carbon content greater or less than 40 and less than or equal to 70 atomic percent.
US07771820B2	Monocrystal, nano wire material, electronic element, and method of producing nano wire material A crystalline nano wire material which can be used as a nano-level wire is provided.A molecular monocrystal having a high anisotropy for electrical resistivity is used.
US07771818B2	Treatment of porous article The present invention is a method for modifying at least one property of a porous membrane. The method comprises the steps of providing a porous membrane. The method also includes exposing the membrane to a fluid at supercritical conditions. At least one property of the membrane is modified while the membrane is exposed to the fluid at supercritical conditions. The condition of the fluid is changed in such a manner that the porous membrane retains the modified property. The present invention is also sheet material that is water-resistant, moisture vapor transmissive and air permeable. The sheet material comprises a membrane having an open pore structure including surfaces defining a plurality of interconnecting pores extending through the membrane and between major sides of said membrane in which the pores have an average pore size. The membrane is made from a material tending to absorb oils and contaminating agents. A uniform coating of precipitated fluorinated urethane polymer material on at least portions of the surfaces of the nodes and fibrils defining the pores. The precipitated fluorinated urethane polymer material provides oil and contaminating agent resistance of at least a number 6 by AATCC 118 testing and an air permeability of at least 0.20 CFM per square foot by ASTM D737 testing.
US07771815B2	Molding glass lens and mold thereof A molding glass lens and a mold thereof are disclosed. The molding glass lens consists of an upper optical surface, a lower optical surface, two outers surrounding the optical surfaces and at least three grooves arranged in the form of a circle disposed on the lower outer and/or the upper outer. The disposition of the grooves has no affecting in original size of the outers as well as assembling with other mechanical parts in les group. The mold of the lens includes an upper molding unit and a lower molding unit. Cavity of each molding unit is composed of a central part for forming an optical surface of the lens and an outer circular part for forming outer of the lens. At least three protrudent parts with the same height are disposed in the form of a circle on the outer circular of the lower molding unit and/or the upper molding unit. Thus the air in the mold cavity is easy to exhaust through the gap formed by protrudent parts and glass preform. Therefore, air bubbles generated during the molding processes are prevented and precision of the glass lens is provided.
US07771812B2	Non-slip absorbent pad There is provided a non-slip absorbent food pad with one or more non-slip surfaces. The one or more non-slip surfaces have a coefficient of friction (COF) suitable for preventing the packaged food product from slipping and/or sliding off of the non-slip absorbent food pad in various product display orientations. The present invention also provides for a method for making a non-slip absorbent food pad and method of using a non-slip absorbent pad in various packaging displays.

1 2 3 4 5 6 7 8 9 10