Document | Document Title |
---|---|
US11052575B2 |
Tri-layer bladder and related systems and methods for fabricating composite structures
Disclosed is an elastomeric bladder tool and related systems and methods. In one embodiment, the elastomeric bladder tool comprises an elastomeric inner layer substantially defining an inner cavity of the elastomeric bladder tool, an elastomeric outer layer substantially defining an outer surface of the elastomeric bladder tool, and a permeable middle layer positioned between the elastomeric inner layer and the elastomeric outer layer. The permeable middle layer has greater permeability than both the elastomeric outer layer and the elastomeric inner layer to allow for evacuating of gases that have entered the permeable middle layer. |
US11052573B2 |
Method of fabricating both a woven fiber preform and a composite material part
A method of fabricating a woven fiber preform that is impregnated with a matrix-precursor resin, the resin, in the raw state, presenting a glass transition temperature Tg0, includes: impregnating yarns or strands with the resin; feeding a loom with the impregnated yarns or strands maintained at a temperature in the range Tg0 to Tg0+10° C.; and weaving the yarns or strands in the loom in order to obtain the resin-impregnated woven fiber preform. |
US11052570B2 |
Process for producing foams based on thermoplastic polyurethanes
A process for producing foamed thermoplastic polyurethane particles comprises the steps of a) melting a thermoplastic polyurethane in a first extruder (E1), b) injecting a gaseous blowing agent in a second extruder (E2), c) impregnating the gaseous blowing agent homogeneously into the thermoplastic polyurethane melt in a third extruder (E3), d) extruding the impregnated thermoplastic polyurethane melt through a die plate and granulating the melt in an underwater granulation device under temperature and pressure conditions to form foamed thermoplastic polyurethane particles. |
US11052567B2 |
Method for liquid treatment of a wood species
The present invention relates to an improved method for impregnating a porous material, such as wood, more specifically a method in which an active ingredient to be deposited within the porous material is dissolved in condensed carbon dioxide and impregnated in the material. |
US11052566B2 |
Pole and method of manufacturing the pole
A pole for supporting a cable. The pole includes a plurality of truncated cones arranged in a linear array to form the pole, wherein each truncated cone receives an adjacent truncated cone within its interior. Each truncated cone in the pole is formed from a veneer by moving the longitudinal edges of the veneer towards each other. A method of manufacturing the pole and various uses of the pole are also provided. |
US11052558B2 |
Adapter for a handle and a cartridge of different razor systems
An adapter for coupling each of a razor handle and a razor cartridge together is provided. The adapter includes a cartridge engaging portion and a handle engaging portion. The handle engaging portion comprises at least one wall that defines a receptacle for receiving a razor handle and at least one handle protrusion extending from the at least one wall and configured to engage a central recess of a razor handle. The cartridge engaging portion is coupled with the handle engaging portion. The cartridge engaging portion comprises a stem that defines a first recess and a second recess for selectively engaging a first cartridge protrusion and a second cartridge protrusion and a tongue member slidably coupled with the stem and configured to contact a cartridge. |
US11052555B2 |
System and method for sensing debris accumulation in shaving razor cartridge
A system for determining a level of debris accumulation in a region adjacent to at least one blade of a razor cartridge. The system includes a sensing unit to detect a measurement parameter which is one of an amount of light reflected from at least one area adjacent to the at least one blade, and an image of the at least one area adjacent to the at least one blade. A processing unit compares the detected measurement parameter to at least one reference threshold parameter and determines a level of debris accumulation in the at least one area adjacent to the at least one blade based on an amount of deviation of the detected measurement parameter from the at least one reference threshold parameter. Information regarding the determined level of debris accumulation is provided by at least one of a light indication, an aural indication, and a haptic indication. |
US11052552B2 |
Safety utility blades, assemblies and methods of manufacturing
A safety blade for use with a knife assembly comprises a blade body, a bade attachment having a cutting edge and a top edge opposite the cutting edge, a blade attachment having a first half and a second half connected together via a hinge and extending beyond the top edge of the blade body to define a clamshell for receiving the blade body, and a handle adaptor having a handle engagement portion for removably securing the blade attachment to a handle. |
US11052544B2 |
Safety device for machine tools
A safety device for machine tools, such as a panel-sizing circular saw or an edge-gluing machine, with a machining tool used for machining a workpiece supplied to the machine tool, comprises a detection device and a hazard reduction device. The detection device is designed to detect a hazardous situation of an operator of the machine tool and the hazard reduction device is designed to initiate a safety measure to reduce the risk of injury to the operator when a hazard signal characterizing a hazardous situation of the operator is received. |
US11052543B2 |
Control device, robot system, and robot
A control device includes a control section configured to control a motion of a robot arm using values detected by a plurality of distance sensors. The plurality of distance sensors include a first distance sensor and a second distance sensor disposed in a first direction orthogonal to the axial direction of a dispenser. The second distance sensor is disposed in a position further apart from the dispenser than the first distance sensor. The control section executes, on a robot, a first instruction for causing the robot to execute discharge of a discharge object by the dispenser when a distance acquired by the first distance sensor is a distance in a predetermined range and a distance acquired by the second distance sensor is a distance larger than the distance in the predetermined range. |
US11052542B2 |
Robot system and control method of robot
A robot system and a control method of a robot are provided. A robot, a liquid application part, an application thickness measurement part and a control part are provided, the liquid application part being provided on the robot, the application thickness measurement part measuring an application thickness of a liquid applied by the liquid application part, the control part, in a case where the application thickness measured by the application thickness measurement part is greater than a predetermined thickness, driving the robot in a manner of moving the liquid application part closer to an application object, and in a case where the application thickness measured by the application thickness measurement part is less than the predetermined thickness, driving the robot in a manner of moving the liquid application part away from the application object. |
US11052541B1 |
Autonomous robot telerobotic interface
An indication of a task to be performed in a network data center is received. A robotic manipulator of an autonomous robot is controlled to autonomously perform at least a portion of the task. It is determined that an assistance is required in performing an identified limited portion of the task. A notification of a request for the assistance is provided. A remote assistance from an operator in performing the identified limited portion of the task is received. Autonomous performance of the task is resumed after completion of the remote assistance for the identified limited portion of the task. |
US11052535B2 |
Floor-to-height object retrieval robot
Provided is a robot for retrieving objects with different sizes, shapes, weights, placements, configurations, and/or other characteristics from a floor or raised height. The robot may include a motorized base, a lift that raises to a plurality of heights from the base, an upper platform attached over the lift, a vertical extension extending downwards from a frontside of the upper platform and in front of the lift, a lower platform with a proximal end coupled to the vertical extension and a distal end extending in front of the robot and directly over a ground surface on which the motorized base moves when the lift is in a lowered position, and a retriever for retrieving an object onto the lower platform. |
US11052530B2 |
Electric work machine
Provided is an electric work machine that can suppress a temperature increase of a component controlling an electric motor. The electric work machine including a brushless motor that operates a tip tool includes a rectification circuit that converts a voltage to be applied to the brushless motor from an alternating current voltage to a direct current voltage, and a switching circuit that controls the brushless motor, and the rectification circuit is arranged upstream of the switching circuit in a circulation path of the air that cools the rectification circuit and the switching circuit. |
US11052526B2 |
Hand-held power tool device
A hand-held power tool device, in particular a hammer drill and/or chisel hammer device, includes at least one operating element and at least one locking unit. The at least one locking unit includes at least one locking element and at least one controllable actuator element. The at least one locking element can be moved from at least one storage position into at least one locking position, and vice versa, and locks the operating element in at least one operating state in the locking position. The at least one controllable actuator element influences motion of the locking element. |
US11052520B2 |
Seal installation tool
A method of installing a seal in a bore of a component includes securing a base plate to a component. The method includes arranging the seal onto a pusher. The method also includes inserting the pusher into a hole in the base plate. The method further includes installing a hub onto the base plate and over the pusher. The method further includes rotating a rod relative to the hub to advance the pusher and seat the seal in the bore. |
US11052519B2 |
System and method for installing a manifold plug
The present disclosure relates to an insert and system of installing the same. The insert includes a tapered core and a cylinder. The core releasably secures to an installation device which includes a depth stop or a depth control to control the installation depth of the insert. The insert may be provided in a tray that allows for easier handling of the inserts and installation thereof in installation holes, for example in a hydraulic manifold. In some cases, the core includes a threaded hole to releasably secure the insert to the installation device, thus allowing the installation device to pull the core into the cylinder. The core and cylinder may be made of metallic materials such as steels, steel alloys and others. In some cases the insert can withstand blow out pressures of 40,000 psi or higher. |
US11052515B2 |
90 degree socket adapter
The 90 Degrees utilizes dual ratio constant mesh gears which provides suitable use for ratchets in hard to access spaces, and particularly well suited for automotive use. The mesh gears are configured to be used either with manual or pneumatic tools. A female socket element recedes into the housing having gears therein and a male socket element meshes with the female socket element and is shaped to accommodate a female socket element at 90 degrees or the adapter element of a drive ratchet. You can use an elongated drive shaft to accommodate distance. Positioned within the housing of the adapter body are gears secured to mesh within the housing of the adapter. Rotation of the female socket element by a drive ratchet in one direction will rotate the male socket element in the opposite direction without any change in direction is governed by the ratchet use. |
US11052511B2 |
Outer blade cutting wheel and making method
An outer blade cutting wheel is provided comprising an annular thin disc base and a blade section of bonded abrasive grains on the periphery of the base. Provided that an imaginary range is delineated by two imaginary planes extending parallel to the planar surfaces of the base and tangent to widthwise side portions of the blade section and two imaginary circumferences defined about the rotational axis and extending tangent to inner and outer perimeters of the blade section, the blade section occupies 10-40% by volume of the imaginary range minus the region of the base, and the widthwise side portions of the blade section have a dented shape relative to the imaginary planes. The cutting wheel is capable of cutoff machining at a high feed speed while maintaining a high accuracy and a low cutting load. |
US11052510B2 |
Imprint device for imprinting a surface of an object to create an identification mark
The present invention is an imprint device for imprinting a unique identification mark on a surface of an object with imprinting particles of different sizes that increase uniqueness and without the need for electric power. The imprint device includes a vertical member, a hammer member, a trigger assembly, a charging unit, a barrel and at least one pocket. In the operative configuration, a trigger of trigger assembly is activated such that hammer member impacts a cartridge filled with at least one munition of imprinting particles and releases imprinting particles. The imprinting particles travel through the barrel where acceleration is increased and impact on surface is made to form microcraters and unique identification marks. The imprinting particles can be of same size, material and shape or they can be of different sizes, material and shapes or the combination thereof for increasing uniqueness. |
US11052504B1 |
Temperature regulation system and temperature regulation method for machine tool
A temperature regulation system and a temperature regulation method are applicable to a machine tool. The temperature regulation system includes a cooling fluid storage tank, a heating fluid storage tank, an internal circulation subsystem, an external circulation subsystem and a computing unit. The internal circulation subsystem includes a first valve. The external circulation subsystem includes a plurality of flow channels and a second valve and a third valve disposed on the plurality of the flow channels. The computing unit controls the first valve, the second valve and the third valve to switch flow directions of the plurality of the flow channels among the cooling fluid storage tank, the heating fluid storage tank and machine tool. Therefore, a thermal balance of the machine tool can be effectively maintained. |
US11052503B2 |
Spindle device
A spindle device includes a spindle housing, a spindle shaft rotatably supported inside the spindle housing, a spindle mount having an insertion cavity into which the spindle housing is inserted along the axial direction of the spindle shaft, and a mount cover covering the spindle mount. A temperature regulator for adjusting the temperature inside the mount cover is provided inside the mount cover. |
US11052502B2 |
Power-tool cooling apparatus
A power-tool cooling apparatus for a portable power tool includes a first fan configured to generate a first cooling fluid flow to cool a drive unit of the portable power tool, and a second fan that generates a further cooling fluid flow to cool an electronics unit of the portable power-tool. A third fan generates a third cooling fluid flow to cool a second electronics unit of the power-tool, and supplies cooling fluid to the first cooling fluid flow. |
US11052500B2 |
Platform for robots
A feeding system for feeding workpieces to a device by means of a robot comprises a feeding station and at least one transport carriage, wherein the feeding station comprises a robot fastening section and is designed that a workpiece holder can be held in the feeding station in a holding position defined in relation to the robot fastening section from which a robot attached to the robot fastening section can grasp the workpieces. The transport carriage also has at least one holding device for holding a workpiece holder in a first holding position. The feed system comprises a coupling section wherein the transport carriage can be coupled to the feeding station using a coupling device in such a way that a workpiece holder held in the transport carriage in the first holding position is brought into the receiving position after the transport carriage has been coupled with the coupling section. A method for feeding workpieces to a device and the use of a feed system is provided. |
US11052492B2 |
Use of an alloy as a brazing alloy for an electric switch braze joint, an electric switch braze joint, an electric switch and a method of producing an electric switch braze joint
Embodiments of the present disclosure relate to an alloy as a brazing alloy for an electric switch braze joint, an electric switch braze joint, an electric switch and a method of producing an electric switch braze joint. The alloy composition of said the alloy consists of at least one element selected from each of group I and group II listed below, and a balance of impurities, Ag, and at least one of Cu, and Zn. Group I encompasses Cd, Mn, Ni, P, Sb, Si, Sn, Ti, and oxides thereof in a total amount of 0.5 to 45.0 wt. %. Group II encompasses Bi, Mo, Te, W, and oxides thereof, oxides of Cu and Zn in a total amount of 0.1 to 15.0 wt. %. |
US11052490B2 |
Inner barrel of an engine inlet with laser-machined acoustic perforations
A forming system includes a femtosecond laser and a control unit that includes one or more processors operatively connected to the femtosecond laser. The femtosecond laser is configured to emit laser pulses onto an inner surface of a face sheet of an acoustic inner barrel. The acoustic inner barrel includes an acoustic core comprising an array of hexagonal cells attached to an outer surface of the face sheet that is opposite the inner surface. The control unit is configured to control the femtosecond laser to laser drill a plurality of perforations in the face sheet via emitting laser pulses at pulse durations between about 100 femtoseconds and about 10,000 femtoseconds and at frequencies over 100,000 Hz such that the perforations are formed without burning portions of the face sheet or the acoustic core surrounding the perforations. |
US11052478B2 |
Method for tapping an engine component to orient a spark plug
A device and method of tapping an engine component to orient a spark plug includes measuring a tap pitch, measuring a first distance between a tap end surface and a full tap tooth center at a first rotational location, calculating a phantom first tap tooth based on the pitch and first distance, determining a tap rotational offset from the first location to a location where the end surface intersects the phantom first tooth, calculating a tap rotational starting orientation that is the first location minus the tap rotational offset minus a spark plug offset, rotating a tool head to the rotational starting orientation, positioning the tap so the end surface is a pitch incremental distance away from the engine component, synchronizing a rotating speed of the tool head and a feed rate to the tap thread pitch, and operating the tool to cut or form threads in the engine component. |
US11052472B2 |
Cutting insert and indexable edge rotary cutting tool
A cutting insert includes a rake face configuring one of polygonal surfaces, a seating surface configuring the other one of the polygonal surfaces, and a side surface connecting the rake face and the seating surface to each other. The cutting insert has a cutting edge portion including a main cutting edge located in a side portion of the rake face, a subsidiary cutting edge connected to the main cutting edge, and a corner cutting edge connected to the subsidiary cutting edge and located in a corner portion of the rake face. The side surface includes a flank face and a connection surface which are adjacent to each other in a thickness direction via a boundary line. The connection surface is located on the seating surface side, and is located outside than an extension line of the flank face. |
US11052466B2 |
Cutting tool and manufacturing method thereof
A cutting tool according to an aspect of the present disclosure includes a cutting edge portion which contains at least one of cubic boron nitride and polycrystalline diamond. The cutting edge portion includes a rake face, a flank face, and a cutting edge. The flank face is contiguous to the rake face. The cutting edge is provided as a ridge line between the rake face and the flank face. The radius of curvature of the cutting edge is 2 μm or more and 8 μm or less. |
US11052457B2 |
Casting nozzle
A casting nozzle for feeding molten metal into a moving casting mold of a caterpillar casting machine, including an elongated housing body having a slot-like outlet side (A), wherein multiple flow passages are formed in the housing body along its longitudinal direction (x) and over its width direction (B), through which passages molten metal can be channeled in the direction of the outlet side (A) and can be fed from there into the moving casting mold, wherein the housing body is of an at least two-part design in the direction of its height and has at least one upper shell and at least one lower shell, wherein the upper shell and the lower shell are spaced apart from one another by separating webs and the individual flow passages extend between the separating webs. |
US11052456B1 |
Casting mold and manufacturing method of cast part
The casting mold is provided with: the molding wall portion forming the internal space; and the filling ports that open to the molding wall portion and that allow the molten metal to flow into the internal space. In this configuration the channel center lines of the filling ports intersect the surface of the heater at the non-perpendicular contact angle. |
US11052452B2 |
Riveting method for aircraft
A riveting method that includes riveting a first aircraft part to a second aircraft part. The method includes capturing a plenoptic image of the rivet and at least one of the first part and the second part in the vicinity of the rivet, by a plenoptic imaging device secured to a riveting head, after riveting the first part to the second part. The method includes detecting the positioning and the surface condition of the rivet, from the plenoptic image captured by the imaging device. |
US11052451B2 |
Gear manufacturing method and gear manufactured thereby
A gear manufacturing method includes a step of preparing a gear blank; a step (teeth cutting step) of cutting the gear blank to form a half-finished gear having a plurality of gear teeth; a step (heat treatment step) of heat-treating the half-finished gear having the gear teeth; and a step (form rolling step) of rolling the half-finished gear which is subjected to the heat treatment, in which the gear teeth of the half-finished gear which is subjected to the teeth cutting step is formed with protuberances on both sides in a circumferential direction, and at the form rolling step, the protuberances are pressed by a rolling die, so that the half-finished gear becomes a gear. |
US11052449B2 |
Method for manufacturing grid-stiffened structure and grid-stiffened structure
A method for manufacturing a grid-stiffened structure includes: regularly arranging triangular or quadrangular cells on one surface of a sheet member and setting a lattice-like pattern which is provided with rib configuring regions, each of the rib configuring regions being provided between the cells; providing through-holes in positions in the sheet member, where the rib configuring regions intersect, so as to separate the rib configuring regions; forming ribs which protrude from the one surface of the sheet member by folding the rib configuring regions of the sheet member; and mutually connecting ends of the rib in a position of each of the through-holes. |
US11052441B2 |
Meandering control device for rolling line
There is provided a meandering control device for a rolling line capable of setting temperature of a material to be rolled so as to suppress meandering of the material to be rolled. The meandering control includes a tail end roll force calculation unit that calculates a predictive value of roll force when entry side tension is not applied, an allowable meandering amount roll force calculation unit that calculates a reference value of the roll force applied to the material to be rolled when a meandering amount of the material to be rolled is an allowable amount, and a temperature rise amount calculation unit that calculates a temperature rise amount of the material to be rolled, based on a difference between the predictive value of the roll force and the reference value of the roll force. |
US11052437B2 |
Reaction force nozzle
A nozzle for water jet equipment and a method of use thereof. The nozzle has a body including a base with a shaft extending outwardly therefrom. The shaft is inserted through a bore of a sleeve that rotatable about the shaft. The base and shaft define a bore therein. At least one opening is defined in the shaft and one or more grooves are milled into the shaft's exterior surface. Each opening places the body's bore in fluid communication with one of the grooves and the sleeve's bore. Water flowing through the body's bore will flow through each opening, into the associated groove and into a space between the shaft and sleeve. The grooves create turbulence in water in this space and thereby reduce leakage from the nozzle. The shaft terminates in a conical section usable as a battering ram to break up blockages in pipes during cleaning operations. |
US11052436B2 |
Laser cleaning apparatus and laser cleaning method
A laser cleaning apparatus and a laser cleaning method are furnished, for switching the wavelengths of laser beams furnished by a single laser module using a wavelength switching module and cleaning a test piece using the laser beams having wavelengths and energy suitable for manufacturing needs. The laser cleaning method includes: creating a laser beam; switching the wavelength output by the laser based on process requirements; propagating the laser beam via an optical path propagating module for laser cleaning the test piece; and removing debris. A transfer platform allows movements of the laser beams with respect to the test piece to achieve cleaning of the entire test piece. A control module controls the wavelength switching unit, the laser beam regulating module, and the transfer platform. Total laser cleaning with improved laser cleaning quality is achieved by using these laser beams with the appropriate wavelengths and energy. |
US11052435B2 |
Narrowband de-icing and ice release system and method
A way of using narrowband irradiation to de-ice or release ice from a surface is provided. The methodology can be applied to a range of different types of de-icing from windshield de-icing to aircraft wing de-icing to releasing ice from the ice tray of an ice making machine. While there are many different specific applications, the concept and methodologies taught remain similar across all of them. |
US11052431B2 |
Compositions and methods for GRAS compliant cleaners for ethanol production equipment
The present technology relates to various cleaning compositions and their methods of use in industrial facilities such as ethanol and biofuel producing vessels. Cleaning compositions according to the present technology may be Generally Recognized As Safe (GRAS) as designated by the U.S. Food and Drug Administration (FDA). The cleaning compositions of the present technology may effectively remove biofilm buildup and/or spent grain residue from industrial fermentation vessels and associated apparatus. Various embodiments of the cleaning composition may comprise various surfactants, chelators, acids, bases, and/or defoamers. Some embodiments of the cleaning composition may comprise a gluconate, a glucoside, a strong acid or base, and/or a defoamer. |
US11052424B1 |
Paint trencher
A paint trencher includes a main body, an abrasive body, and a handle. The main body includes a top panel, a bottom panel, and a support. The abrasive body, preferably a beveled-elongated body, is adjacently mounted to the support in order to cut into the wall. The handle is mounted to the top panel so that applied pressure of the main body can be transferred into the abrasive body thus cutting a trench into the wall. A felt pad is perimetrically attached around the bottom panel so that the surrounding wall area of the trench can be protected from unnecessary scratches. |
US11052422B2 |
Electronic component manufacturing method and apparatus
An electronic component manufacturing method includes a blotting process of bringing a conductive paste applied to an end portion of each electronic component body held by a jig into contact with a surface of a surface plate. The blotting process includes simultaneous performance of a distance changing process of changing the distance between an end face of each electronic component body and the surface of the surface plate and a position changing process of changing a two-dimensional position where the end face of the electronic component body is projected on the surface of the surface plate in such a manner that the direction of the movement of two-dimensional position in parallel to the surface of the surface plate successively varies (e.g., along a circular path). |
US11052420B2 |
Layer-by-layer coating apparatus and method
Apparatus and method are described and useful for, among other things, providing a layer by layer coating of materials on a belt. A directional gas curtain producing element is used to provide a gas curtain blowing on the belt in an upstream direction that simultaneously meters liquid from the belt and dries the belt. |
US11052418B2 |
Pressure-fed accessories adapter for an airless spray gun
A spray gun adapter establishes fluid communication between a fluid pump of a handheld airless spray gun and an applicator accessory. The adapter comprises an adapter body, a head attached to the adapter body, and a protrusion. The adapter body comprises an upper portion, a lower portion, a radial inlet located in a sidewall of the adapter body between the upper and lower portions, and an adapter bore having a first diameter in fluid communication with the radial inlet. The head attached to the adapter body is attached at the upper portion of the adapter body. The head comprises a cavity in fluid communication with the adapter bore and having a second diameter larger than the first diameter, an adapter outlet located in the upper portion of the adapter body and in fluid communication with the cavity, and a handle extending radially from the head. The protrusion extends radially from the adapter body between the upper portion and the lower portion of the adapter body. |
US11052417B2 |
Cleaning station for needle nozzles
A cleaning apparatus for cleaning a nozzle of a liquid dispensing device is disclosed. The cleaning apparatus includes a base member supporting a receiving head including a receiving opening for receiving a portion of the nozzle to be cleaned, a gas inlet for receiving pressurized gas, and an outlet at the receiving head for applying pressurized gas to the nozzle for flushing the nozzle. The receiving opening can include a sealing edge for sealing the receiving head against the nozzle when the nozzle is received in the receiving opening. The cleaning apparatus can also include at least one of a discharge tube, a collection vessel and a filter element. |
US11052415B2 |
Measured dosing and spray bottle for multi-use applications and associated method of using
Embodiments include a bottle and method for cleaning a grill. An exemplary method may be applied to grills having an upper grill and a lower grill. Methods can include providing a bottle having a dosing chamber with a first outlet, a reservoir chamber configured to store a solution and including a second outlet, and a sprayer for dispensing solution via the second outlet. The sprayer includes a spray head and a trigger that, when actuated, draws solution from the reservoir chamber and dispenses it by spraying the solution from the spray head. Methods can include filing the dosing chamber with a predetermined dose of solution from the reservoir chamber and dispensing the solution onto the lower grill from the first outlet, and dispensing the solution onto the upper grill by spraying the solution onto the upper grill from the second outlet. |
US11052414B2 |
Valve for an end piece including a shut-off device
Some embodiments are directed to a valve, including a rigid end piece that defines a center; a rod at the center of the end piece defining an axis; and a flap, wherein the flap is in one piece and has a flexible wall situated opposite a free end of the rod, the flexible wall is perforated by an orifice concentric with the end of the rod, the orifice has a contour substantially homothetic with that of the contour of the end of the rod in a plane perpendicular to the axis of the rod, the orifice has a surface below a projected surface of the end of the rod in the plane, the flap is connected to the end piece by a non-deformable fixed connection, and the flexible wall presses against the end of the rod at any point of its surface in contact with the end. |
US11052413B2 |
Remote trigger head for dispensing a liquid and dispensing device
A remote trigger head for dispensing a liquid includes a rewindable tube (2) having a predefined length and a winder unit (70) for the automatic spring rewinding of the tube (2). |
US11052412B2 |
Handheld texture spray gun with hopper
A sprayer includes a spray gun and a hopper. An air source provides compressed air to the sprayer to both eject fluid from the spray gun as a spray and to pressurize the hopper. The spray gun includes an airflow controller for controlling the flow of the compressed air to a nozzle of the spray gun, a pressure regulator for regulating a pressure of the compressed air flowing to the hopper, and a relief valve between the pressure regulator and the hopper. The hopper receives the compressed air through a port in the hopper, and the compressed air assists the flow of material out of the hopper and into the spray gun. |
US11052407B1 |
Dielectrophoretic in-droplet material concentrator
A dielectrophoresis-based in-droplet cell concentrator is disclosed herein. The concentrator can include a concentration microchannel having an input port and two or more outlet ports. The input port introduces cell-encapsulated droplets or particle-encapsulated droplets into the microchannel; a first outlet port receives droplets including most of the cells or particles and a second output port receives droplets including few cells or particles. The concentrator also can include a pair of electrodes. When voltage is applied, the electrodes will create an electric field across the microchannel. The concentrator adds new capabilities to droplet microfluidics operations, such as adjusting concentrations of cells in droplets, separating cells of different properties from inside droplets, and solution exchange. |
US11052404B1 |
Apparatus for remediation of a copper and nickel co-contaminated soil and a method for using the same
An apparatus for remediation of a copper and nickel co-contaminated soil includes a housing. A crushing device is arranged at the upper part of the inside of the housing. A stirring device is arranged below the crushing device. An anode electrode and a cathode electrode are provided at both ends of the inner bottom of the housing, respectively. In the present invention, the soil contaminated by copper and nickel is first poured from the top of the crushing device, and then crushed thoroughly under the action of the crushing device. The crushed soil facilitates the movement of copper and nickel metal ions therein toward the electrodes under the action of the anode electrode and the cathode electrode, thereby achieving optimal soil remediation. |
US11052403B2 |
Protection device for tool-holders for tools for shredding, cutting and collecting material
A protection device for tools for cutters and shredders and the like, arranged on a tool-holder seat for a tool-holder rotor rotatable about the axis of the rotor, said tool being housed in a seat arranged on the tool-bolder rotor, and formed by a first surface arranged at the front in the cutting direction and a second surface onto which the tool is fixed with its opposite surface to the cutting direction, the tool having a body that has a front surface in the rotation direction of the rotor, and a rear surface opposing the front surface. The tool and/or the seat having lateral projections and a protection device is dismountable connected to the seat of the tool, laterally as a protection for the tool and the plates being arranged partially between the lateral projections, of the tool and/or the seat of the tool, and the tool-holder rotor. |
US11052397B2 |
Device and a method for collecting and transferring samples of biological material
A device for collecting, transferring and/or conserving samples of biological material, comprising at least: a support body having at least a housing seating for a conserving element for samples, the housing seating being configured for enabling removably housing the conserving element for samples of biological material, the support body being configured for maintaining at least a conserving portion of the conserving element accessible for depositing a sample when the conserving element is housed in the housing seating; an operating portion, movable between a first closed position in which it is arranged in proximity of said housing seating and at least an open position in which it is arranged in a distanced position from the housing seating; and engaging portion configured for selectively and removably engaging a sampling element for samples, in particular an element for buccal sampling, to the support body and/or to the operating portion. |
US11052396B2 |
System and method for isolating and analyzing cells
A system and method for isolating and analyzing single cells, comprising: a substrate having a broad surface; a set of wells defined at the broad surface of the substrate, and a set of channels, defined by the wall, that fluidly couple each well to at least one adjacent well in the set of wells; and fluid delivery module defining an inlet and comprising a plate, removably coupled to the substrate, the plate defining a recessed region fluidly connected to the inlet and facing the broad surface of the substrate, the fluid delivery module comprising a cell capture mode. |
US11052392B2 |
Microfluidic device for cell separation and uses thereof
Methods for separating cells from a sample (e.g., separating fetal red blood cells from maternal blood) include introducing a sample including cells into one or more microfluidic channels. In one embodiment, the device includes at least two processing steps. For example, a mixture of cells is introduced into a microfluidic channel that selectively allows the passage of a desired type of cell, and the population of cells enriched in the desired type is then introduced into a second microfluidic channel that allows the passage of the desired cell to produce a population of cells further enriched in the desired type. The selection of cells is based on a property of the cells in the mixture, for example, size, shape, deformability, surface characteristics (e.g., cell surface receptors or antigens and membrane permeability), or intracellular properties (e.g., expression of a particular enzyme). |
US11052384B2 |
Chrome compound, catalyst system using same, and method for preparing ethylene oligomer
The present invention relates to a chrome compound composed of non-coordinating anions and a trivalent chrome cation, a reactant of the chrome compound and a bidentate ligand, an ethylene oligomerization reaction catalyst system using the chrome compound and the reactant, and a method for preparing an ethylene oligomer using the catalyst system. Through the above conformation, the present invention can selectively produce 1-hexene and 1-octene with high activity while omitting the use of methylaluminoxane (MAO), and can provide an ethylene oligomerization process more suitable for mass production. |
US11052370B2 |
Method and device for producing printed microarrays
Method for manufacturing microarrays and verifying the quality of said microarrays, wherein the method comprises: a) providing at least one reagent, b) loading said at least one reagent in a dispensing print head, in a predetermined arrangement, c) in a first print pass, generating instructions for the print head and moving said print head with respect to a substrate to print said at least one reagent on the substrate to obtain microarrays, d) obtaining an image of the printed microarrays by means of a camera, e) processing the obtained images of the printed microarrays, to calculate parameters indicative for the quality of the printed microarrays, f) comparing, at the end of the first print pass, the calculated parameters for the printed microarrays with predetermined criteria for the microarrays, to identify possible printing defects, g) comparing, for the printed microarrays, the identified printing defects of step f), h) using the outcome of the comparison of step g) to select a corrective action to improve the quality of the microarrays, prior to the printing of a subsequent print pass. |
US11052367B2 |
Reflecting spherical microcapsules
Each of monodisperse spherical microcapsules for seeding a transparent fluid to track movements of the fluid both in translational and rotational directions comprises a core; a shell; and 1 to 5 light reflecting solid integral particles. Each of the particles reflects incoming light in a defined direction; and each of the particles is embedded in the core and fixed in its orientation with regard to the shell. The shell and the core are transparent for the incoming light to be reflected by the particles entering and exiting the microcapsule. The shell has a thickness of not more than λ, λ being a wavelength of the incoming light, so that the shell does essentially not deflect the incoming light entering and exiting the microcapsule. The core includes a main component of the fluid such that a refraction index of the core essentially matches a refraction index of the fluid. |
US11052366B2 |
Erosion monitoring system for components for fluid bed catalytic cracking plants
An erosion monitoring system of components exposed to wear for use in systems equipped with a fluidized catalyst comprising a bundle of fiber optic sensors, said optical fibers being provided with one or more Bragg gratings, a processing unit and the fiber optic sensors depart off from the bundle and are positioned transversely to the wall exposed to erosion wear due to the erosion of the components to be monitored. |
US11052365B2 |
Process and apparatus for the production of synthesis gas
Reactive diluent fluid (22) is introduced into a stream of synthesis gas (or “syngas”) produced in a heat-generating unit such as a partial oxidation (“POX”) reactor (12) to cool the syngas and form a mixture of cooled syngas and reactive diluent fluid. Carbon dioxide and/or carbon components and/or hydrogen in the mixture of cooled syngas and reactive diluent fluid is reacted (26) with at least a portion of the reactive diluent fluid in the mixture to produce carbon monoxide-enriched and/or solid carbon depleted syngas which is fed into a secondary reformer unit (30) such as an enhanced heat transfer reformer in a heat exchange reformer process. An advantage of the invention is that problems with the mechanical integrity of the secondary unit arising from the high temperature of the syngas from the heat-generating unit are avoided. |
US11052363B1 |
Resaturation of gas into a liquid feedstream
A method for enabling gas exchange and chemical reactions with one or more liquid streams contained in a reactive process vessel are provided. One or more exchange layers within the process vessel can be composed of both collector media and releaser media. The exchange layers allow elements to facilitate increased performance of vessel operations by promoting gas component mixing and diffusion. Improved rates of gas component exchange mean less coking and more gas components available for reaction. |
US11052359B2 |
Blending station apparatus and method for using the same
A blending method is described for preparing a blended mixture. The blending method for preparing a blended mixture, the method includes: providing a control system having at least a processor, a computer-readable memory, and a display, wherein the memory contains software configured to receive a formula defining instructions for preparing a blended mixture using one or more blending materials and amounts for producing a batch size of the blended mixture on a scale; monitoring a weight on the scale as blending materials are added to a receptacle on the scale, both individually and in total; indicating on the display the amounts of the blending materials that have been added to the scale, both individually and in total, to prepare an amount of a custom blended mixture based upon the selected blending materials; determining an end weight of the custom blended mixture after a user has used the custom blended mixture; and recalculating a needed amount of the custom blended mixture by subtracting the end weight of the custom blended mixture from the prepared amount of the custom blended mixture. |
US11052357B2 |
Deployable stirring member
The invention relates to a stirring member (9) for using in a system for preparing a food product, the product being prepared by the stirring member (9) moving inside a container (8), the stirring member (9) being configured in such a way that it can adopt different configurations depending on its direction of rotation inside the container (8). Preferably, the stirring member (9) can adopt a spoon configuration or a whisk configuration. The invention further relates to a method for using such a stirring member (9) in a system for preparing a food product, the method varying the direction of rotation of the stirring member (9) so that it adopts a different configuration depending on the type of product prepared in the container (8). |
US11052353B2 |
Catalyst-containing oxygen transport membrane
A method is described of producing a catalyst-containing composite oxygen ion membrane and a catalyst-containing composite oxygen ion membrane in which a porous fuel oxidation layer and a dense separation layer and optionally, a porous surface exchange layer are formed on a porous support from mixtures of (Ln1−xAx)wCr1−yByO3−δ and a doped zirconia. Adding certain catalyst metals into the fuel oxidation layer not only enhances the initial oxygen flux, but also reduces the degradation rate of the oxygen flux over long-term operation. One of the possible reasons for the improved flux and stability is that the addition of the catalyst metal reduces the chemical reaction between the (Ln1−xAx)wCr1−yByO3−δ and the zirconia phases during membrane fabrication and operation, as indicated by the X-ray diffraction results. |
US11052349B2 |
Apparatus for membrane distillation using solar absorber and heat pump
The present disclosure to an apparatus for membrane distillation using a solar absorber and a heat pump, in which in the implementation of a membrane distillation process for producing treated water using a temperature difference between raw water and a coolant, raw water is heated using the solar absorber with improved heat collection efficiency, and through this, the treated water production efficiency of the membrane distillation process is improved. |
US11052340B1 |
Cylindrical filter cartridge cleaning device
A cartridge cleaning device comprising a cleaning nozzle joined to means for vertically displacing the nozzle, a power unit, and a rotatable platform. Fluid is introduced to the device and split into two streams, one stream providing fluid to the cleaning nozzle and the other stream directed to the power unit and effectuating rotation of a power wheel, thereby generating a torque which is transferred to the means for vertically displacing the nozzle and the rotatable platform. The torque to the means for vertically displacing the cleaning nozzle effectuates vertical displacement of the nozzle. The torque to the rotatable platform effectuates rotation of the rotatable platform on which at least one cartridge is placed during cleaning operations. The cleaning nozzle directs a stream onto the cartridge surface and perpendicular to the cartridge longitudinal axis and is displaced vertically in concert with cartridge rotation. |
US11052339B2 |
Backwashable depth filter
A hollow cylindrical depth filter formed of fibers of a thermoplastic resin and having a thickness of a filter medium of 5 to 25 millimeters, in which the filter medium has a compression ratio of 0.2 or less when a load of 0.5 MPa is applied thereto, the filter medium has a fiber layer of at least three layers from a fluid inflow side toward an outflow side, porosity of the three layers are adjusted to a specific range, respectively, and intersection points of the fibers forming the filter medium are bonded, a mean interval between the intersection points is 2 to 100 times a mean fiber diameter of the fibers in a length direction, and a ratio of the mean fiber diameter on a surface on an upstream side to the mean fiber diameter on a surface on a downstream side of the filter medium is 0.9 to 1.2. |
US11052337B2 |
Filtration filter and filtration filter device
A filtration filter includes a porous metal film that filters out a filtration object contained in a fluid, and a support base member that is disposed on at least one main surface of the porous metal film and that supports the porous metal film. The support base member has an opening that exposes a part of the porous metal film. An inner peripheral surface of the opening has undulations formed along its periphery. |
US11052333B2 |
Filter interconnect using a correlated magnet torque design
A filtration system interconnection structure having manifold with a rotatable manifold magnet of correlated magnets, a shroud with alignment tracks, an actuating valve for water ingress, and a filter cartridge having a rotatable filter magnet of correlated magnets, where the manifold magnet and the filter magnet are in magnetic communication with one another when the filter cartridge is inserted with the shroud, and are at least partially rotatably compatible, where the manifold magnet rotates with the filter magnet until the manifold magnet experiences a rotational stop beyond a predetermined rotation of the filter magnet, thus allowing the filter magnet to shift polarity with respect to the manifold magnet and present a repulsion force for removal of the filter cartridge from the shroud. |
US11052331B2 |
Diffusiophoretic water filtration device with closed channel structure
A diffusiophoretic water filtration device has a pressurizable gas chamber for receiving a pressurized gas; an inlet manifold for receiving a colloidal suspension including colloidal particles in water; a flow chamber having an inlet and an outlet, the flow chamber for receiving the colloidal suspension at the inlet from the inlet manifold, the colloidal suspension flowing between the inlet and at least one outlet in a flow direction; and a gas membrane separating the gas chamber and the flow chamber, the sheet being made of a gas permeable membrane, the pressurized gas capable of permeating the membrane, the membrane being water impermeable, the gas membrane having a first side facing the pressurized gas chamber, and a second side facing the flow chamber, the flow chamber having a plurality of channels, each channel contacting the second side of the membrane; and an outlet splitter separating a first outlet from a second outlet and splitting the plurality of channels, the first outlet for receiving water having a higher concentration of some of the colloidal particles than the second outlet. |
US11052329B1 |
Launder cover system
A launder cover system for reducing or eliminating sunlight exposure so as to prevent algae growth in a tank such as a clarifier tank. The launder cover system generally includes a plurality of support members and a plurality of launder covers which are each independently pivotably connected to a tank wall of a tank, such as by using a mount. The support members are each pivotably connected to the tank wall by a pivot connector and the launder covers are each pivotably connected to the tank wall by a hinge connector. Each support member is positioned between a pair of launder covers, and each launder cover is positioned between a pair of support members. The support members function to support the launder covers in a raised or lowered position. A launder support may be connected to the channel wall to support the launder covers in their lowered positions. |
US11052326B2 |
Feedback control optimization of counter-flow simultaneous heat and mass exchange
A counter-flow simultaneous heat and mass exchange device is operated by directing flows of two fluids into a heat and mass exchange device at initial mass flow rates where ideal changes in total enthalpy rates of the two fluids are unequal. At least one of the following state variables in the fluids is measured: temperature, pressure and concentration, which together define the thermodynamic state of the two fluid streams at the points of entry to and exit from the device. The mass flow rate of at least one of the two fluids is changed such that the ideal change in total enthalpy rates of the two fluids through the device are brought closer to being equal. |
US11052321B2 |
Applying participant metrics in game environments
A system that collects, analyzes, and applies physical metrics from participants in game environments. Participants (players and/or spectators) in a game may wear or hold devices that collect physical data from the participants via sensors, generate metrics data from the sensor data, and provide the metrics data to a participant metrics module. The module may receive the metrics data from the devices, analyze the metrics data to generate game inputs based on the participants' physical metrics, and provide the game inputs to the game system to affect game play. The module may also receive alerts or other information from the game system or from players, determine feedback for participants according to the received information, and signal the devices to provide feedback or alerts to the participants in the game. The devices may include indicators that are activated by the signals to provide visual, audio, and/or haptic indications to respective participants. |
US11052319B2 |
Guest management in an online multi-player virtual reality game
A guest management method and system for an online multi-player virtual reality environment or social networking site. A network interface receives guest access requests from guest clients and input data from a plurality of remotely-located clients. The input data is operative to control avatars associated with the clients in a modeled virtual reality environment. A memory holds program instructions for determining whether the guest access is associated with a member client. If the guest access request is associated with the member client, then the guest client is allowed to access the virtual reality environment via a guest avatar. The guest avatar's movements in the virtual reality environment are restricted based on a location of a member avatar controlled by the associated member client. For example, the guest avatar may only be permitted to move within an area that is bounded by a perimeter about the member avatar. |
US11052318B2 |
System and method for predicting in-game activity at account creation
This disclosure relates to a system and methodology for dynamically adjusting a game based on predictions made during game account creation in accordance with one or more implementations. The system may be configured to receive user information included in platform level accounts which were previously created by users on an online platform and assign one or more user types to the user based on that user information. The system may be configured such that game adjustments associated with one or more user types for future play by users associated with that user type may be modified over time based on historical and ongoing game activities undertaken by users associated with one or more user types. |
US11052317B1 |
Performing simulation of stretchable character in computer game
Embodiments relate to generating a character with a stretchable body part in a computer game. A pose of a body part of the character is received. The body part includes at least one base joint, bones connected via the at least one base joint, and an end effector coupled to one of the bones. An end effector position is received. The end effector position is where an end effector of the body part is to be placed in an updated pose. Inverse kinematics operations are performed to determine the updated pose of the body part by at least changing a length of one of the bones to place the end effector at the end effector position responsive to receiving the pose of the body part and the end effector position. |
US11052316B2 |
Method and apparatus for generating image parameter for reproducible virtual character
A method for generating an image parameter for a reproducible virtual character includes: receiving a trigger signal for generating a virtual character; acquiring a generation rule of an image parameter of the virtual character, the image parameter comprising n characteristic parameters configured to indicate an image of the virtual character; and generating a gene sequence of an ith characteristic parameter in the n characteristic parameters according to the generation rule. |
US11052313B2 |
Using connection quality history to optimize user experience
Methods and systems for assigning a data center to service a request from a user account include receiving a login request to a cloud gaming server. The login request is examined to identify a user account. A use history of the cloud gaming server is examined to identify a data center. The user account is assigned to the data center to start a session of streaming game play at a server within the data center. The data center is identified without performing a connection testing operation. |
US11052312B2 |
Non-transitory computer readable medium, method of controlling a game, and information processing device
A non-transitory computer readable medium including program instructions, a method of controlling a game, and an information processing device make a game more amusing. When executed, the program instructions cause the information processing device to store information related to objects and information related to game contents in a storage, associate positioning information in a virtual space with each object, associate positioning information with the game contents, cause the objects and the game contents to be displayed at the position indicated by the positioning information associated with each of the objects and the game contents, change the positioning information associated with an object and the positioning information associated with each game content associated with the object, determine whether a predetermined condition is satisfied, and finalize the positioning information associated with the objects and the positioning information associated with the game contents when the predetermined condition is determined to be satisfied. |
US11052309B2 |
Wireless interactive game having both physical and virtual elements
Embodiments of the invention provide a unique interactive game that connects both physical and virtual play environments and includes multiple dynamic layers in which a participant may complete a variety of challenges and/or tasks. For example, the participant may obtain a physical gaming item such as a toy from a retail phase that is usable in an interactive entertainment phase that provides virtual play via computer animation. The interactive entertainment phase may include multiple interrelated layers such that progress in one or more layers may affect the participant's experience in one or more other layers. The participant may also receive training on how to use and improve the physical gaming item to help achieve one or more special effects or complete one or more adventures and/or quests. During or following the interactive entertainment phase, the participant may use accumulated points and/or powers to redeem prizes and/or compete against other participants, such as in a duel or other face-off challenge. |
US11052308B2 |
Object control system in location-based game, program and method
An object control system in a location-based game, in which a character in a virtual world is linked with and moved along with a movement of a user in a real world, is provided with: a location information acquiring unit which detects a current location and displacement in the real world of the user; a virtual display data generating unit which selects a boundary line on real map information so as to be an area and a shape according to the current location of the user in the real world and information density on the real map information corresponding to the current location, and generates a virtual fantasy block that partially covers the real map; and a synthesis processing unit which superimposes and displays the fantasy block generated by the virtual display data generating unit on the real map information. |
US11052306B2 |
Wisdom ring puzzle
The wisdom ring puzzle includes a first member and a second member being an annular member, the first member including a connection post, a first small ring, a second small ring, and a first large ring, and a disconnection prevention part, a first post, and a second post sequentially provided to extend from the connection post toward a substantially same direction, the first post including a first ring catching part, the second post including a second ring catching part, the first small ring swingably caught in the first post by the first ring catching part, the second small ring and the first large ring swingably caught in the second post by the second ring catching part, the disconnection prevention part passing through the first small ring and the first large ring, the first post passing through the second small ring. |
US11052304B2 |
Management system of gaming chips and storage box
A system that manages a package of shuffled playing cards and gaming chips includes a storage box and a control apparatus. The storage box is provided in association with a game table and stores a plurality of shuffled playing cards and a plurality of chip cases and also includes a card reader that reads playing card ID codes of the shuffled playing cards and a chip reader that reads case ID codes of the chip cases. The control apparatus outputs total numbers of the shuffled playing cards and the chip cases stored in the storage box and the playing card ID codes and case ID codes stored in the storage box by monitoring read playing card ID codes and case ID codes. |
US11052303B2 |
Guard for in-line roller skate
There is provided a guard for an in-line roller skate, which includes an elongated member defining a wheel receiving channel. The channel has a bottom and a pair of opposed sidewalls, which extend upwardly from the bottom terminating in a remote edge. The remote edge of the sidewalls define a wheel insertion opening to receive wheels of an in-line roller skate. At least one transverse roller is positioned across the channel near the remote edge of the sidewalls. |
US11052302B2 |
Leg guard with adjustable strap
The leg guard for protecting at least a shin of a wearer includes a shin guard body and a strap. A peripheral edge of the shin guard body defines part of a perimeter of the shin guard body. The shin guard body includes a first coupling base and a second coupling base disposed on one of the interior and exterior surfaces. A first coupler is disposed at a first end of the strap and is releasably attachable to the first coupling base at a plurality of first attachment points, and a second coupler is disposed at the second end of the strap and is releasably attachable to the second coupling base at one of a plurality of second attachment points. A length of a wrappable segment is adjustable by releasably attaching the second coupler to the second coupling base at another one of the plurality of second attachment points. |
US11052301B2 |
Securing garment for a shoulder-pad system
A shoulder-pad system includes various components, including an impact-plate assembly and one or more sub-layers. The shoulder-pad system may be substantially retained in an arrangement or configuration using one or more securing garments. An exemplary securing garment includes an upper-body garment that at least partially wraps over, and attaches to, the impact-plate assembly. |
US11052300B1 |
Flying disc launcher
A flying disc launcher includes a frame body including a loading seat and a side wall. The loading seat includes a carrying portion and a receiving portion. A flying disc inlet and a flying disc outlet are respectively defined in both ends of the carrying portion. The side wall includes a guiding wall opposed to the receiving portion. A turntable is installed in the receiving portion and protrudes from an upper surface of the carrying portion. The power component is connected with the turntable to drive the turntable to rotate. When the turntable rotates and a flying disc is placed on the carrying portion from the flying disc inlet, the guiding wall and the turntable can contact the flying disc to drive and guide the flying disc to fly out toward the flying disc outlet. |
US11052298B2 |
Golf ball position gauging assembly and method
A golf ball position gauging assembly allows for a method of improving results based on a user's existing swing without modifying the existing swing. The assembly includes a pair of feet. Each foot has an associated aperture extending therethrough. Each of the feet has a bottom edge downwardly spaced from the associated aperture. A beam is insertable into or through each of the apertures such that the beam extends between the feet in an upwardly spaced position relative to the bottom edges of the feet. Each of a plurality of markings is incrementally spaced along the beam between the feet. The beam is insertable through a guide wherein the guide is slidable along the beam to be positioned adjacent to a selectable one of the markings. |
US11052289B2 |
Swim cap for persons with long hair
A swim cap for persons having long hair includes a shell preferably having at least two interconnected compartments for receiving and encapsulating the hair of a user. The swim cap is secured around the head of a user by at least one draw string or adjustable band positioned within a channel near the open end of the swim cap as well as a chin strap extending downwardly from the cap. The interconnected compartments can be inflated to provide buoyancy. The shell further includes an outer layer and an inner layer defining a space therebetween that can also be inflated, or comprised of buoyant material, to provide buoyancy. A pump, compressed air canister or manual filler tube in communication with the interconnected compartments or space within the shell can be used to provide inflation. A pair of ear flaps extends downwardly from the swim cap around a user's head. |
US11052288B1 |
Force measurement system
A force measurement system is disclosed herein. The force measurement system includes a force measurement assembly configured to receive a subject thereon, and one or more data processing devices operatively coupled to the force measurement assembly. In one or more embodiments, the one or more data processing devices are operatively coupled to the force measurement assembly, the one or more data processing devices configured to receive one or more signals that are representative of forces and/or moments being applied to a top surface of the force measurement assembly by the subject, and to convert the one or more signals into output forces and/or moments, the one or more data processing devices further configured to predict one or more balance parameters of the subject using a trained neural network. |
US11052286B2 |
Smart performance footwear and system
A footwear system that includes a left having a left toe region, left forefoot region, a left arch region and a left heel region, a left outsole, a left upper secured to the left outsole, and a left sensor system that includes at least a first left heel pressure sensor positioned in the left heel region, and at least a first left forefoot pressure sensor positioned in the left forefoot region. The footwear system also includes a right shoe that includes a right toe region, a right forefoot region, a right arch region and a right heel region, a right outsole, a right upper secured to the right outsole, and a right sensor system that includes at least a first right heel pressure sensor positioned in the right heel region, and at least a first right forefoot pressure sensor positioned in the right forefoot region. |
US11052284B2 |
Method, system and non-transitory computer-readable recording medium for supporting shooting a golf swing
The present invention relates to a method, system, and non-transitory computer-readable recording medium for supporting photographing of a golf swing. According to one aspect of the invention, there is provided a method for supporting photographing of a golf swing, the method comprising the steps of: (i) determining a user device matched with information on a user who is to perform a golf swing, among a plurality of user devices, with reference to a scenario associated with the golf swing; and (ii) causing a photographing module of the determined user device to photograph the golf swing of the user. |
US11052283B2 |
Hand grip
The present invention relates to a hand gripper including a first arm, a second arm, a pair of spring members, a first spring member coupling shaft, and a second spring member coupling shaft, wherein a plurality of first elastic force adjusting grooves and a plurality of second elastic force adjusting grooves, to which the first spring member coupling shaft and the second spring member coupling shaft are selectively coupled, respectively, to adjust strength of elastic force provided by the spring members, are formed in a first body of the first arm and a second body of the second arm, respectively. |
US11052282B2 |
Neckbalance
A device and method for influencing the movement and muscular function in the neck, includes a helmet, the helmet has a rim, said rim has notches along the edge, on top of the helmet there is attached a vertical rod, on top of this vertical rod there is attached at least two laser sights pointing forward, at least one rod is attached at one end to the vertical rod, and the at least one rod can rotate around the vertical rod. |
US11052281B2 |
Multi-purpose exercise device
A multipurpose exercise device is provided. The device includes features which allow the device to exhibit self-stabilizing features. The device includes a weighted body characterized by at least three substantially-loop-shaped handles which have dimensions and arrangements that are effective to cooperatively urge the device into one of several predetermined self-stabilizing rest positions. The rest positions are characterized by engagement portions of two of the provided handles resting against a support surface, while an elongated device bore extending along a center axis of the device is maintained in a substantially-horizontal orientation. The device may be stored safely in a variety of arrangements, including on a rack typically used for dumbbell storage. |
US11052279B1 |
Exercise machine
An exercise machine has a base housing and a boom that extends from a proximal end to a distal end. The boom is able to pivot between a rowing configuration wherein the boom is generally horizontal, and a skiing configuration wherein the boom is generally vertical. A rowing assembly includes a row handle attached to a row chain which extends into the base housing, to a row recoil device. A ski assembly includes a pair of ski handles, each ski handle being attached to a ski rope which extends into the base housing, to a ski recoil device. A transmission system has a shaft that is operably connected to a resistance device, the shaft having a row sprocket and a pair of ski spools, and the respective cables contact the spools so that movement of one of the cables rotates the respective spool, thereby rotating the shaft. |
US11052278B2 |
Pipe exercise device
A pipe exercise device designed to allow a user to transport a weight variable exercise device. The pipe exercise device includes an elongated member with an outer shell having a hollow interior designed to receive items therein. The elongated member has an open end disposed opposite a sealed end, wherein the open end is in communication with the hollow interior, such that a weight can be received therethrough to sit within the hollow interior. An end cap is designed to seal the open end, such that the weights therein are removably secured. At least one handle is disposed on the outer shell, such that the user can grasp the pipe exercise device. In this way, a user is able to transport a weight training device that can quickly and simply change the amount of weight used. |
US11052276B1 |
Weight plate and barbell component system
A barbell comprises a substantially cylindrical elongated bar having a plurality of connectors located along the length thereof. A generally disk shaped weight plate having a central aperture and a peripheral handle is provided, and the barbell is received within the central aperture. A fastening assembly is formed on the weight plate and extends between the central aperture and the peripheral handle. The fastening assembly is selectively movable between a first position in which it engages with one of the connectors on the barbell, and a second position in which it is disengaged from the connector on the barbell. |
US11052274B2 |
Method and apparatus for exercise energy utilization
A system for capture, storage, and usage of electric energy generated by humans during exercise activities, including exercise devices having a modular control-power storage unit that incorporates energy conversion units arranged to transform mechanical energy of the at least one human participant into different storable forms of energy, at least one energy storage module arranged to store energy in at least one storage medium, and at least one control unit arranged to provide digital or analog control for the at least one modular control-power storage unit. The system may also have a communication and networking subsystem structured as a networking device and arranged to connect to and communicate bay exchanging information with at wired and/or wireless network. |
US11052272B2 |
Multiple position adjustable exercise device
A multiple position adjustable exercise device includes a first plate, a second plate and an elastic member. The second plate is pivotally connected with the first plate. The elastic member is disposed between the first plate and the second plate, and when the second plate rotates relative to the first plate, the elastic member is twisted for providing an elastic recovering force. An initial position of the second plate relative to the first plate is adjustable for adjusting the elastic recovering force. |
US11052266B2 |
Method and apparatus for beam energy measurement
Apparatus for measuring radiation beam energy output from a radiation beam source, comprising a first beam energy sensor at a first distance from the radiation beam source along the radiation beam axis; a second beam energy sensor located at a second distance from the radiation beam source along the radiation beam axis; and an energy absorbing layer, for example a layer that removes a part of the low energy content of the beam or a layer that absorbs at least 1% of the beam energy, located between the first and second sensors, and positioned such that radiation passing through the first sensor also passes through the energy absorbing layer before entering the second sensor. |
US11052265B2 |
Fluence map optimization for field-in-field radiation therapy
Improved radiation therapy with field-in-field multi-leaf collimator, utilizing leaf sequencing Field-in-Field's (FIF) to accurately reproduce the input fluence map or original optimized dose distribution. The number of apertures used is constrained to a user-specified value all the way down to as few as 2 apertures which significantly magnifies the effect of poorly formed apertures. The disclosed invention further includes producing fluence maps with a homogenous dose throughout the treated volume utilizing leaf-sequencing Field-in-Field that reproduces more precise input fluence maps to yield optimized dose distribution. |
US11052262B1 |
Stimulation of subcortical brain regions using transcranial rotating permanent magnetic stimulation (TRPMS)
A method of affecting a biological, cellular or biochemical function or structure in a targeted subcortical location in a brain of a patient using a TRPMS apparatus placed on a head of the patient includes positioning two or more of a plurality of magnetic assemblies on locations of the head mount selected to stimulate the targeted subcortical location in the brain of the patient, and activating the plurality of magnetic assemblies at the selected locations to generate magnetic fluxes of a selected strength, frequency and duration directed into the brain of the patient, wherein the magnetic flux directed into the brain of the patient from each of the assemblies is operative to generate induced electric field in regions of the brain and the regions of induced electric fields generated by each of the plurality of magnetic assemblies converge in the targeted subcortical location and combine to a magnitude sufficient to affect the biological, cellular or biochemical function or structure in the targeted subcortical location. |
US11052260B2 |
Implantable electrode coupled to an optoelectronic device
An optoelectronic electrode element includes an electrode module (40) having at least a first and second electrodes (41, 42) each having an electrode surface (41s, 42s). An an optoelectronic module (20) is provided and having a photovoltaic cell (21a) suitable for transforming optical energy into electrical energy. A feeding fibre optic (31a) is also provided. A coupling module (10) is provided and having a circuit receiving portion (12) for inserting, positioning, and rigidly fixing the optoelectronic module (20) to the coupling module (10); and a feeding fibre cavity (11a) for inserting and coupling the feeding fibre optic to bring it in optimal optical communication with the photovoltaic cell. The coupling module (10) is coupled directly to a fixing area of the electrode module (40), such that the photovoltaic cell be in electrical contact with the first and second electrodes (41, 42). |
US11052258B2 |
Methods and systems for detecting atrial contraction timing fiducials within a search window from a ventricularly implanted leadless cardiac pacemaker
A ventricularly implantable medical device that includes a sensing module that is configured to identify a search window of time within a cardiac cycle to search for an atrial artifact. Control circuitry in the ventricular implantable medical device is configured to deliver a ventricular pacing therapy to a patient's heart, wherein the ventricular pacing therapy is time dependent, at least in part, on an atrial event identified in the search window of time. |
US11052254B2 |
Methods and systems of electrode polarity switching in electrical stimulation therapy
Methods for electrically stimulating body tissues to improve function or reduce symptoms provide an electrical stimulation system having two or more electrodes that are capable of being switched independently from a hyperpolarizing (depolarizing) state to a hypopolarizing state. Multiple combinations of hyperpolarizing electrodes and hypopolarizing electrodes are created by polarity switching to determine a polarity configuration having the best performance as determined by symptom reporting and clinical diagnostic tests. Polarity switching is triggered manually or is programmed to be switched automatically. Determining the configuration providing electrical stimulation resulting in the greatest benefit allows the system to be operated with one or more electrodes in a hypopolarizing state, thereby reducing energy requirements, tissue tolerance, and tissue fatigue. |
US11052251B2 |
Device for the transcutaneous electrical stimulation of the trigeminal nerve
A device for the transcutaneous electrical stimulation of the trigeminal nerve is provided. The device has an elongated symmetrical support with at least one electrode pair, and the support can be applied on a person's forehead in the supraorbital region to cover the afferent paths of the supratrochlear and supraorbital nerves of the ophthalmic branch of the trigeminal nerve. Each electrode pair contacts a self-adhesive conductive gel that at least partially covers one surface of the support for attaching the support to the forehead to be applied to two lateral zones with the exception of an insulating central zone. Each lateral zone has one electrode of the electrode pair, an electric circuit for supplying to the electrode pair electric pulses that have a predefined intensity, and a measurement means for measuring the intensity of the supplied pulses that is connected to the electric circuit. |
US11052248B2 |
Device and implantation system for electrical stimulation of biological systems
The present specification discloses devices and methodologies for the treatment of achalasia. Individuals with achalasia are treated by implanting a stimulation device within the patient's lower esophageal sphincter and applying electrical stimulation to the patient's lower esophageal sphincter, in accordance with certain predefined protocols. The presently disclosed devices have a simplified design because they do not require sensing systems capable of sensing when a person is engaged in a wet swallow and have improved energy storage requirements. |
US11052247B2 |
Skin treatment system
A skin regeneration therapy combining precise bioelectric signals, light, and biologics for skin treatment and regeneration. Precise bioelectric signals give clear instructions to the stimulated cell DNA/RNA to produce specific regenerative proteins on demand. Bioelectric signals give clear instructions to cell membranes on what to let in and what to let out and serve as an equivalent or surrogate of environmental stimuli to cause a cell action in response. |
US11052240B2 |
Electro kinetic transdermal and trans mucosal delivery accelerator device
A medical device for administering a medicament is disclosed that includes a reservoir for storing the medicament, a current driver electrically coupled to an electrode, and an oscillation driver electrically coupled to a vibrational element. The electrode forms multiple channels in fluid communication with the reservoir. A method of administering a medicament is also provided. |
US11052239B2 |
Cannula, cannula system, heart pump system and method for relieving the volume of a heart
A cannula for relieving the left side of the heart is provided, the cannula having a cannula shaft comprising a heart-side inlet and a pump-side outlet. A lumen extends between the inlet and the outlet, and a suture ring for connecting the cannula to a left atrium is arranged on an outer side of the cannula shaft. The outlet is configured such that the outlet can be connected to a pump and the length of the cannula shaft between the suture ring and the outlet is such that the cannula shaft can be guided outwards through an intercostal space. |
US11052238B2 |
Vena-caval sleeve
Apparatus and methods are described for use with a tributary vessel of a subject that supplies a vein of the subject. Blood within the tributary vessel is mechanically isolated into a compartment that is separated from blood within the vein. Blood flow from the tributary vessel to the vein is controlled by pumping blood from the compartment to the vein. Other applications are also described. |
US11052237B2 |
Swivel hub
The present disclosure relates to a connector for medical devices. The connector may have two interfaces facing different planes. The two interfaces may provide access to the connector's core and hub. The hub may be free to rotate relative to the core to increase accessibility and/or angle attachment while maintaining a fluid pathway between the core and the hub. |
US11052236B2 |
Conduit connector for a patient breathing device
In an embodiment, a connector or connector assembly for attaching a nasal cannula with a gas delivery hose includes a sensor port for a sensor probe positioned near an end of a nasal cannula, which can allow the sensor probe to be placed closer to the patient's nostrils than previous connector parts allowed. The connector can be configured to advantageously allow the nasal cannula to rotate relative to the gas delivery hose, thereby allowing a patient or healthcare provider to untangle or otherwise straighten the hose or the cannula. The connector assembly can be configured to automatically align locking protrusions on a first component with locking recesses on a second component, where insertion of the second component within the first component causes the second component to rotate relative to the first component, thereby aligning the locking protrusions with associated locking recesses. |
US11052235B2 |
Lever lock-type male connector and male connector assembly
Levers (30) are connected to a base end portion (13) of a male luer via a base (15). Each lever includes a locking portion (31) and an operating portion (35). A locking claw (32) protrudes from each locking portion toward the male luer. A lock ring (8) is provided opposing inner surfaces of the operating portions. The lock ring is movable between a first position at which the lock ring is located close to the base and a second position at which the lock ring is located away from the base. When the lock ring is at the first position, the levers are pivotable such that the locking claws move away from the male luer. When the lock ring is at the second position, the lock ring restricts the levers from pivoting such that the locking claws move away from the male luer. |
US11052234B2 |
Connector with integrated non-return check valve for extension tubing and urology collection systems
A connector-with-integrated-check-valve for minimizing microbial migration to catheter-tubing is formed from three parts: a connector-for-catheter-tubing that is hollow and with an internal valve seat; an elastomer gate (sometimes with disc and stem); and a connector-for-extension-tubing that is hollow and with support-surfaces. When one end of the connector-for-catheter-tubing is attached to one end of the connector-for-extension-tubing, a pocket is formed where the seat is disposed opposite and facing the support-surfaces; the gate is disposed within this pocket; such that when the gate contacts this seat due to urine backflow (reflux), the connector-with-integrated-check-valve is closed to such urine backflow; and where a remaining end of the connector-for-catheter-tubing is attachable to catheter-tubing; and where a remaining end of the connector-for-extension-tubing is attachable to the extension-tubing, such that there is a continuous urine flow path from the catheter-tubing, to the connector-with-integrated-check-valve when open, and to the extension-tubing. |
US11052233B2 |
Tube for a medical container
A tube for a medical container has a tube wall which consists of at least two layers. According to the invention, at least one layer contains a styrene-containing thermoplastic polymer (S-TPE), in particular a styrene-butadiene block copolymer (SBC) or a copolyester, a copolyester ether or a cyclic olefin copolyester. The at least one other layer contains ethylene-vinyl acetate copolymer (EVA), preferably with a vinyl acetate (VA) portion in the ethylene-vinyl acetate copolymer of from 10% to 30%, preferably 14% to 28%. The EVA can be mixed with a thermoplastic polybutene and/or SEBS to improve the tube properties. The tube wall can have a two-layer structure with an inner or an outer layer which contains the S-TPE, copolyester, copolyester ether or cyclic olefin copolyester, or a three-layer structure with an outer and inner layer containing the S-TPE or copolyester or copolyester ether. |
US11052230B2 |
Implantable encapsulation devices
The present disclosure relates to implantable encapsulation devices for housing a biological moiety or a therapeutic device that contains a biological moiety. Particularly, aspects of the present disclosure are directed to an implantable apparatus that includes a distal end, a proximal end, a manifold including at least one access port positioned either at the distal end or the proximal end, and a plurality of containment tubes affixed to the manifold and in fluid communication with the at least one access port. Additionally, the encapsulation device may contain a flush port and a tube that are fluidly connected to the manifold. The containment tubes may contain therein a biological moiety (e.g., cells) or a therapeutic device (e.g. a cell encapsulation member). |
US11052229B2 |
Devices and methods for guidewire extension in spinal surgery
A guidewire system for spine surgeries includes a first guidewire portion having an elongate first guidewire body with a distal end and a proximal end. A threaded male fastener at the distal end of the first guidewire body is configured to fasten to a vertebra of a spine of a subject and a threaded female coupler at the proximal end of the first guidewire body defines a threaded opening. The guidewire system includes a second guidewire portion having an elongate second guidewire body with a distal end and a proximal end. A threaded male coupler at the distal end of the second guidewire body is configured to thread into the threaded female coupler of the first guidewire portion to fasten the second guidewire portion to the first guidewire portion to form an elongate guidewire. |
US11052227B2 |
Deflectable catheter shaft section, catheter incorporating same, and method of manufacturing same
A deflectable catheter shaft section is disclosed comprising an elongated body extending along a longitudinal axis and comprising a distal end and a proximal end; and a plurality of lumens extending along the longitudinal axis of the elongated body, wherein at least one of the lumens is abutting at least another one of the lumens. A catheter comprising the deflectable catheter shaft section and a method of manufacturing the deflectable catheter shaft section are also disclosed. A catheter incorporating a deflectable catheter shaft section can further comprise first and second compression coils disposed over pull wires located within the catheter, wherein the compression coils are unattached to the catheter or components thereof, but can be constrained by a shaft coupler at a distal end of each of the compression coils and by at least a portion of a handle assembly at a proximal end of each of the compression coils. |
US11052226B2 |
Steerable medical devices, systems, and methods of use
Steerable medical devices and methods of use. In some embodiments, the steerable medical devices can be steered bi-directionally. In some embodiments the steerable medical devices include a first flexible tubular member and a second flexible tubular member secured together at a location distal to a steerable portion of the steerable medical device. |
US11052222B2 |
Sleep induction device and method for inducting a change in a sleep state
A sleep induction device includes at least one sensor for detecting a physiological characteristic of the user, a stimulator configured to provide successive stimuli to the user to anticipate on the detected physiological characteristic, which successive stimuli define a guidance path, and which guidance path is to be followed by the user to induce a change during the sleep session of the user, a memory which is arranged to store values of detected physiological characteristics, and provided stimuli during the sleep session, and a processing unit including a control programme which is programmed to determine a current sleep state of the user, which current sleep state is based on at least one detected physiological characteristic measured by the at least one sensor and which control programme is programmed to generate an initial guidance path to induce a change from the determined current sleep state to another sleep state. |
US11052221B2 |
Infant calming/sleep-aid device
An infant calming/sleep-aid device that includes a moving platform and a sound generator, the sound and motion adapted to calm a fussy baby, induce sleep, and maintain sleep under normal conditions. The device makes a determination as to whether sound signals represent sound coming from inside the device or outside the device. If the sound signals are coming from the inside the device, then the signals are evaluated in a specified frequency band to determine whether the sound is a baby cry. If a determination is made that there is a baby cry, then a threshold analysis is performed to quantify the cry and compare it to a threshold value. If the cry is above a specified threshold, the device moves the platform and/or generates sound. |
US11052220B2 |
System and method for adjusting the volume of auditory stimulation during sleep based on sleep depth latencies
The present disclosure pertains to a system configured to adjust a volume of auditory stimulation delivered to a subject during sleep. The system is configured to determine a deepening time indicative of a rate at which sleep of the subject deepens during the sleep session. The deepening time is determined based on (i) a ratio of power in a high frequency band of an EEG signal to power in a low frequency band, (ii) a density of slow waves, or (iii) a hypnogram, indicative of sleep depth in the subject during the sleep session. The system is configured to determine a rate of volume increase for auditory stimulation during a subsequent sleep session based on the deepening time; and control the one or more sensory stimulators to adjust the volume of auditory stimulation provided to the subject during the subsequent sleep session based on the determined rate of volume increase. |
US11052219B2 |
Sensory activity sack
A sensory activity sack provides a garment with pleasant tactile features offering safe sensory stimulation for persons with developmental or sensory disabilities and an isolation bag for the wearer's arms and hands. The isolation bag prevents the wearer from engaging in self-injurious behavior or other harmful behaviors. Multiple fabrics and textures in the isolation bag, including mesh and denim, provide a pleasing tactile experience, which can be furthered by the placement of toys into the isolation bag. Sensory panels made with a sturdy, textured material such as denim provide tactile stimulation and resistance against wear and biting, as well as adding a comforting weight to the sensory activity sack for wearers with sensory issues. |
US11052212B2 |
Capnoxygen masks
An oxygen mask configured for CO2 sampling and oxygen delivery, the oxygen mask having an oxygen inlet, a nasal breath-sampling element and a breath sampling port configured to receive breath samples, sampled by the breath-sampling element, wherein the breath-sampling element is configured to reduce dilution of exhaled breath by the delivered oxygen. |
US11052211B2 |
Interchangeable mask assembly
A system of breathing arrangements for delivering breathable gas to a patient includes at least first and second cushion components, e.g., full-face, nasal, nasal prongs, nose tip, and/or a combination of any of the above, including a nasal or full-face cushion and nasal prongs/nozzles combination, etc., that are different from one another in at least one aspect, and a common frame assembly configured to support each of the first and second cushion components. Various embodiments are directed to a full-face or nasal mask used with a frame having lateral connector portions having a stiffening member. The mask assembly may include a nose height adjustment device for the height of the cushion, or a cushion adjustment member by which the position of the cushion may be adjusted relative to the frame. The mask assembly may include a chin strap assembly. |
US11052210B2 |
Patient interface with blowout prevention for seal-forming portion
One form of the present technology includes a sealing structure to seal against a user's face around the user's airways. The sealing structure includes a flap or membrane that extends inward towards the user's airways and includes a structure that prevents an inner boundary of the flap or membrane from being blown outwards (e.g., folded backwards upon itself) due to internal pressurization. |
US11052207B2 |
Gas sensing apparatus
The present disclosure pertains to an apparatus configured to facilitate monitoring of gas in a therapeutic gas delivery system with a catalytic sensor. The gas delivery system comprises a pressure generator having an inlet and an outlet, and a gas delivery flow path configured to communicate the gas between the pressure generator and a subject. The apparatus comprises a receiver body configured to receive the catalytic sensor such that the catalytic sensor removably couples with the receiver body, the receiver body located remotely from/outside the gas delivery flow path; a delivery port configured receive a portion of gas obtained from the gas delivery system that has passed through the pressure generator outlet and guide the received portion of gas toward the catalytic sensor; and a return port configured to exhaust the received portion of gas from the receiver body to the gas delivery system through the pressure generator inlet. |
US11052202B2 |
Drug delivery device for the treatment of patients with respiratory diseases
Drug delivery devices that include a microphone and processing circuitry that can detect operating events, such as peak inspiratory flow (PIF) and Breath Actuated Mechanism (BAM) in dry powder inhalers can be used to improve clinical trials by providing information about the way in which the inhalers under test are being used. |
US11052199B2 |
Auto-injector
An autoinjector having a body (1) receiving a reservoir (S), the reservoir containing fluid and including a piston (P); a piston rod (5) adapted to co-operate with the piston (P) of the reservoir (S), the piston rod (5) movable by an injection spring (8) between a primed position and an injection position in which the piston rod (5) has moved the piston (P) of the reservoir (S); and an indicator device for indicating that the autoinjector may be removed from the injection site. The autoinjector includes a retarding system for delaying actuation of the indicator device relative to the end of injection, the retarding system including a dashpot (16) containing a fluid and a piston (19) arranged in the dashpot (16). The retarding system has the dashpot (16), the piston (19), a retarding spring (18), a locking key (20), and the piston rod (5), and the piston rod (5). |
US11052198B2 |
Rotary sensor assembly with axial switch and redundancy feature
A sensor assembly comprising a first rotary sensor part with a plurality of individual electrically conducting axial position sensor segments arranged in a circumferential pattern, and a second rotary sensor part arranged rotationally relative to the first portion and comprising a plurality of circumferentially arranged electrically interconnected axial position contacts adapted to be arranged in contact with the axial position sensor segments. The assembly further comprises actuator means for axially moving the axial position contacts between a connected and a dis-connected position, wherein the axial position contacts and the axial position sensor segments are arranged such that for a given rotational position at least two axial position contacts each are in contact with a different axial position sensor segment. |
US11052187B2 |
Packaging for a reel of medical injection devices
A packaging for a reel of medical injection devices includes a base tray configured for supporting the reel and at least a first flat rib and a second flat rib. Each rib includes a respective slot arranged such that the ribs can be interlocked with one another by mutual engagement of the slots. The base tray includes at least two pairs of peripheral openings. Each opening is configured to receive an end of the ribs, so that the base tray and interlocked flat ribs engaging the base tray form a frame configured for enclosing the reel. |
US11052183B2 |
Devices for urea electrolysis and methods of using same
The present disclosure provides devices and methods of using same for cleansing a solution (e.g., a salt or used dialysis solution) of urea via electrooxidation, and more specifically to cleansing a renal therapy solution/dialysis solution of urea via electrooxidation so that the renal therapy solution/dialysis solution can be used or reused for treatment of a patient. In an embodiment, a device for the removal of urea from a fluid having urea to produce a cleansed fluid includes a urea decomposition unit and an electrodialysis unit. |
US11052182B2 |
Method and apparatus for checking a dialyzer for the presence of a leak
The present invention relates to a method for checking a dialyzer for the presence of a leak in the semipermeable membrane of the dialyzer, wherein the membrane divides the inner dialyzer space into a least one blood chamber and into at least one dialyzate chamber, wherein the blood chamber is flowed through by blood in the operation of the dialyzer and is in fluid communication with a blood-side line system and the vascular system of the patient, and wherein the dialyzate chamber is flowed through by dialysis fluid in the operation of the dialyzer and is in fluid communication with a dialyzate-side line system, wherein the method comprises the following steps: a) emptying the blood chamber or the dialyzate chamber of blood and of dialysis fluid respectively and keeping the fluid (blood or dialyzate) in the non-emptied dialyzate chamber or blood chamber; b) building up a test pressure by means of a gas, in particular by means of air, in the emptied blood chamber or in the emptied dialyzate chamber; and c) measuring the pressure drop over time in the emptied blood chamber or in the emptied dialyzate chamber or in the line system respectively in fluid communication therewith and/or measuring the pressure increase in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in the line system respectively in fluid communication therewith or measuring the number of air bubbles or of a parameter correlated with the number of air bubbles in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in a line system respectively in fluid communication therewith, wherein the steps a) to c) are carried out subsequent to the blood treatment of the patient and subsequent to the disconnection of the patient from the blood-side line system. |
US11052181B2 |
Cassette system integrated apparatus
A cassette integrated system. The cassette integrated system includes a mixing cassette, a balancing cassette, a middle cassette fluidly connected to the mixing cassette and the balancing cassette and at least one pod. The mixing cassette is fluidly connected to the middle cassette by at least one fluid line and the middle cassette is fluidly connected to the balancing cassette by at least one fluid line. The at least one pod is connected to at least two of the cassettes wherein the pod is located in an area between the cassettes. |
US11052178B2 |
Arrangements and methods for avoiding spreading of infectious agents and improving electric safety and suction performance of a medical aspirator
Vacuum pump (18) for a medical aspirator (10), the pump (18) comprising a tubular member (20); a piston (22) slidably arranged within the tubular member (20); a piston rod (24) connected to the piston (22); and a coupling mechanism (36) for detachably and functionally connecting the piston rod (24) to a motor (38) for driving the pump (18), wherein the piston rod (24) is configured to reciprocate linearly during operation of the pump (18). |
US11052176B2 |
Gradient coatings of biopeptides that promote endothelial cells selective adhesion and directional migration and methods of using the same
A two-layer gradient coating article is provided that is operable to cause selective adhesion and directional migration of endothelial cells. The first layer includes cell-resisting polymers that repels cells, the second layer includes one layer of peptides that has affinity to and binds specifically to endothelial cells. Furthermore, the peptides are distributed in a gradient, in which attached ECs migrate towards the direction of increased concentration, thus enriching the ECs to a desired locus. The combination of a cell-repelling layer and a graded affinity peptide produces a unique result of selective adhesion, directional migration, thus local enrichment of endothelial cells. A method for using such gradient coating article and its potential use in treating cardiovascular diseases are also provided. The invention provides an inexpensive, stable and effective means for attracting ECs to desirable locations. |
US11052175B2 |
Cartilage-derived implants and methods of making and using same
Cartilage fibers and implants made therefrom are disclosed, with and without cartilage particles. Methods for making the cartilage fibers and the implants containing them are also disclosed. The implants may be pre-shaped and may be reshapable and provide good shape retention and little swelling when placed into a cartilage defect. |
US11052173B2 |
Conductive biomaterial for enhancement of conduction in vitro and in vivo
The present disclosure relates to a biocompatible, electrically conductive polymer capable of carrying the electrical potential of a cardiac impulse. The present disclosure also relates to treatments using the electrically conductive polymer, such as for atrial fibrillation. |
US11052170B2 |
Temporary dressing for an internal wound
The invention relates to a device for treating blood flow in an internal wound, including a handling member connected to a series of successively narrower tubes, each tube including a liquid-expandable article. The tubes can be pivotably connected to each other, allowing the tubes to conform to the contours of the wound, or fixed together. The tubes can be encased in a liquid-soluble layer that keeps the liquid-expandable article sequestered from liquids.The stepwise-tapering profile of the device allows for its insertion into the internal wound with little or no resistance until fully seated. Upon encountering liquids within the wound, the liquid-soluble layer can dissolve to expose the liquid-expandable article. When exposed to the wound liquids, the liquid-expandable element can expand in volume, providing compressive pressure against internal wound surfaces and minimizing blood loss.The tubes and the liquid-expandable element can include therapeutic agents for treating the wound. |
US11052169B1 |
Systems, apparatus and methods for purifying air
Systems, apparatus and methods for disinfection of airflow. An apparatus for disinfecting air-conditioned airflow in a confined space includes: a modular housing; and a disinfection chamber enclosed within the housing. The disinfection chamber includes a plurality of disinfection sheets. Each disinfection sheet comprises a plurality of ultraviolet (UV) light sources. The airflow is configured to be routed along a serpentine pathway within the housing to expose microorganisms in the airflow to far UV-C light emitted by the UV light sources for an extended and optimal duration. |
US11052168B2 |
Air germicidal device
An air germicidal treatment device and system for removing or eliminating unwanted pathogens or bacteria in an airstream is shown. The device or system has a removable irradiation chamber that divides an interior area of the device into an air pre-chamber area, an air post-chamber area and an irradiation area therebetween. The removable irradiation chamber is generally trapezoidal in shape and has end walls that are inclined with respect to an interior divider wall. |
US11052167B1 |
Glass aroma diffuser
A glass aroma diffuser is provided, including a base, a water tank and a top cover. The bottom of the water tank is fixed on the base, the opening of the water tank is upward, and the bottom of the water tank is provided with an atomizer, and the water tank is configured to carry the liquid to be atomized; the top cover is provided with an exhaust nozzle for discharging mist. The top cover and the water tank of the aroma diffuser of the present disclosure are made of glass material, the atomizer is arranged under the water tank, and the exhaust nozzle is arranged on the top cover, which greatly reduces the use of plastic materials, thus reducing the plastic taste carried in the mist, reducing the probability of mist affecting human health, greatly improving the use experience, and making users feel more comfortable to use. |
US11052166B1 |
Frequency selective viral inactivation through bond breaking
An apparatus is provided for delivering IR and/or UV radiation, to an area or a surface in which virions, such as SARS-CoV-2 (the virus that causes the disease, COVID-19), may exist, wherein the IR radiation is intended to degrade the viral envelope of the virions and wherein the UV radiation is intended to break specific molecular bonds in order to degrade the RNA of the virion contained within a viral envelope. |
US11052165B2 |
Method for virus clearance
The invention discloses a method for virus clearance of a cell culture medium, comprising the steps of: i) providing a bulk medium portion, comprising amino acids and glucose, and a first additive portion, comprising vitamins in aqueous solution; ii) subjecting the bulk medium portion to a high temperature short time treatment (HTST); iii) passing the first additive portion through a virus retentive filter or an ultrafilter; and iv) after steps ii) and iii), mixing the bulk medium portion with the first additive portion to obtain a cell culture medium. |
US11052163B2 |
Homing agents
The present disclosure provides peptide constructs for diagnostic imaging and therapeutic applications, using pegylated peptides which exhibit specific binding for a target molecule of interest, such as a biomarker of a disease or disorder. |
US11052162B2 |
Liposomal gadolinium (GD) contrast agent “NMRX” for T1-MRI
The present invention is directed towards new chemical entities based on a lipid-paramagnetic metal ion chelate. The lipid portion of the compound intercalates into the membrane of a liposome. The compounds of the invention find particular use as paramagnetic contrast media for magnetic resonance imaging. It has been surprisingly discovered that the liposomal contrast media do not substantially cross the placental barrier into the vasculature of the fetus(es) when administered to a pregnant subject. These novel compounds are useful in the diagnosis of disorders and diseases in both gravid and non-gravid subjects. The invention is also directed towards pharmaceutical compositions comprising these compounds and the uses of these compounds. |
US11052158B2 |
Delivery of urea to cells of the macula and retina using liposome constructs
Provided are liposome constructs for delivery of urea to the vitreoretinal interface of the eye. The liposome constructs are agglomerates of small lamellar vesicles (SUVs) and have a greater density than the vitreal fluid, such that they sink to the back of the eye rather than dispersing throughout the vitreous. |
US11052148B2 |
Compositions and methods for generating an immune response to hepatitis B virus
The compositions and methods are described for generating an immune response to a hepatitis B virus. The compositions and methods described herein relate to a modified vaccinia Ankara (MVA) vector encoding one or more viral antigens for generating a protective immune response to a hepatitis B virus, in the subject to which the vector is administered. The compositions and methods of the present invention are useful both prophylactically and therapeutically and may be used to prevent and/or treat an infection caused by hepatitis B virus. |
US11052147B2 |
Stable virus-containing composition
Described herein are compositions and pharmaceutical compositions including poxviruses, in particular vaccinia virus such as modified vaccinia Ankara (MVA) virus, a sulfate salt at a concentration between about 5 mM and 300 mM and a buffer, wherein the composition has a pH of between about 6.0 and 8.5. Also described are methods for stabilizing a poxvirus composition by preparing said viral formulation. |
US11052142B2 |
Modified endotoxic bacteria lipopolysaccharide (variants), combination of modified lipopolysaccharides (variants) and, containing same, a vaccine (variants) and a pharmaceutical composition (variants)
For the first time individual (free from impurities of penta- and hexa-acetylated derivatives) di-, tri- and tetra-acetylated S-LPS of endotoxic bacteria and combinations thereof were obtained and their immunobiological, physical-chemical and chemical-pharmaceutical properties were studied.For the first time the principal possibility of their clinical application was directly demonstrated as vaccines and pharmaceutical compositions containing the modified S-LPS individual as monocomponent or combinations thereof as two and three component active substance, respectively.The modified S-LPS and combinations thereof have high safety profile and provide low pyrogenicity and high immunogenicity. Developed on their basis vaccines and pharmaceutical compositions demonstrate anti-shock activity, high efficiency and specificity, broad-spectrum action and also good chemical-pharmaceutical parameters. |
US11052140B2 |
Methods of treatment using conditional superagonist CTL ligands for the promotion of tumor-specific CTL responses
What is described is a method of treatment of a patient with a tumor, comprising administering a cell responsive to a peptide comprising a tumor epitope, wherein the tumor epitope comprises an amino acid substitution in a tumor antigen. The tumor antigen is preferably selected from the group consisting of NYESO-I157-165, NYESO-II157-170, or MART-126-35, preferably SEQ ID NOS: 1-351, 361-376, and 392-401. |
US11052135B2 |
Methods and compositions for treating hunter syndrome
The present invention provides, among other things, compositions and methods for CNS delivery of Idursulfase-beta, a human recombinant iduronate-2-sulfatase protein, for effective treatment of Hunter Syndrome. The compositions and methods provided by the present invention effectively reduce symptoms not only in brain and spinal cord but also in peripheral tissues including heart, liver, spleen, lung, and kidney. |
US11052133B2 |
Glucose responsive insulins
This disclosure provides a composition containing a conjugate with a modified insulin molecule. The conjugate has an insulin molecule, which can be insulin or an insulin analog, glucagon, GLP-1, GLP-2 or a GLP-1 agonist. The conjugate also contains one or more polymers. Each of the one or more polymers is covalently linked to the insulin molecule. Additionally, each of the one or more polymers is covalently linked to between 0 to 50 copies of a decoy ligand, and to between 0 to 50 copies of a glucose-binding agent, such that the combined total number of glucose-binding agents and decoy ligands covalently linked to each of the one or more polymers is at least 1. The conjugate can reversibly bind to soluble glucose and in which the extent of its glucose-binding controls the extent to which the modified insulin is able to bind to and activate the insulin receptor. Methods of making the conjugate, as well as use of the conjugate in treatment, are also provided. |
US11052131B2 |
Methods and pharmaceutical compositions for the treatment of kidney cancer
Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated. |
US11052129B2 |
Ornithodoros moubata complement inhibitor for use in the treatment of complement-mediated diseases in patients with C5 polymorphism
The present invention relates to methods of treating or preventing a complement-mediated disease and/or disorder in a subject with a complement C5 polymorphism, including administering to a subject in need thereof a therapeutically or prophylactically effective amount of an agent that a) inhibits the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibits eicosanoid activity. The invention also relates to methods of identifying patient populations with C5 polymorphisms that are treatable with specific agents that a) inhibit the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibit eicosanoid activity. |
US11052127B2 |
HSP for use in treatment for imiquimod related side effects
The invention relates to a healthcare product comprising (i) a component selected from the group of heat shock proteins from alfalfa and heat shock protein hydrolysates from alfalfa, the product further comprising imiquimod or a pharmaceutically acceptable salt or derivative thereof. Further, the invention relates to a healthcare product for use in the prophylactic or therapeutic treatment of a skin disorder. Further, the invention relates to HSP for use for use in preventing the occurrence of a negative-side effect of a treatment with imiquimod, or alleviating such side effect. |
US11052120B2 |
Method of committed differentiation of human induced pluripotent stem cells into Leydig cells and application of Leydig cells
The present application provides an in-vitro committed differentiation method for inducing human induced pluripotent stem cells (hiPSCs) into Leydig cells (LCs) by neural crest stem cells (NCSCs). The hiPS-derived LCs is verified by an animal model to have the capacity of regenerating senile or injured LCs, so that a new treatment for supplementing testosterone is provided for patients suffering from hypogonadism, particularly for patients suffering from late-onset hypogonadism (LOH). |
US11052115B2 |
Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
The present invention provides improved and/or shortened methods for expanding TILs and producing therapeutic populations of TILs, including novel methods for expanding TIL populations in a closed system that lead to improved efficacy, improved phenotype, and increased metabolic health of the TILs in a shorter time period, while allowing for reduced microbial contamination as well as decreased costs. Such TILs find use in therapeutic treatment regimens. |
US11052114B2 |
Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. |
US11052113B2 |
Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. |
US11052108B2 |
Amorphous calcium carbonate for treating a leukemia
The present invention provides compositions and methods of treating a leukemia, including chronic lymphocytic leukemia, wherein the method comprises administering a stabilized amorphous calcium carbonate to a person in need thereof. |
US11052107B2 |
Amorphous calcium carbonate stabilized with polyphosphates or bisphosphonates
The present invention provides solid compositions of amorphous calcium carbonate (ACC) and a polyphosphate, bisphosphonate or pharmaceutical salts thereof as a stabilizer. Said stabilizers stabilizes the ACC and prevent crystallization to crystalline calcium carbonate ((′( (″) for a long period of time, even in an aqueous suspension. The invention further provides pharmaceutical composition comprising the solid ACC compositions as well their use in treating of certain diseases and conditions. |
US11052105B2 |
Methods for treating hepatitis B infection
This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections. |
US11052104B2 |
Methods for treating hepatitis B infection
This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections. |
US11052099B2 |
Use of cimicifugae rhizoma triterpenoid saponin extract, actein, and deoxyactein
The present invention provides the use of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, or a composition formed by actein and deoxyactein in the preparation of a medicament or a functional health product for autoimmune diseases. The present invention also provides a pharmaceutical composition for autoimmune diseases and a pharmaceutical composition for inhibiting inflammatory cytokines. The invention provides new applications of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, etc., and widens the application field of medicines or functional health products for autoimmune diseases. The raw materials source is plenty, the cost is low, and it has a broad market application value. |
US11052098B2 |
Composition containing araloside for external application to skin
The present invention relates to a composition comprising an araloside-based compound and, more particularly, to a composition for external application to skin, the composition comprising, as an active component, an araloside-based compound, including araloside X, araloside V and araloside VII. Thus, the composition restores skin markers damaged by external environmental stress, such as harmful substances or fine dusts, and reduces the expression of skin inflammatory factors to help the recovery of damaged skin, thereby providing effects, such as anti-oxidation, skin trouble suppression, anti-inflammation, or skin barrier improvement. |
US11052096B2 |
Steroidal compositions
Provided herein are steroid containing compositions suitable for providing therapeutically effective amounts of at least one steroid to individuals. Also provided herein are compositions comprising testosterone and/or testosterone derivatives suitable for providing therapeutically effective and safe amounts of testosterone over periods of time. Further provided are methods of treating andro- and/or testosterone deficiency in individuals by administering to the individuals compositions described herein. |
US11052094B2 |
D2O stabilized pharmaceutical formulations
Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein. |
US11052093B2 |
Aryl-or heteroaryl-substituted benzene compounds
The present invention relates to aryl- or heteroaryl-substituted benzene compounds. The present invention also relates to pharmaceutical compositions containing these compounds and methods of treating cancer by administering these compounds and pharmaceutical compositions to subjects in need thereof. The present invention also relates to the use of such compounds for research or other non-therapeutic purposes. |
US11052092B2 |
N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating autoimmune diseases
The present invention provides e.g. N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating e.g. autoimmune diseases, autoimmune-related diseases, inflammatory diseases, metabolic diseases, fibrotic diseases or cholestatic diseases, such as e.g. arthitis and asthma. |
US11052091B2 |
BRK inhibitory compound
The present invention relates to a Brk inhibitory compound represented by general formula (I) (wherein, all symbols represent the same meanings as the symbols set forth in the specification), a salt thereof, an N-oxide thereof, a solvate thereof, or a prodrug of any of these. |
US11052090B2 |
Use of TREM-1 inhibitors for treatment, elimination and eradication of HIV-1 infection
Compounds, compositions, and methods of treatment and prevention of HIV, including HIV-1 and HIV-2, Dengue, and Chikungunya infection are disclosed. The compounds are TREM-1 inhibitors. Combinations of these TREM-1 inhibitors and additional antiretroviral compounds, such as NRTI, NNRTI, integrase inhibitors, entry inhibitors, protease inhibitors, JAK inhibitors, macrophage depleting agents, and the like, are also disclosed. In one embodiment, the combinations include a combination of adenine, cytosine, thymidine, and guanine nucleoside antiviral agents, optionally in further combination with at least one additional antiviral agent that works via a different mechanism than a nucleoside analog. This combination has the potential to eliminate the presence of HIV, Dengue, or Chikungunya virus in an infected patient. |
US11052089B2 |
Methods for inhibiting alpha-v beta-3 expression on cancer stem cells and inhibiting progression to a cancer stem cell phenotype
In alternative embodiments, provided are compositions and methods for treating, enhancing the drug sensitivity of, and preventing the formation of cancer stems cells, including preventing or slowing the development or generation of a beta-3 (β3)-expressing, or integrin β3 (ITG-B3)-expressing cancer or tumor cells. In alternative embodiments, provided are methods using histone acetyl transferase inhibitors and/or histone methyl transferase inhibitors to determine therapeutic values in cancer cells that induce an integrin β3 (ITGB3) polypeptide expression. In alternative embodiments, provided are kits, blister packages, lidded blisters or a blister card or packet, clamshells, trays or shrink wraps, comprising at least one compound, composition or formulation used to practice a method as provided herein, and at least one Growth Factor Inhibitor. |
US11052084B2 |
Pharmaceutical capsule compositions comprising lumateperone mono-tosylate
The present disclosure relates to pharmaceutical capsules comprising lumateperone, in free, or pharmaceutically acceptable salt form, optionally in combination with one or more additional therapeutic agents, processes for manufacture thereof and methods of use in the treatment or prophylaxis of disease. |
US11052077B2 |
Methods of treating lung cancer
The present disclosure provides for methods of treating a patient with a CYP3A4 substrate drug, wherein the patient is treated with posaconazole. In some embodiments, the patient stops posaconazole treatment, waits for at least 2 days, and then is treated with the CYP3A4 substrate drug as soon as it is safe to do so. In some embodiments, treatment with the CYP3A4 substrate drug is delayed for about 2-42 days after stopping posaconazole. In some embodiments, the patient is treated with a reduced dose of the CYP3A4 substrate drug for about 2-42 days. |
US11052075B2 |
Pharmaceutical compositions of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl) cyclopropanecarboxamido)-3-methylpyridin-2-yl) benzoic acid and administration thereof
A pharmaceutical composition comprising Compound 1, (3-(6-(1-(2,2-difluorobenzo [d][1,3]dioxol-5-yl) cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid), and at least one excipient selected from: a filler, a diluent, a disintegrant, a surfactant, a binder, a glidant and a lubricant, the composition being suitable for oral administration to a patient in need thereof to treat a CFTR mediated disease such as Cystic Fibrosis. Methods for treating a patient in need thereof include administering an oral pharmaceutical formulation of Compound 1 to the patient. |
US11052070B2 |
Riluzole prodrugs and their use
Pharmaceutical compositions of the invention include substituted riluzole prodrugs useful for the treatment of cancers including melanoma, breast cancer, brain cancer, and prostate cancer through the release of riluzole. Prodrugs of riluzole have enhanced stability to hepatic metabolism and are delivered into systemic circulation by oral administration, and then cleaved to release riluzole in the plasma via either an enzymatic or general biophysical release process. |
US11052065B2 |
Compositions and methods for treating cancer with a combination of programmed death receptor (PD-1) antibodies and a CXCR2 antagonist
The present invention relates to methods of treating a cell proliferation disorder (e.g., cancer) comprising administering: (a) a compound having the Formula (I), wherein R1 or R2 are as herein defined, or a pharmaceutically acceptable salt thereof; and (b) an anti-human PD-1 antibody or antigen binding fragment thereof to a human patient in need thereof. Also disclosed are therapeutic combinations and kits containing such agents for the treatment of cancers. |
US11052064B2 |
Compositions, methods and systems for the treatment of cutaneous disorders
Devices, systems, methods, and kits for treating cutaneous diseases, such as warts, with a cantharidin formulation are generally described. The cantharidin formulations, described herein, may have many advantages over traditional cantharidin formulations, including removal of highly volatile and corrosive solvents, improved safety, and improved compatibility with common plastics for ease of delivery. The devices, systems, methods, and kits can be used for the precise application of the cantharidin formulation for the treatment of cutaneous diseases and other topical indications. Treatment of cutaneous diseases with cantharidin, using the devices, systems, methods, and/or kits may have many advantages over traditional therapies, including high single application efficacy, lack of scaring, and a mild pain profile. |
US11052063B2 |
Methods of reducing RLP-C
In various embodiments, the present invention provides methods of treating and/or preventing cardiovascular-related disease and, in particular, a method of blood lipid therapy comprising administering to a subject in need thereof a pharmaceutical composition comprising eicosapentaenoic acid or a derivative thereof. |
US11052060B2 |
Compounds and methods for treating autoimmunity
Compounds and compositions useful in methods of treating, ameliorating, or inhibiting the development of autoimmune diseases or Celiac disease by modulating the binding of DQ8 MHC class II molecules to antigenic peptides or fragments of antigenic peptides. |
US11052057B2 |
Use of cysteamine and derivatives thereof to suppress tumor metastases
The present Disclosure is directed to methods for inhibiting or suppressing metastasis of a tumor in a mammalian subject using a cysteamine product, e.g., cysteamine or cystamine or a derivative thereof. Also described herein is a method for treating pancreatic cancer in a mammalian subject by administering a cysteamine product described herein. |
US11052053B2 |
Nanoparticle comprising a bio-resorbable polyester, a hydrophilic polymer and an acylated human lactoferrin-derived peptide
A nanoparticle includes a core. The core includes a bio-resorbable polyester and a hydrophilic polymer. The hydrophilic polymer is a portion of the bio-resorbable polyester or a separate polymer. An acylated human lactoferrin-derived peptide is coated onto the core. The acylated human lactoferrin-derived peptide is a peptide with the amino acid sequence SEQ ID NO. 1: KCFQWQRNMRKVRGPPVSCIKR or an amino acid sequence, which does not differ by more than 8 amino acid positions from the sequence SEQ ID NO: 1. The N-terminus of the human lactoferrin-derived peptide is acylated with a C16-monoacyl group. |
US11052051B2 |
Coating composition, drug-containing particle, solid preparation and method for preparing drug-containing particle
Provided are a drug-containing particle capable of suppressing dissolution of a drug in the oral cavity to suppress an unpleasant taste thereof and having excellent dissolution of the drug in the digestive tract after passing through the oral cavity; a method for preparing the drug-containing particle; a coating composition used for preparing the drug-containing particle; and a solid preparation having the drug-containing particle. More specifically, provided are a coating composition having 100 parts by weight of a cellulose-based enteric base and 50 parts by weight or less of a water-soluble cellulose ether; a drug-containing particle having a drug-containing core and a coat portion obtained by coating the core with the coating composition; a solid preparation having the drug-containing particle; and a method for preparing a drug-containing particle having a step of coating the drug-containing core with the coating composition. |
US11052048B2 |
Esomeprazole-containing complex capsule and preparation method therefor
Provided are a composite capsule and a method of preparing the composite capsule. The composite capsule includes a first dissolving part including a core, an inner coating layer on the core, and a first enteric coating layer on the inner coating layer, wherein core contains, as an active ingredient, esomeprazole or a pharmaceutically acceptable salt thereof. The composite capsule further includes a second dissolving part including a core, which contains, as an active ingredient, esomeprazole or a pharmaceutically acceptable salt thereof, an inner coating layer on the core, and a second enteric coating layer on the inner coating layer. |
US11052047B2 |
Oral tablet suitable for fast release of active pharmaceutical ingredients
The invention relates to an oral tablet suitable for fast release of active pharmaceutical ingredients comprising a population of particles, the population of particles comprising directly compressible (DC) and non-directly compressible (non-DC) sugar alcohol particles, the non-DC particles providing the tablet with a plurality of discrete non-DC areas, and the non-DC areas promoting fast release of active ingredients upon mastication of the tablet. |
US11052046B2 |
Method for preparing micro-particles by double emulsion technique
Methods for preparing micro-particles using a double emulsion technique combining a membrane and a micro-sieve are provided. Particularly the present invention relates to method for preparing micro-particles comprising: preparing a first phase comprising an active agent; preparing a second phase comprising a carrier and a solvent; passing the first phase and the second phase through a membrane to form a primary emulsion; passing the primary emulsion through a micro-sieve in a continuous phase to form a secondary emulsion; and removing the solvent to form the micro-particles. |
US11052040B1 |
Topical application and method of administration and absorption
The present invention relates to a composition for boosting immunity in a person comprising a plurality of minerals, a plurality of vitamins, activated charcoal, coffee beans, vitamin B complex and a carrier, wherein the carrier is an oil-based substance. The composition is an aggregation of the active agents/ingredients conventionally prepared. The present invention allows absorption of multiple active agents/ingredients in the body, consistently. The blend of vitamin and minerals get easily absorbed in the body of a patient without affecting the function of the liver. |
US11052034B2 |
Cosmetic for correcting bumps and dips
A subject of the present invention is to provide a cosmetic for unevenness correction which has an excellent effect of concealing wrinkles and pores and correcting skin unevenness and has good compatibility with a makeup cosmetic.The present inventors have found that the cosmetic for unevenness correction which conceals wrinkles and pores and has good compatibility with a makeup cosmetic at the time of application can be easily provided by using a polyacrylate water-absorbing polymer having a specific water absorption capacity, but not a water-soluble macromolecule having a thickening effect commonly used in cosmetics, and they thus have completed the present invention. That is, the present invention provides a cosmetic for unevenness correction comprising the polyacrylate water-absorbing polymer which has an excellent effect of concealing wrinkles and pores, and the polyacrylate water-absorbing polymer has an average swollen particle size of 10 to 150 μm, an average dry particle size of 10 to 50 μm and a water absorbency of 5 to 50 g/g. |
US11052031B2 |
Cleansing composition comprising a nonionic / cationic surfactant mixture
An aqueous cleansing composition comprising a cationic surfactant, a nonionic surfactant, and a thickener comprising an alkoxylated methyl glucose ether, wherein a weight ratio of cationic surfactant to nonionic surfactant is greater than 0.9:1. The combination of the cationionic:nonionic surfactant ratio with the alkoxylated methyl glucose ether thickener provides the composition with cold weather stability. Cold weather stability is observed when the composition remains transparent after cold storage. |
US11052028B2 |
Process for depigmenting keratin materials using thiopyridinone compounds
The invention relates to cosmetic processes and compositions for depigmenting, lightening and/or whitening keratin materials, in particular the skin, which comprises the application of a cosmetic composition comprising thiopyridinone compounds to keratin materials. |
US11052026B2 |
Multi-capsule containing pigment for cosmetic material or functional component, and method for producing same
The present invention relates to a method for producing a multi-capsule, the method including steps of: (a) preparing a coating solution by mixing purified water, titanium dioxide, mica, a hydrophobic polymer, cellulose gum, and sucrose; and (b) drying the coating solution prepared in step (a) while spraying the coating solution through a spray nozzle of a fluid bed dryer after introducing a spherical seed of a colorant component for a cosmetic; or a starch or sucrose spherical seed coated with a functional component into the fluid bed dryer, a multi-capsule produced by the method, and a cosmetic composition containing the multi-capsule as an active component. |
US11052025B2 |
Perfumes in the form of aqueous microemulsions
Disclosed is a microemulsion of oil-in-water type including, preferably consisting of, by weight relative to the total weight of microemulsion: •70% to 94% of water, •1% to 15% of at least one hydrophobic fragrancing substance, •4% to 20% of at least one preferably volatile solvo-surfactant, and •0.1% to 15%, preferably 1% to 13%, of at least one hydrotropic agent or at least one surfactant selected from anionic surfactants, cationic surfactants, amphoteric surfactants and non-ionic surfactants. The solvo-surfactant is selected from monoalkylated glycerol derivatives of following formula (I): wherein the “alkyl” group is a linear or branched alkyl group including from 1 to 8 carbon atoms, and R and R′ are each independently H or a linear or branched alkyl group including from 1 to 5 carbon atoms, with the proviso that R is different from R′, and mixtures thereof. |
US11052024B2 |
Feeding system for gastric tube patients
A feeding system for medical patients comprises a storage assembly, dispensing assembly, and extension set including, in part, a reservoir, a pump, a feeding tube, a check valve and an adapter. The reservoir is configured to hold at least one feeding of nutritional substance. The dispensing assembly is connected to the storage assembly and pumps the at least one feeding of nutritional substance from the reservoir to the feeding tube connected to an outlet of the pump. The check valve unit is connected to a second end of the feeding tube by means of a check valve connection point and is configured to allow the flow of nutritional substance in only one direction. The at least one feeding of nutritional substance is passed through the adapter unit connected to the check valve unit. |
US11052022B1 |
Reloadable antiseptic vial
Medical vials and bottles containing medications dispensable syringes and needles are interfaced to replaceable caps having alcohol infused wipes therein to sterilize the rubber hubs through which the needles will be inserted into the vials to draw out the medication therefrom. |
US11052021B2 |
Medicine container, method of assembling the container, and method of dispensing the medicine from the container
A child-resistant medication container assembly that includes a blister card including a plurality of compartments each configured to support a dosage of medication, and a puck including a body portion, a recess that defines a partition wall in the body portion, and a plurality of openings defined in the partition wall. Each opening corresponds to one of the plurality of compartments in the blister card. The assembly further includes a carton including a first wall opposite a second wall. An access opening is defined in the first wall and a plurality of perforations are defined in the second wall. The access opening is sized to provide access to the plurality of compartments, and each perforation corresponds to one of the plurality of compartments in the blister card. |
US11052016B2 |
Devices, systems and methods for reducing motion artifacts during imaging of a neonate
Generally, a system for soothing a baby during imaging by an imaging device is provided. The system can include: a capsule incubator for positioning the baby within the imaging device, the capsule incubator can include: a bottom portion having an inner surface, a bed positioned on top of the inner surface for positioning the baby thereon, and one or more members coupled to the bottom portion that are positioned in a first position to open the capsule incubator and a second position to close the capsule incubator; a vibrational device including a vibrational element that extends from outside of the capsule incubator into the capsule incubator and is coupled to the bed to cause the bed to vibrate with a predetermined vibrational frequency, thus causing the baby to vibrate with the predetermined vibrational frequency. |
US11052014B2 |
Abdominal massage apparatus and abdominal massage method for relieving constipation
According to one implementation an apparatus is provided that comprises: one or more support plates with which there are associated massage units, the one or more support plates being secured to and facing an abdominal wall of the body of a patient; massaging heads integrated in the massage units for performing an abdominal massage on the patient, wherein at least two massaging heads are applied such that they are adjacent to at least one section out of an ascending section, transverse section or descending section of the colon of the patient thereby to apply a localized force generating a pressure on the colon section in a direction normal to the abdominal area, wherein the at least two massaging heads are synchronized; and control means for controlling the magnitude and timing of the localized force. |
US11052013B2 |
Assistance apparatus, assistance method, and recording medium
There is provided an assistance apparatus in which when assistance provided to a user in walking is to be stopped, a motor reduces a tension of a first wire and a tension of a second wire, which couple an upper-body belt and a left knee belt to each other on or above a front part and a back part of a body of the user, to less than a second threshold value during a first stop period in a gait phase of a left leg of the user, the first stop period being a period from a period included in a first period and including a timing at which the left leg shifts from a stance phase to a swing phase to a start period of a second period, and reduces a tension of a third wire and a tension of a fourth wire, which couple the upper-body belt and a right knee belt to each other on or above the front part and back part of the body of the user, to less than the second threshold value during a second stop period in a gait phase of a right leg of the user, the second stop period being a period from a period included in a third period and including a timing at which the right leg shifts from the stance phase to the swing phase to a start period of a fourth period. |
US11052010B2 |
Training device and method for correcting force
A training device suppresses unintended operation of an operation rod when executing an operation mode in which operation of the operation rod is controlled based on a force applied to the operation rod. The training device includes the operation rod, a motor, a force detector, a rotation information output sensor, a first command calculator, and a force corrector. The operation rod moves a limb. The motor operates the operation rod in a direction of degree of freedom. The force detector detects a force component and outputs a force component signal. The rotation information output sensor detects an operation position of the operation rod in a corresponding direction of degree of freedom. The force corrector calculates a corrected force component value based on operation positions of the operation rod and force component signal. The first command calculator calculates a first motor control command based on the corrected force component value. |
US11052007B2 |
System for cooling a pressurized hyperbaric chamber without pressure change
A system for cooling a pressurized hyperbaric chamber without pressure change includes an air compressing unit, an air cooling unit, and an air discharging hose. The pressurized hyperbaric chamber, the air compressing unit, the air cooling unit, and the air discharging hose are in fluid communication with each other. A flow of output warm air from the pressurized hyperbaric chamber is withdrawn and discharged into the air cooling unit by the air compressing unit. A heat exchanger of the air cooling unit then removes heat energy from the flow of output warm air to convert the flow of output warm air into a flow of input cold air, as the heat exchanger is in fluid communication with stored ice water within an insulated reservoir of the air cooling unit. The flow of input cold air is then discharged back into the pressurized hyperbaric chamber through the air discharging hose. |
US11052002B2 |
Vehicle wheel assembly
A disclosed vehicle wheel assembly includes a plurality of wheels, a plurality of rotary drive modules each having a respective rotation axis, and a plurality of rotatable arms, wherein each arm is arranged to extend radially from a rotation axis of a respective rotary drive module to couple the respective rotary drive module to a respective wheel. Each rotary drive module is operable to drive rotation of a respective rotatable arm about the rotation axis of the drive module, to thereby rotate a respective wheel about the rotation axis. A control module can sense stepped terrain, and control each rotary drive module to enable a vehicle to travel over the stepped terrain. |
US11052001B2 |
Mobile chair apparatus comprising foot pedals
A mobile chair apparatus is described that comprises a drive assembly that preferably includes one or more moveable foot pedals, and drive wheels which rotate in response to rotation of the foot pedals by the mobile chair occupant, and a steering assembly which comprises two steering wheels and at least one tiller, configured such that forward and backward movement of said tiller will translate into movement of both steering wheels, wherein the drive assembly and the steering assembly concurrently enable the mobile chair occupant to propel and steer the mobile chair apparatus without assistance from another person. |
US11051998B2 |
Portable and collapsible support structures and related methods
A reconfigurable portable load bearing structure which can be configured into an extended load bearing configuration or a collapsed configuration, comprising of a first, second and third plurality of rail segments that are each rotatably coupled together and a plurality of support segments or pads which are configured to selectively couple and latch into one of a plurality of positions on said first, second and third plurality of rail segments. |
US11051996B2 |
Sensor devices and systems for monitoring the basic needs of an infant
Sensor devices and systems for monitoring the basic needs of an infant comprising feeding, sleeping, and/or voiding (urinating and/or defecating) are described herein. |
US11051995B2 |
Sensor devices and systems for monitoring the basic needs of an infant
Sensor devices and systems for monitoring the basic needs of an infant comprising feeding, sleeping, and/or voiding (urinating and/or defecating) are described herein. |
US11051987B2 |
Method for tailoring a compression garment
A method and system for tailoring a compression garment having a first lateral end and a second lateral end. A first tension tab releasably attachable to the compression garment; wherein the first tension tab includes at least a first indicator and a second indicator on an outer surface. The first tension tab being attachable to the compression garment and the first strap being attachable onto the compression garment adjacent or over at least a portion of the first tension tab with a first strap covering a first part of the first tension tab and terminating at a first strap end that exposes a second portion of the first tension tab. A first tension tab setting indicates whether the end of the first strap terminates adjacent or over the first indicator or the second indicator of the first tension tab. |
US11051986B2 |
Knit hemostatic bandage
A knit hemostatic bandage provided herein can include a continuous rayon fiber and a continuous glass fiber. The knit hemostatic bandage can have a gauge of between 10 and 30 stitches per inch. The knit hemostatic bandage can have a Young's modulus of elasticity of less than 50 MPa. |
US11051985B2 |
Preparation jig for tympanic membrane regenerating agent and preparation vessel for tympanic membrane regenerating agent
[Problem] The present invention provides a preparation jig for a tympanic membrane regenerating agent and a preparation vessel for a tympanic membrane regenerating agent enabling simple preparation of a tympanic membrane regenerating agent.[Solution] A preparation jig for a tympanic membrane regenerating agent (1a) and a preparation vessel for a tympanic membrane regenerating agent (1A) each include: a vessel (3A) including housing walls (6, 7) forming an interior space (S1) housing a medicinal solution support (2), and including an opening (6h) opening in one direction and formed in the housing walls (6, 7); and a holding portion (4A) disposed in the interior space (S1). The deep side of the interior space (S1) is a housing portion (S3) housing the medicinal solution support (2) holding a medicinal solution. The opening (6h) side of the interior space (S1) is an installation space (S2) in which the holding portion (4A) is disposed. |
US11051983B2 |
Laser eye surgery system calibration
A laser system is calibrated with a tomography system capable of measuring locations of structure within an optically transmissive material such as a tissue of an eye. Alternatively or in combination, the tomography system can be used to track the location of the eye and adjust the treatment in response to one or more of the location or an orientation of the eye. In many embodiments, in situ calibration and tracking of an optically transmissive tissue structure such as an eye can be provided. The optically transmissive material may comprise one or more optically transmissive structures of the eye, or a non-ocular optically transmissive material such as a calibration gel in a container or an optically transmissive material of a machined part. |
US11051980B2 |
Capsulorhexis apparatus
Provided is a capsulorhexis apparatus for incising an anterior capsule covering a crystalline lens by being inserted into an incision site of a cornea, the capsulorhexis apparatus including: an anterior capsule incision portion which has a closed curve shape, is inserted into the incision site of the cornea to incise the anterior capsule located below the cornea to a circle, and generates heat by using high frequency vibration to incise the anterior capsule; a body portion which is externally exposed when the anterior capsule incision portion incises the anterior capsule while slidingly moving in the body portion, and is internally inserted when the anterior capsule incision portion does not incise the anterior capsule; and a button portion which is formed on one side of the body portion and slidingly moves the anterior capsule incision portion inside the body portion. |
US11051978B2 |
Automated aspiration throttling in vitreoretinal surgery
Ophthalmic surgical devices, systems, and methods for regulating aspiration from a patient's eye are provided. A vacuum pump in fluid communication with an aspiration line provides fluid aspiration from a vitreous chamber of the eye through the aspiration line. A sensor disposed adjacent to or inside the eye determines sensor data relating to an intraocular pressure (IOP). The controller receives the sensor data and regulates the aspiration in response to changes in the IOP, such as by controlling the vacuum pump. The controller may determine whether a fluid infusion to the vitreous chamber through an infusion line is below a maximum infusion level, regulate the infusion in response to the IOP being below a threshold value and the infusion being below the maximum infusion level, and regulate the aspiration in response to the IOP being below the threshold value and the infusion being at or above the maximum infusion level. |
US11051977B2 |
Eye treatment device having a ring like shape
An eye treatment apparatus is described. The apparatus includes an annular body that has a hollow optical zone in its center. An inner perimeter of the annular body surrounds the optical zone. The inner perimeter has a diameter that corresponds to a diameter of the eye's cornea. An outer perimeter of the annular body has a diameter such that the annular body can extend to underneath the eye lid in an open eye position when the eye treatment apparatus is in operation. In this way, the apparatus can be worn on the eye, where the hollow optical zone substantially corresponds to the cornea and does not interfere with the field of vision. The annular body also includes a storage chamber that stores therapeutic liquid for an eye. An outlet is coupled with the storage chamber such that, in operation, the therapeutic liquid can be dispensed to the eye. |
US11051974B2 |
Fluency aid
The present disclosure relates to a fluency aid comprising: a pacing signal generator operable to output a signal for generating, at regular time intervals, an audible sound; and a controller operable, in response to a voice being detected by a voice detector, to control the pacing signal generator such that the output signal causes the audible sound to continue, stop or fade. |
US11051972B1 |
Non-invasive, non-gravitationally dependent, pressurized method for rapid reclamation and volume expansion of medication from urine
The present disclosure relates to a non-invasive, non-gravitationally dependent, pressurized method for the rapid selective extraction, volume expansion, and reclamation of medication and medication metabolites (including but not limited to naturally occurring or engineered hormones, chemicals, antibodies, enzymes, lipids, proteins or pharmaceutical products) from urine. The disclosure further relates to methods for reclamation of medication from urine in a pressurized system and methods of using the medication reclaimed from that urine. |
US11051963B2 |
Medical devices and methods for protecting a limb of a patient during a medical procedure
Medical devices and methods are presented for protecting a limb, e.g., an arm, of a patient during a medical procedure. The medical devices and methods utilize a plurality of longitudinal sealed fluid pockets to thermally insulate and cushion an extremity of a limb. The plurality of longitudinal sealed fluid pockets is incorporated in a protective body that is shaped to wrap around the extremity when the medical device is deployed. The protective body has at least one access opening to provide access through the protective body to one or more corresponding portions of the extremity. Access panels may be formed into the protective body to allow portions of the extremity to be covered or uncovered and used with left or right limbs.Other devices and methods are presented. |
US11051959B2 |
Intravascular aneurysm treatment device and methods
An intravascular device configured to treat an aneurysm that includes a support structure including metal struts configured to be positioned in a body lumen and defining a central fluid passage that extends axially along the support structure, and a knitted mesh cover disposed over an exterior thereof and across a radial arc and along a length of the support structure sufficient to exceed an opening of an aneurysm to be treated, and the cover includes a polymer fiber having a diameter of at least 40 nanometers to 30 microns and apertures therethrough, the apertures being sized to prevent blood from passing through the device to prevent further expansion of the aneurysm. Devices including apertures that are at least 20 microns and sized to minimize or prevent an aneurysm-filling material from exiting the aneurysm through the knitted mesh cover and support structure, and methods of stenting, are also encompassed. |
US11051958B2 |
Biodegradable supporting device
A biodegradable in vivo supporting device is disclosed. In one embodiment, a coated stent device includes a biodegradable metal alloy scaffold made from a magnesium alloy, iron alloy, zinc alloy, or combination thereof, and the metal scaffold comprises a plurality of metal struts. The metal struts are at least partially covered with a biodegradable polymer coating. A method for making and a method for using a biodegradable in vivo supporting device are also disclosed. |
US11051956B2 |
Prosthesis cosmetic element, and system consisting of prosthesis cosmetic element and prosthesis
A prosthesis cosmetic element for a prosthesis comprising a prosthesis joint which has an upper part and a lower part that is mounted thereon in a pivotal manner about a pivot axis, the prosthesis cosmetic element has a first frame part, which has at least one first securing device for fixing on the lower part, and a second frame part with at least one second securing device for securing on the upper part. The frame parts are mounted in a pivotal manner relative to each other, and the prosthesis joint is equipped with a rotational element on which an actuating element is arranged. The actuating element is accessible from the outside by a frame part or through a frame part. |
US11051953B2 |
Porous spinal implant
A surgical implant and a surgical kit. The surgical implant has a body portion comprising a first hole formed in an exterior surface of the body portion, a second hole adjacent the first hole, and at least one through-hole within the body portion and extending entirely thought a depth of the body portion extending entirely thought a depth of the body portion. The implant has a central opening abutting the body portion and extending through the body portion. The first hole has a first sidewall and a first cavity in the body portion, the second hole has a second sidewall and a second cavity in the body portion, and the first cavity and the second cavity have an interconnected opening there between. The surgical kit includes the surgical implant and an intervertebral insertion device |
US11051952B2 |
Spinal implant system
A spinal fusion system may include an interbody fusion cage, a fixation plate, and an implanter. The interbody fusion cage may include a proximal region, a distal region opposite the proximal region, a superior region, an inferior region opposite the superior region, and an open volume between the proximal and distal regions. The superior and inferior regions are located between the proximal and distal regions and are configured such that, when the interbody fusion cage is implanted in the disc space, the superior region contacts the inferior end plate and the inferior region contacts the superior end plate. The fixation plate is receivable in the open volume of the interbody fusion cage and includes a superior blade and an inferior blade. At least one of the blades includes a first opening defined therein. The fixation plate is displaceable between a non-deployed state and a deployed state. |
US11051949B2 |
Expandable orthopedic implant
An expandable intervertebral implant having an upper body portion, a lower body portion opposite the upper body portion, a wedge member connecting the upper body portion to the lower body portion, a nose member having a tapered distal end and a proximal end opposite the distal end, and an actuator disposed between the nose member and the wedge member, for translation of the wedge member along a longitudinal axis of the implant. A pin disposed in a center of the nose member connects to the actuator for centering the nose member with the actuator. Translation of the wedge member along the longitudinal axis of the implant displaces the upper body portion and the lower body portion away from each other, thereby expanding the intervertebral implant. |
US11051948B2 |
Hinge joint system with distal femoral replacement prosthetic knee
Methods and systems are provided for a hinge knee system. A hinge knee system may comprise a femoral component; an insert; a tibial tray configured to be coupled to the insert; a tibial bushing configured to be disposed between the tibial tray and the insert; a poly locking screw configured to secure the tibial tray to the insert; a hinge box configured to be disposed between the femoral component and the insert; one or more cross-pin bushings configured to be disposed within the hinge box; a cross-pin configured to secure the hinge box to the femoral component; a hinge post configured to couple the hinge box to the tibial tray; and a hinge post set screw configured to secure the hinge box to the hinge post. |
US11051946B2 |
Joint surface replacement system
The present invention relates to an articular joint replacement system. The system has first and second components. Each component has a tapered head piece for covering the end of a bone and for acting as an articular surface, an integrally formed screw stem having a length sufficient to extend into the medullary canal, and inwardly angled bone grips affixed to the underside of the head piece to allow solid fixation to the bone by compression press fit. The head piece of the first component is provided with a shaped exterior surface which complements the shaped exterior surface of the head piece of the second component and which allows motion in three planes. |
US11051945B2 |
Prosthetic device with antibiotics
Prosthetic device suitable for being implanted in a bone or joint site of the human body, including a prosthetic body, wherein the prosthetic device includes or can be added with antibiotic or a medical substance. |
US11051939B2 |
Active introducer sheath system
The active introducer sheath systems disclosed herein are expanded by activating a translation mechanism at the handle. The sheath has an inner cylindrical structure of comingled fixed and mobile elongate rods bound together by an attachment line. Activating the translation mechanism causes the mobile rods to move axially with respect to the fixed rods, changing the internal tension in the attachment line. Increased tension draws the fixed and mobile rods closer together, decreasing the diameter of the cylindrical structure. Decreased tension in the attachment line enables the fixed and mobile rods to move apart, increasing the diameter of the cylindrical structure. A prosthetic device, such as a prosthetic heart valve, can be routed through the expanded sheath and to the implantation site. During implantation, the sheath can be contracted back to its original outer diameter, and expanded again for retrieval of the delivery apparatus. |
US11051938B2 |
Bifurcated tubular graft for treating tricuspid regurgitation
A lubricated tubular graft is implanted in the inferior vena cava and the superior vena cava in order to control the inflow of blood to the right atrium. A bifurcated leg with a non-collapsing stent extends across the tricuspid valve. A bioprosthetic valve is positioned proximal of the stent in the bifurcated leg in order to regulate flow through the tricuspid valve and to eliminate tricuspid regurgitation. |
US11051933B2 |
Aspherical multifocal intraocular lens
A multifocal intraocular lens has an anterior lens surface which includes a first optic of a first radius and a second optic of a different radius. The posterior surface of the lens include an aspheric surface. |
US11051932B2 |
Methods and apparatus for delivering and positioning sheet-like materials in surgery
An implant delivery system for delivering a sheet-like implant is disclosed. The implant delivery system includes a distal guidewire port for receiving the proximal end of guidewire after the guidewire distal end has been affixed to a first point on bone or other tissue. The implant delivery system is tracked over the guidewire to a selected position defined by the guidewire attachment. The device includes an implant spreader assembly disposed proximate the distal end of a delivery shaft. The implant spreader assembly includes a first arm and a second arm. The arms are coupled to the delivery shaft such that the first arm and second arm are moveable between a closed position and an open position. When pivoting to the open position the distal end of each arm travels in a generally transverse direction to spread a sheet-like implant. |
US11051929B2 |
Neovaginal prosthesis
The invention relates to a neovaginal prosthesis formed by an essentially cylindrical hollow main body comprising a closed upper end and an open lower end, and a securing plate intended to connect to the lower end of the main body. |
US11051922B2 |
Dental restoration production device and add-on or attachment
The invention relates to a dental restoration production device, comprising a curable dental restoration material (20) and a radiation-curing device by means of which the curable dental restoration material (20) can be cured using light radiation, UV radiation and/or heat radiation in order to produce a dental restoration part (22), and comprising an add-on (24) or attachment to the radiation-curing device, which faces said dental restoration material (20) or can be directed thereto, wherein said attachment or add-on (24) has a molding surface that corresponds to the target shape of the surface (52) of the dental restoration material (20) and forms a negative mold (54) therefor on the region facing the radiation-curing device. |
US11051921B2 |
Vibrating toothbrush
A vibrating toothbrush is provided with vibration-isolating zones that substantially isolate vibrations in the head and reduce vibrations transmitted to the handle without sacrificing structural integrity around the vibration-isolation zones. Such zones may generally comprise neck material that is reduced in cross-section, thinned, replaced by dampening material, or removed altogether to create transmission-inhibiting voids. The vibration-isolating zones may be further supported by the housing of the vibratory element to maintain the structural integrity around the zones and to thereby alleviate weakness conditions that might subject the toothbrush to fatigue and breakage. |
US11051917B2 |
Prosthesis as well as retrofit kit for a prosthesis
The invention relates to a dental prosthesis comprising a prosthesis base and teeth which are attached in or to the prosthesis base (14), wherein the prosthesis base (14) comprises a ventilation element, in particular a ventilation valve (12). |
US11051916B2 |
Dental zirconia system
A dental zirconia system to produce translucent zirconia sintered bodies comprises at least two separate zirconia green bodies. At least one zirconia green body comprises zirconium oxide and a lower content of at least one other oxide summing to between 6.5 wt % to 20 wt % based on a total weight percent of the zirconia green body. At least another zirconia green body comprises zirconium oxide and a higher content of at least one other oxide summing to between 7.5 wt % to 20 wt % based on a total weight percent of the zirconia green body. The at least two zirconia green bodies each have at least some particles with a diameter of 100 nanometers to 1000 nanometers. The at least two zirconia green bodies have different amounts of the at least one other oxide with respect to one another. |
US11051914B2 |
Augmented reality enhancements for dental practitioners
A method of using AR for dentistry and orthodontics is provided. An image of a dental arch is received, the image having been generated by an image capture device associated with an augmented reality (AR) display. A processing device registers the image to previous image data associated with the dental arch, compares one or more areas of the dental arch from the image to one or more corresponding areas of the dental arch from the previous image data, determines a position of an area of interest on the dental arch based on the comparing, generates a visual overlay comprising an indication of the area of interest, and outputs the visual overlay to the AR display, wherein the visual overlay is superimposed over a view of the dental arch on the AR display at the position of the area of interest. |
US11051910B2 |
Mandibular reposition device and coupling therefor
An adjustable mandibular repositioning appliance including first and second connecting members and a link arm which is pivotable about an axis wherein protrusive positioning of the mandible is provided by relative positioning of the link arm along aid axis, to kits and couplings for making a readily adjustable mandibular appliance, to a system for providing a readily adjustable mandibular repositioning appliance and methods of use. |
US11051909B2 |
Dental drill tool
A system and method for mitigating pain associated with dentistry provides a removal apparatus for removing a portion of a tooth. A desiccation apparatus flows a desiccated gas to the portion of the tooth to desiccate dentinal tubules in a region surrounding the portion of the tooth, generally preventing nerve cells within the tooth from transmitting pain signals associated with the removal. The removal apparatus has a drill head with a body having an axial opening configured to accept a dental burr. An annular passage exists between the dental burr and the body within the axial opening. A chamber in the body is in fluid communication with the axial opening, where a channel is fluidly coupled to an external port and to a source of the desiccated gas to flow the desiccated gas therethrough and expose a drilling region of the dental burr to the desiccated gas to mitigate pain. |
US11051907B2 |
Adapter for connecting a compressed gas operated dental instrument to a compressor
The invention relates to an adapter for connecting a dental instrument to be operated with compressed gas to a compressor supplying the compressed gas, and to a control unit as well as a treatment unit comprising the adapter, wherein the adapter has at least one first input for the compressed gas of a compressor, a second input for a control signal, an output for connecting to the dental instrument, and a valve between the first input and output that is controllable by the control signal. |
US11051906B2 |
Ergonomic body positioning system
An ergonomic body positioning system for supporting and positioning a user such that the user can maintain a neutral body position while providing improved access and visibility to a worksite. The body positioning system includes a base, a support arm, a stem mounted to the support arm, and at least one body support device. |
US11051892B2 |
Control apparatus and tendon-driven device
An apparatus including a tendon-driven device such as an endoscope comprising a bendable body, a tendon attached to and extending a length of said body, and an actuator that will actuate said tendon based on a control signal from a controller. The controller is configured to send said control signal to said actuator and comprises a forward-kinematic-mapping unit that estimates an angular displacement, wherein the kinematic-mapping unit is configured for: providing a tension value of the tendon to obtain a desired angular displacement wherein the tension has a nonlinear relationship with the desired angular displacement based on information of friction where the tension is greater that would be calculated without including the effect of friction. The friction coefficient may be determined as it changes over time. |
US11051886B2 |
Systems and methods for performing a surgical navigation procedure
A system and method for performing a navigation procedure including a surgical tool, an imaging device, and a computing device. The surgical tool is navigated to a target tissue located in a target area to perform a surgical procedure on the target tissue. The imaging device acquires image data of the target area while the surgical tool is being navigated to the target tissue by automatically traversing back and forth along a path relative to the target area and acquiring image data of the target area while traversing the path. The computing device receives the image data acquired by the imaging device and displays the image data such that the surgical tool can be navigated to the target tissue while simultaneously visualizing a position of the surgical tool relative to the target tissue from multiple perspectives relative to the target area. |
US11051885B2 |
Method and system for determining a risk of hemodynamic compromise after cardiac intervention
A method and system for predicting a measure of hemodynamic compromise as a result of transcatheter cardiac treatment. The method includes providing a patient-specific anatomical model representing cardiac region and an implant model representing a three-dimensional representation of a cardiac implant. The method includes virtually deploying said implant model into said patient-specific anatomical model. A deformation of the patient-specific anatomical model is calculated as a result of implant model deployment A measure of hemodynamic compromise is determined from the virtually deployed implant model and the deformed patient-specific anatomical model. |
US11051881B2 |
Lasso catheter with moveable ablation spine
This disclosure is directed to a method for providing electrical communication with a heart using a catheter having a lasso electrode assembly with a moveable spine. The lasso electrode assembly may have an array of sensing electrodes and may be configured to engage the ostium of the vessel of a patient. The moveable spine may have an ablation electrode and may travel along track around the circumference of the lasso electrode assembly. By adjusting the position of the moveable spine, tissue may be ablated to form lesions around a circumference of the vessel. |
US11051880B2 |
Devices and methods for forming a fistula
Described here are devices, systems and methods for forming a fistula between two blood vessels. Generally, the systems may comprise a first catheter which may comprise a fistula-forming element. The fistula-forming element may comprise one or more electrodes, mechanical cutting elements, laser sources, or combinations thereof, and may be used to assist in fistula formation. In some instances, a system may comprise a second catheter, which may comprise a fistula-forming element. One or more of the catheters may comprise one or more markers, magnetic alignment elements, and/or one shape-changing elements. |
US11051876B2 |
Surgical evacuation flow paths
Surgical systems can include evacuation systems for evacuating smoke, fluid, and/or particulates from a surgical site. A surgical evacuation system can be intelligent and may include one or more sensors for detecting one or more properties of the surgical system, evacuation system, surgical procedure, surgical site, and/or patient tissue, for example. |
US11051874B2 |
Electrosurgical device
A forceps-type electrosurgical device is disclosed comprising, a fixed elongate body and a pair of moveable tips, arranged for engaging tissue in use, and extending from a forward end of the body. The tips are relatively moveable between a first position in which the tips are spaced apart and a second position in which the tips are brought together. The body further comprising an actuation member moveable relative to the body and connected to the tips such that a user may move the actuation member to result in movement of the tips between the first and second positions. The device may further comprise a suction port proximal to the tips. |
US11051872B2 |
Electrosurgical electrodes and systems and methods including same
A method for treating surface tissue of a patient includes: providing an electrode having a contact surface, wherein the contact surface has a curved profile; placing the contact surface in contact with surface tissue of the patient; and sliding the contact surface across and in contact with the surface tissue while applying electrosurgical currents to the surface tissue via the contact surface to thereby vaporize and ablate the surface tissue and form a treated band of the surface tissue. |
US11051870B2 |
Compression stent with electrodes
A device for compressing a renal artery prior to delivery of radiofrequency ablative energy to the renal nerves. The device includes a stent structure with a focal region that expands outwards to place the RF electrodes located on the stent structure in close proximity to the renal nerves. A covering is applied to the stent structure to prevent intimal hyperplasia. |
US11051858B2 |
Instruments for interspinous or interlaminar stabilization devices
Surgical instruments to properly implant interspinous/interlaminar stabilization devices, and instrumentation kits containing these instruments are provided. These surgical instruments may be configured to be disposable, or for single patient use, and therefore do not require resterilization for reuse, thus reducing risk of infection as a result of reuse and logistical costs associated with these resterilization procedures. |
US11051854B2 |
Spinal implant system and method
A method for treating a spine comprising the steps of: connecting at least one first fastener that defines an implant cavity with at least one vertebral level of a first portion of vertebrae; connecting at least one second fastener with at least one vertebral level of a second portion of the vertebrae; manipulating the vertebrae; manipulating a spinal rod to a selected configuration; connecting the spinal rod with the at least one first fastener such that the spinal rod is disposed at a selected position with the implant cavity; connecting a tether to a second fastener and the spinal rod; and reducing the spinal rod to a selected position relative to the second fastener with the tether. Systems, spinal constructs and surgical instruments are disclosed. |
US11051853B2 |
Systems and methods for percutaneous removal of objects from an internal body space
Disclosed are systems, methods, and devices for percutaneous retrieval of objects, such as endovascular devices, from a subject's internal body space. The present inventions have vascular, non-vascular (gastrointestinal), and surgical (laproscopic) applications. The inventions include the use of a retrieval end having one or more compressed states and an expanded state, the retrieval end adopting the expanded state when the retrieval end is deployed into a subject's internal body space, the retrieval end having a mouth through which an object can be passed into an interior space within the retrieval end when the retrieval end is in the expanded state, the mouth being adjustable between an opened state and a closed state so that the object can be enclosed within the interior space after passing through the mouth of the retrieval end. |
US11051850B2 |
Dilating cannula with radially expandable flange and method of using the same
A dilating cannula includes a radially expandable flange and an expandable shaft. The radially expandable flange is disposed at a proximal end portion of the dilating cannula and includes two or more sectors that are each independently movable. The expandable shaft extends from the proximal end portion to a distal end portion of the dilating cannula and defines an inner passageway of the dilating cannula and includes two or more arms. A first branch of the two or more arms extends from one end of the base section and a second branch of the two or more arms extends from another end of the base section. The first branch is connected to a first sector of the two or more sectors of the radially expandable flange and the second branch is connected to a second, different sector of the two or more sectors of the radially expandable flange. |
US11051846B2 |
Catheter device for providing access to a body cavity of a patient
A catheter device (1) for providing access to a body cavity of a patient comprises a tube (10) and an inserting shell (11) arranged on the tube (10) and constituted to be fastened to an insertion guide (3) for inserting the catheter device (1) into a body opening (C) of a patient (P). Herein, the inserting shell (11) comprises an opening (111) into which a thread (300) of the insertion guide (3) is insertable for fastening the catheter device (1) to the insertion guide (3). In this way, a catheter device is provided which, in an easy and efficient manner, allows for the fastening to an insertion guide. |
US11051844B2 |
Pixel array medical devices and methods
Systems, instruments or devices, and methods or procedures are described in which a scalpet array is applied to a target site with the use of a pattern. The scalpet array comprises scalpets positioned on a device. Skin pixels are incised at the target site via application of a load through the scalpet array. A recipient site is prepared by positioning the pattern at the recipient site and applying the scalpet array to generate skin defects. The incised skin pixels are applied at the skin defects of the recipient site. |
US11051842B2 |
Tissue-removing catheter with guidewire isolation liner
A tissue-removing catheter for removing tissue in a body lumen includes an elongate body and a tissue-removing element mounted on a distal end portion of the elongate body. The tissue-removing element is configured to remove the tissue as the tissue-removing element is rotated by the elongate body within the body lumen. An inner liner is received within the elongate body and coupled to a handle at a proximal end of the inner liner. The inner liner defines a guidewire lumen. The inner liner isolates an interior of the guidewire lumen from the elongate body and tissue-removing element such that rotational and torsional forces are not transferred from the elongate body and tissue-removing element to the interior of the guidewire lumen when the elongate body and tissue-removing element are rotated during operation of the tissue-removing catheter. |
US11051840B2 |
Modular battery powered handheld surgical instrument with reusable asymmetric handle housing
A surgical instrument is disclosed. The surgical instrument includes a handle assembly that includes a handle housing. The handle housing comprises two asymmetric portions, a first portion configured to support mechanical and electrical components of the surgical instrument and a second portion comprising a removable cover. |
US11051838B2 |
Ultrasonic surgical instrument with ad hoc formed blade
A method of forming a component of an ultrasonic surgical instrument includes accessing a file including a digital model representing the component. The component includes a proximal portion and a distal portion. The proximal portion includes a contact portion. The distal portion includes an ultrasonic blade. The contact portion is configured to transmit ultrasonic vibrations to the ultrasonic blade when the component is acoustically coupled to a complementary portion of an acoustic waveguide of the ultrasonic surgical instrument. The file is used to fabricate the component via an additive manufacturing process. Once the component has been fabricated, the distal portion is secured to a distal end of the complementary portion of the acoustic waveguide. |
US11051834B2 |
Tissue specimen retrieval device
A tissue specimen retrieval device includes a first shaft and a second shaft telescopically movable relative to the first shaft. The second shaft supports an end effector assembly at a distal end thereof and is movable relative to the first shaft between a retracted position, wherein the end effector assembly is disposed within the first shaft, and a deployed position, wherein the end effector assembly extends from the first shaft in an expanded configuration. The end effector assembly includes a bag brim having a wire support with first and second ends that operably engage the distal end of the second shaft. The bag brim is transitionable from a first collapsed configuration within the first shaft to an expanded configuration upon deployment therefrom. The wire support includes torsion springs disposed between the first and second ends that cooperate to facilitate expansion of the bag brim upon deployment from the first shaft. |
US11051833B2 |
Retrieval systems and methods for use thereof
The devices and methods described herein relate to improved structures for removing obstructions from body lumens. Such devices have applicability in through-out the ho including clearing of blockages within the vasculature, by addressing the frictional resistance on the obstruction prior to attempting to translate and/or mobilize the obstruction within the body lumen. |
US11051832B2 |
Aspiration monitoring system and method
A system for removal of blood or thrombus includes an aspiration catheter having an elongate shaft including an aspiration lumen having proximal end configured to couple to a vacuum source, and a distal end having an orifice, an elongate member configured for placement through the aspiration lumen and having a distal portion including a disruption element configured to disrupt thrombus within the aspiration lumen, and a monitoring device configured for removable connection in between the aspiration catheter and the vacuum source, and including a housing, a pressure sensor in fluid communication with an interior of the housing, a measurement device coupled to the pressure sensor and configured for measuring deviations in fluid pressure, and a communication device coupled to the measurement device and configured to generate an alert signal when a deviation in fluid pressure measured by the measurement device exceeds a pre-set threshold. |
US11051830B2 |
Implant cutting block pin placement
A system, method, and device for drilling holes (420, 422) in a target bone (414) are described. For example, the system includes a cutting tool (330), a navigation system (310) configured to track a position of the cutting tool, and a computer-assisted surgical (CAS) system (340) operably connected to the cutting tool and the navigation system. The CAS system can be configured to determine an implant component (100) to be implanted on the target bone (414), determine a cutting block position for preparing the target bone to receive the implant component, determine a plurality of pin locations (420, 422) for securing the cutting block (416) based upon the determined cutting block position, and selectively provide instructions to the cutting tool to cut a hole when the cutting tool is in a position adjacent to at least one of the determined plurality of pin locations. |
US11051828B2 |
Rotation knob assemblies and surgical instruments including same
A rotation knob assembly for a surgical instrument includes an outer knob, an intermediate collar, an inner sleeve, a retaining clip, and screws. The outer knob defines a knob lumen extending longitudinally therethrough and longitudinal apertures disposed in radially spaced relation relative to a distal lumen portion of the knob lumen. The intermediate collar is disposed within the knob lumen and defines a collar lumen extending longitudinally therethrough. The inner sleeve is disposed within the knob lumen and extends through the collar lumen. The retaining clip includes a curved body disposed within an annular groove defined in an exterior surface the inner sleeve and prongs disposed at opposed ends of the curved body that are aligned with the longitudinal apertures of the outer knob. The screws extend through the prongs and into the longitudinal apertures to secure the outer knob and the inner sleeve with one another. |
US11051826B2 |
Embolic compositions
Described herein are compositions comprising, a polymer; a non-physiological solution; and a visualization agent; wherein the polymer is soluble in the non-physiological solution and insoluble at physiological conditions. Methods of preparing the compositions are disclosed as well as methods of using these compositions to treat vascular conditions. |
US11051825B2 |
Delivery system for embolic braid
A device for treating an aneurysm by releasing an implanted implant from a delivery system at a treatment site can include a braided implant attached to a releasing component that can be detachably engaged with a delivery tube and a pull wire. The releasing component can engage the delivery tube in a compressed configuration via friction fit and can disengage the delivery tube by expanding to a released or deployed configuration. The pull wire can have an extending portion that can engage the releasing component and an elongated portion that can be pulled to disengage the releasing component. The braided implant, once implanted, can be released from the delivery tube by disengaging the pull wire from the releasing component and disengaging the releasing component from the delivery tube. |
US11051824B2 |
Embolic delivery
Concepts related to embolic delivery, including embolic detachment systems and an embolic pusher retention mechanism/system are discussed. |
US11051818B2 |
Device for connecting hollow organs, especially blood vessels, by surgery
A sleeve for enforcing the end of a hollow organ so that it can be connected with a further end of a hollow organ, the sleeve comprising a cylindrical shape and being configured to be pushed over the end of the hollow organ and for turning-over the end of the hollow organ projecting from the sleeve around an end of the sleeve, wherein the sleeve has an adjustable diameter. |
US11051815B2 |
Force modulating tissue bridges, associated tools, kits, and methods
Force modulating tissue bridges, and associated applicators, kits and methods are provided. A force modulating tissue bridge can be a medical article for at least partially covering a wound and/or scar tissue. The medical article can include an elastic arch extending over an area, and a medial strut connected to the arch and extending into the area over which the central section extends. |
US11051810B2 |
Modular surgical instrument with configurable operating mode
Various examples are directed to systems and methods for operating and controlling a modular surgical instrument comprising an operating mode. A controller may receive electrical signal associated with an activation of at least one user-actuated input device electrically coupled to the controller and override the operating mode of the surgical instrument upon receiving the electrical signal. |
US11051809B2 |
Cartridge receiving jaw for surgical stapler and associated method of manufacture with MIM
A method is used to manufacture an end effector of a surgical instrument. The end effector includes first and second opposing jaws. The first jaw includes a body and an elongate cap. The method includes providing the elongate cap and the body of the first jaw of the end effector. The body includes an elongate channel and at least one alignment feature. The method also includes aligning the elongate cap with the elongate channel that extends completely through the body using the at least one alignment feature of the body that is disposed adjacent the elongate channel. The method also includes welding the elongate cap onto the body to at least partially enclose the elongate channel. |
US11051807B2 |
Packaging assembly including a particulate trap
A sterile packaging assembly configured to receive a surgical instrument is disclosed. The sterile packaging assembly comprises a vacuum-molded tray and a particulate trap. The vacuum-molded tray comprises an instrument cavity configured to receive the surgical instrument, and a trap cavity. The particulate trap is positioned in the trap cavity. The particulate trap comprises a housing including a funnel shaped side terminating in an opening. The opening is in communication with a chamber defined in the particulate trap. |
US11051805B2 |
System and method of using simulation reload to optimize staple formation
The present disclosure is directed to a testing systems and methods for testing a powered surgical instrument. The powered surgical instrument includes a processor configured to control operation of the powered surgical instrument, a memory configured to store a tissue compression program, a reload configured to clamp tissue, a motor configured to control the reload to apply a compressive force to the tissue by the reload, and at least one sensor configured to measure a current draw on the motor. The processor executes the simulation program to measure the current draw on the motor through a nominal thickness firing and the measured current draw is used to adjust the tissue compression program. |
US11051803B2 |
Suture/needle constructs and methods of manufacture thereof
Suture/needle constructs are disclosed in which either a first round or flat section of suture can be crimped on a needle. If the first section is round, then a transition to flat second section is formed by a braiding machine. After a short space of flat, the braiding machine weaves a bifurcation into the second section, forming third and fourth suture sections. The third and fourth suture sections transition back together again into a woven fifth section at a distance from the needle, which forms a suture loop. This looped section of the suture can then be used for whipstitching a tendon or a ligament graft. |
US11051801B2 |
Closure devices and methods
A closure device for closing an opening in tissue is provided. The closure device includes an elongate member through which needles may be deployed. The closure device also includes a closure element having a foot portion and a needle guide portion. The foot portion and the needle guide portion are each movable between a delivery configuration and a deployed configuration. The foot portion includes cuffs removably mounted thereon and having sutures connected therebetween. The needle guide portion includes needle guide apertures that guide the needles to the cuffs. The needles securely engage the cuffs and draw the cuffs and suture through the lumen wall so that the opening in the lumen wall can be closed with the sutures. |
US11051800B2 |
Endoscopic suturing system having external instrument channel
An endoscopic suturing system includes an endoscope, a suturing device, a needle assembly movable through tissue by the suturing device, and first and second devices used in association with the suturing device. The cap assembly includes a rotatable needle arm supporting the needle assembly and actuatable by a proximal handle via a transmission assembly. First and second separate lumen extends outside the endoscope from the cap assembly to a proximal handle to advance instruments therethrough to engage the needle assembly and target the tissue. The cap assembly is retained at an end of the endoscope by a securing arm. The securing arm may be resilient or rotatable. Ancillary clips are also provided about the first and second lumen and transmission assembly to couple them to the endoscope. |
US11051785B2 |
Heartbeat detection device and heartbeat detection method
A heartbeat detection device includes a bone conduction microphone that converts, into a signal, displacement on the body surface of a user in a thickness direction of the body of the user, and an extractor that extracts a first frequency component and a second frequency component which are included in the signal. The first frequency component is based on audio information of the user, and the second frequency component is based on heartbeat information of the user. The heartbeat detection device is capable of estimating the physical and psychological state of the user based on the heartbeat information by extracting both the audio information and the heartbeat information, from a signal that has been output by the bone conduction microphone. |
US11051783B2 |
X-ray radiography apparatus
The present invention relates to an X-ray radiograph apparatus (10). It is described to placing (110) an X-ray source (20) relative to an X-ray detector (30) to form an examination region for the accommodation of an object, wherein, a reference spatial coordinate system is defined on the basis of geometry parameters of the X-ray radiography apparatus. A camera (40) is located (120) at a position and orientation to view the examination region. A depth image of the object is acquired (130) with the camera within a camera spatial coordinate system, wherein within the depth image pixel values represent distances for corresponding pixels. A processing unit (50) transforms (140), using a mapping function, the depth image of the object within the camera spatial coordinate system to the reference spatial coordinate system, wherein, the camera position and orientation have been calibrated with respect to the reference spatial coordinate system to yield the mapping function that maps a spatial point within the camera spatial coordinate system to a corresponding spatial point in the reference spatial coordinate system. A synthetic image is generated (150) within the reference spatial coordinate system. The synthetic image is output (160) with an output unit (60). |
US11051782B1 |
Image quality by incorporating data unit assurance markers
A method and apparatus is disclosed, which significantly improves image quality. Specifically, the method disclosed utilizes structures within an image with a known or calculated value, such as a phantom or presumed homogeneous structure, such as an air mass outside of the patient. The method then performs segmentation of the imaging dataset and subsequent measurement of the structure with a known value. The difference between the known value and the measured value is used as a correction factor, which is then applied to the remainder of the dataset where values are not known. This can improve image quality by helping to generate extremely similar gray scale maps over multiple examinations and eliminate artifacts. |
US11051781B2 |
Medical diagnostic imaging apparatus
In one embodiment, A medical diagnostic imaging apparatus includes: a scanner that images a first site of an object and generates medical image data, wherein the scanner acquires biological information from a sensor that detects the biological information at a second site of the object that is different to the first site, and images the first site based on the biological information that changes according to a movement at the second site of the object. |
US11051775B2 |
Collapsible column movement apparatus for mobile x-ray device
A mobile radiography apparatus with a portable transport frame has a sectioned vertical column mounted on the transport frame. The sectioned vertical column defines a vertical axis and has a vertically fixed base section and an upper section that is movable with respect to the base section along the vertical axis. Cable and pulley systems are coupled to the vertical column sections and/or the transport frame. A boom is coupled to the movable section for positioning an x-ray source attached to the boom. |
US11051773B2 |
Systems and methods for imaging with improved dosages
A system is provided that includes at least one detector and a processing unit. The at least one detector is configured to acquire imaging information. The processing unit is operably coupled to the at least one detector, and is configured to acquire the imaging information from the at least one detector. The processing unit is configured to acquire patient scanning information for an imaging operation, determine a target activity based on the patient scanning information, determine a target time for performing the imaging operation corresponding to the target activity, perform the imaging operation at the target time to acquire targeted imaging information; and reconstruct an image using the targeted imaging information. |
US11051769B2 |
High definition, color images, animations, and videos for diagnostic and personal imaging applications
High definition, color images, animations, and videos for diagnostic and personal imaging applications are described along with methods, devices and systems for creating the images, as well as applications for using the images, animations and videos. |
US11051768B1 |
Determining when to emit an alarm
Systems and methods are provided for evaluating an alarm condition for a monitored patient in a population of one or more patients. One or more physiological parameters pertaining to the patient, or physiological variables, are used to form a time series describing the patient status. A dimension parameter such as a time series roughness statistic or a fractal dimension is used to estimate a dimension decision statistic over time. The dimension decision statistic is used as a measure of physiological condition. The dimension decision statistic may be compared to a threshold to determine a region of operation for the dimension of the physiological variable. The dimension decision statistic is used in an embodiment in combination with the underlying raw physiological variable value to reduce the rate of false alarms, to increase the frequency of missed detections, and to aid diagnostic decision making and to aid the formation of a crisis action plan. |
US11051765B2 |
Health status detecting system and method for detecting health status
A health status detecting system includes a first acquisition device configured to collect a plurality of images of a finger of a user; a second acquisition device configured to obtain an electrocardiogram of the user; and a processor configured to process the plurality of images to obtain a pulse wave of the user and configured to obtain a blood pressure of the user based on the pulse wave and the electrocardiogram of the user. |
US11051764B2 |
Device for detecting blood flow disturbance
A blood flow disorder detection device includes: a sensor sheet including a flexible substrate and a plurality of sensors provided on the flexible substrate; and an analyzer that analyzes outputs of the plurality of sensors. The plurality of sensors measure different types of blood flow information of a living tissue, the blood flow information being obtained by attaching the sensor sheet to the living tissue. The analyzer detects a blood flow disorder in the living tissue by analyzing the different types of blood flow information from the plurality of sensors. |
US11051763B2 |
Method and apparatus for determining a feature characterizing intentional breath-holding by a patient in a medical imaging device
In a method and medical imaging apparatus for determining a feature characterizing intentional breath-holding by an examination object for acquiring medical raw data with breath-holding algorithm, an algorithm, the algorithm being designed to allocate at least one feature characterizing intentional breath-holding to at least one physiological property. The algorithm includes or accesses trained artificial neural network. A physiological property of the examination object is detected during free breathing of the examination object. The feature characterizing intentional breath-holding by the examination object is determined by the computer, by executing the algorithm with the detected physiological property of the examination object, as an input to the algorithm. |
US11051762B2 |
Electronic device
An electronic device is disclosed. The electronic device includes a case and a battery cover forming an appearance of the electronic device and a printed circuit board mounted inside the case and provided with electronic elements. A measurement sensor is mounted on at least a portion of the printed circuit board. One surface of a recess of the printed circuit board, on which the measurement sensor is mounted, is formed at a different height from other portion of the printed circuit board in a thickness direction of the electronic device. The recess, on which the measurement sensor is mounted, is thinner than the other portion and is spaced apart from the other portion, and thus the electronic device can more accurately measure a body temperature of a user. |
US11051760B2 |
Wearable device for healthcare and method thereof
The present invention relates to a wearable device for healthcare and method for using the device. More specifically, the wearable device is worn on a finger for measuring the health data of the user, selected from one or more of heart rate, blood oxygen saturation, heart rate variability. Based on the measured data, the sleep quality can be monitored and recorded. Disorders such as obstructive sleep apnea (OSA), can be detected. The wearable device may include an optical sensor coupled with or embedded in a main body including a visible light emitter, an IR light emitter and a light detector being arranged along a longitudinal direction of the finger. During operation of the wearable device, the heart rate is monitored based on a detected light signal. When the heart rate is higher than an adaptive threshold, both heart rate and blood oxygen saturation are monitored. |
US11051756B2 |
System and method for analyzing user's activities on conductive fabrics to trigger IoT devices
This disclosure relates generally to a system and method for analyzing live activity on the conductive fabrics with intelligent touch. The system comprises a plurality of modules and these modules are in sync with the processor of the system to take action based on a plurality of instructions of the memory. Further, the system comprises fabrics, which are of conductive in nature, are used as a conductive touch pads for inputs to the system. The input data from touch pads are analyzed to determine pattern of actions. These patterns are associated with the IoT devices and the system uses them to trigger at least one action on the at least one IoT device based on a predefined training data set. |
US11051753B2 |
Information processing method and information processing apparatus
Disclosed is an information processing method executed by a computer. The information processing method includes identifying a sleep onset time and an awakening time based on time series data relating to an activity status of a user; calculating a first midpoint at which an interval between the sleep onset time and the awakening time is evenly divided into two; and outputting information indicating a time at the calculated first midpoint. |
US11051748B2 |
Multiple frequency neurofeedback brain wave training techniques, systems, and methods
Methods, systems, and techniques for providing neurofeedback and for training brain wave function are provided. Example embodiments provide a Brain Training Feedback System (“BTFS”), which enables participants involved in brain training activities to learn to evoke/increase or suppress/inhibit certain brain wave activity based upon the desired task at hand. In one embodiment, the BTFS provides a brain/computer interaction feedback loop which monitors and measures EEG signals (brain activity) received from participant and provides feedback to participant. The BTFS may use an FFT based system or machine learning engines to deconstruct and classify brain wave signals. The machine learning based BTFS enable optimized feedback and rewards, adaptive feedback, and an ability to trigger interventions to assist in desired brain transitions. |
US11051745B2 |
Adaptive selection of digital ECG filter
A method and system for filtering a detected ECG signal are disclosed. In a first aspect, the method comprises filtering the detected ECG signal using a plurality of digital filters. The method includes adaptively selecting one of the plurality of digital filters to maintain a minimum signal-to-noise ratio (SNR). In a second aspect, the system comprises a wireless sensor device coupled to a user via at least one electrode, wherein the wireless sensor device includes a processor and a memory device coupled to the processor, wherein the memory device stores an application which, when executed by the processor, causes the processor to carry out the steps of the method. |
US11051742B2 |
Wearable device and respiration sensing module
A wearable device and respiration sensing module are provided. The wearable device includes a first respiration sensing module and a second respiration sensing module. The first respiration sensing module is configured to sensing respiration of a user to obtain a first respiration information. The second respiration sensing module is configured to sensing respiration of the user to obtain a second respiration information. The second respiration sensing module includes a substrate, a first electrode, a second electrode and a stretchable conductive element. The first electrode and the second electrode are disposed on a first surface of the substrate. The stretchable conductive element is physically and electrically connected between the first electrode and the second electrode. The respiration of the user is judged according to the first respiration information and the second respiration information. |
US11051739B2 |
Neural mapping
An embodiment of the invention may include a method, computer program product and computer system for neural activity interpretation. The method, computer program product and computer system may include a computing device that presents a first user with a stimulus and monitors and maps the neural activity of the first user. The computing device may receive the first user's verbal reaction to the stimulus and map the linguistic data of the first user's verbal reaction to form a high dimensional vector based on the relationships of the mapped neural activity and the mapped verbal reaction of the first user. The computing device may associate the high dimensional vector with the stimulus presented resulting in a thoughts model. The computing device may receive a second user's neural activity and compare that second user's neural activity to the thoughts model to identify the neural activity in the second user. |
US11051738B2 |
Physiological monitoring device
The present invention relates to a physiological monitoring device. Some embodiments of the invention allow for long-term monitoring of physiological signals. Further embodiments may also allow for the monitoring of secondary signals such as motion. |
US11051735B2 |
Pressure monitoring system
A pressure-measuring system, including a tube system having at least first and second pressure measuring devices, each including a pressure transducer membrane and a measuring chamber. A first flow regulation device with a perfusion tube section is positioned between the first pressure measuring device and a supply of fluid, and has a first tube clamp that acts on a tube section by squeezing. The system further includes at least one non-perfusion regulation device. |
US11051731B2 |
System and method for factory calibration or reduced calibration of an indwelling sensor based on sensitivity profile and baseline model of sensors
Systems and methods are disclosed which provide for a “factory-calibrated” sensor. In doing so, the systems and methods include predictive prospective modeling of sensor behavior, and also include predictive modeling of physiology. With these two correction factors, a consistent determination of sensitivity can be achieved, thus achieving factory calibration. |
US11051730B2 |
Virtual reality biofeedback systems and methods
A biofeedback virtual reality (VR) system and methods are provided for improving, optimizing, or minimizing the physiological or psychological effects of a medical condition, such as a physiological or psychological condition of a patient. The biofeedback VR System monitors one or more physiological parameters while presenting an immersive VR environment. The system and method comprise a closed-loop biofeedback system where a user (i.e., patient) observes a VR Experience provided by the VR System. The VR System monitors one or more physiological parameters while guiding the user to an improved (or optimized) physiological state through improvement of one or more of the physiological parameters. In some embodiments, a social experience is included in the VR, where the user engages with one or more other users in the VR Experience. |
US11051729B1 |
Oxygen saturation measuring device, probe adapted to be used therefor, and oxygen saturation measuring method
An oxygen saturation measuring apparatus capable of measuring arterial blood oxidation saturation (SpO2), and tissue oxygen saturation (rSO2), safely, easily and economically at a desired position of a biological body for a long time continuously. A ROM stores the distance information between a light emitting unit and a light receiving unit situated corresponding to the depth of a target intended to be measured for tissue oxygen saturation, a light emission driving unit makes the light emitting unit emit light in an amount of light corresponding to the distance information, MPU makes the light emitting unit emit a pulses capable of measuring the tissue oxygen saturation, MPU applies pulse capable of measuring the tissue oxygen saturation from the light emission driving unit to the light emitting unit, and the pulse increasing unit increases the amount of pulses from MPU for a predetermined time to pulses capable of measuring the arterial blood oxygen saturation. |
US11051728B2 |
Apparatus comprising a light detector, a light source and optics
An apparatus comprising: a light detector; a light source, laterally offset from the light detector by a first lateral offset; optics configured to receive light emitted by the light source and output the received light, wherein a majority of the light output is directed towards an offset region laterally offset from the light detector by at least a second lateral offset different from the first lateral offset. |
US11051727B2 |
System and method for non-invasive monitoring of advanced glycation end-products (AGE)
A method of non-invasively monitoring advanced glycation end-product (AGE) concentrations includes providing incident light to patient tissue at one or more excitation wavelengths and monitoring the one or more emission responses at one or more emission wavelengths. Based on the emission responses monitored, a ratio is calculated based on a ratio of the first emission response to the second emission response. |
US11051722B2 |
Apparatus for and method of monitoring movement
Apparatus comprises an acceleration unit, a processing unit and a display for continuous real time monitoring. The acceleration unit is attached or held by a body region of a mammal comprises a 3D-acceleration sensor and a wireless transmitter for transmitting a measurement signal provided by the acceleration sensor continuously. The processing unit processes the measurement signal continuously in a band of a medically defined movement of the body region, forms a movement index on the basis of a norm of values of acceleration in a first time window, and forms a value(s) of amplitude, and/or a value of frequency of the spatial movement of the body region on the basis of a power spectral density in second time window of a known duration. The display displays said movement index with said value of amplitude, and/or said value of frequency of the spatial movement continuously in real time. |
US11051720B2 |
Fitness tracking for constrained-arm usage
A system and method for collecting motion data using a fitness tracking device located on an arm of a user, detecting that the arm is constrained based on the motion data, estimating a stride length of the user based on the motion data and historical step cadence-to-stride length data, calculating fitness data using the estimated stride length, and outputting the fitness data to the user. |
US11051719B2 |
Electronic device, generation method, and generation system
An electronic device includes a measurement unit configured to measure a contour of a body by the electronic device being moved along a surface of the body and a controller configured to generate a three-dimensional image of the body based on the contour. The controller is configured to generate the three-dimensional image by lining up a plurality of first contours measured along a first direction. |
US11051709B2 |
Knowledge discovery based on brainwave response to external stimulation
Techniques are disclosed for detecting knowledge based on brainwave response to external stimulation. A subject can be exposed to stimuli and brainwave responses indicating a p-300 signal can be detected. Further stimuli or sequences of stimuli can be selected be presented to the subject based on the category correlated with the stimuli that indicate a p-300 response. |
US11051708B2 |
Catheter spine assembly with closely-spaced bipole microelectrodes
An electrophysiologic catheter with a distal electrode assembly carrying very closely-spaced bipole microelectrodes on a plurality of divergent spines that can flexibly spread over tissue surface area minimized detection of undesirable noise, including far-field signals. Each spine has a flexible microelectrode panel having a substrate, at least one pair of microelectrodes, a trace for each microelectrode, and a soldering pad. Adjacent microelectrodes of a bipole pair are separated by a space gap distance ranging between about 50-300 microns. Each microelectrode may have a width of about 200 or 300 microns. |
US11051705B2 |
Blood pressure and cardiac monitoring system and method thereof
A blood pressure and cardiac monitoring system includes a sensing assembly, a processor, a memory, a communication interface, and any suitable computer implemented modules communicatively coupled to each other via a bus. The sensing assembly comprises of a first sensor (single or multi-axes) located at a first axis of a target generating a first time-dependent motion waveform representative of one or more contractile properties of the target's heart and a second sensor (single or multi-axes) located at a second axis of the target generating a second time dependent motion waveform representative of the target's blood flow. The first and second sensor can be integrated in a multi-axes sensor which sense both the axes. The processor is configured to receive the first time dependent motion waveform and the second time dependent motion waveform, and to determine a first time difference between a vital sign present in the first time dependent motion waveform and the second time dependent motion waveform. A third sensor located along any axis of the target generating a third time dependent waveform representative of the electrical potential due to the depolarization of heart muscle is provided. At least one of the sensors may be added or configured to either remove motion artifacts (as a reference sensor) or detect attributes from the environment for providing context awareness information. |
US11051704B1 |
Smart watch
Systems and methods include one or more entities including a sensor configured to provide data in at least a first protocol or standard from a first manufacturer and a second protocol or standard from a second manufacturer; and an electronic health record database configured to translate between the protocols and save the data in an intermediate format. |
US11051701B1 |
Methods, systems, and computer readable media for obtaining accurate skin temperature measurements
A method for obtaining accurate skin temperature measurements includes displaying, on a display, a video image of a temperature measurement subject captured by a camera. The method further includes displaying, on the display, at least one visual alignment cue sized and positioned on the display such that when a predetermined portion of the video image of the subject is aligned with the at least one visual alignment cue, the subject is located at a predetermined distance and orientation for accurate skin temperature measurement by a contactless temperature sensor. The method further includes analyzing the video image of the subject and detecting when the predetermined portion of the video image of the subject is aligned with the at visual alignment cue. The method further includes triggering the contactless temperature sensor to record a skin temperature measurement of the subject when the predetermined portion of the video image of the subject is aligned with the at least one visual alignment cue. |
US11051699B2 |
Method and system for estimating fractional fat content of an object of interest
A method and system for estimating fractional fat content of an object of interest. The method and system include a thermoacoustic imaging system comprising an adjustable radio frequency (RF) applicator configured to emit RF energy pulses into the region of interest and heat tissue therein and an acoustic receiver configured to receive bipolar acoustic signals generated in response to heating of tissue in the region of interest; and one or more processors. The one or more processors are able to process bipolar acoustic signals received by the acoustic receiver in response to RF energy pulses emitted into the region of interest using the RF applicator to determine a setting for the RF applicator that yields bipolar acoustic signals with at least one enhanced metric thereof, determine an impedance of the RF applicator used to yield acoustic bipolar signals with the enhanced at least one metric, and estimate fractional fat content of the object of interest using the determined impedance. |
US11051696B2 |
Complementary color flashing for multichannel image presentation
Methods are provided for the highlighting of features in composite images through the alternating of images having complementary colors. An image having a feature of interest is used to generate one or more pseudo color images. A series of a pseudo color images and one or more additional pseudo color or original color images are then alternately displayed so that the differently colored regions among the series of images are easily recognizable to an operator. The differently colored regions differ in having hues that are complementary to one another. The methods are particularly useful for the display of information using two or more imaging modalities and channels, such as is the case for some medical applications in which a natural-light image of pink or light-red tissue with deeper red or blue vasculature is overlaid with another functional image. In these cases, a feature present in the functional image can be more easily perceived when displayed in a composite overlay with an underlying image from another imaging modality or channel. |
US11051693B2 |
Systems and methods for automated end-to-end eye screening, monitoring and diagnosis
System and method for fully automated end-to-end eye screening with automated medical acquisition and analysis. The system includes an eye imaging device, a mechanism that moves the imaging device, a computing platform that guides the movement mechanism, a user interface, and an electronic display device and/or printer to provide the screening, monitoring, and/or diagnosis report. |
US11051692B2 |
Optical instrument for measuring the density of the macular pigment in the eye and associated method
Optical instrument for measuring the density of macular pigment in the eye and associated method. The instrument includes: a light source (500), several lenses L1, L2, L3 between the light source and the eye, a diaphragm D1 conjugate to the eye pupil plane, a photodetector (520), a mirror M that directs the light exiting the eye to the photodetector (520), a diaphragm D2 conjugated to the pupil plane of the eye, at least one lens L4 between diaphragm D2 and the photodetector (520), the light source (500) has a central part (501) and a peripheral part (502), the light source (500) being modulated at four different frequencies corresponding to green light in the central part and in the peripheral part, blue light in the central part and in the peripheral part, projecting the light from the light source (500) on the fundus of the eye. |
US11051689B2 |
Real-time passive monitoring and assessment of pediatric eye health
A method, computer system, and computer program product for real-time pediatric eye health monitoring and assessment are provided. The embodiment may include receiving a plurality of real-time data related to an individual's eye health from a user device. The embodiment may also include assessing biometric indications relating to eye health based on the plurality of real-time data. The embodiment may further include generating a report on the assessed biometric indications. The embodiment may also include collecting clinical information from one or more databases. The embodiment may further include determining whether the assessed biometric indications reach pre-configured threshold conditions. The embodiment may also include generating alerts and recommendations based on analysis of the collected clinical information and the assessed biometric indications based on the assessed biometric indications satisfying the pre-configured threshold conditions. |
US11051685B2 |
Direct endoluminal- and/or endovascular-illumination systems and methods of use thereof
In some embodiments, endoscopy systems and/or methods of using endoscopy systems are described. In some embodiments, an endoscopy system comprises a shaft having an image sensor within a distal tip of the shaft. The shaft can have an expandable cuff disposed on an outer surface of the shaft. The expandable cuff can be moved from a contracted configuration to a deployed configuration. In the deployed configuration, an outer surface of the expandable cuff can inhibit, reduce, or prevent fluid (e.g., blood) flow in the vessel. Inhibiting or preventing the fluid flow can permit direct visualization of the interior of the vessel by the image sensor without interference from the fluid. |
US11051679B2 |
Substrate connection structure and endoscope
A substrate connection structure includes a tubular member, a first substrate, a second substrate, a first connector, a second connector, a first pin, and a guide member. The tubular member has a bottom portion and an opening side. The first substrate is disposed on either the bottom portion or the opening side. The second substrate is disposed on either the bottom portion or the opening side opposite to the first substrate. The first connector is disposed on the first substrate. The second connector is disposed on the second substrate and is connected to the first connector. The first pin is disposed on the first substrate. The first pin projects such as to extend from the first substrate along a direction of connection between the first connector and the second connector. The guide member is disposed on the second substrate. The guide member has a guide hole. |
US11051678B2 |
Optically guided feeding tube assemblies, feeding tube tips, and related methods
A feeding tube assembly and feeding tube tip secure a viewing lens proximal of the distal end of the feeding tube tip. The feeding tube tip can include a plurality of protrusions that extend radially inward to secure the viewing lens. The feeding tube assembly and feeding tube tip can be used to improve image quality by keeping tissue from abutting the viewing lens as the feeding tube tip is inserted into a patient. |
US11051676B1 |
Decontaminating floor mats
The present invention provides floor mats possessing antipathogenic, cohesive, viscoelastomeric and adhesive attributes for removing foot and/or sole borne contaminants. A thermoset reaction product derived from a reaction media of a carefully balanced ratio of isocyanate prepolymer, polyether diols and triols, and organic plasticizers effectively provides a floor mat overlay for adhesively retaining and preventing the spreading of foot or sole borne pathogens and other contaminants. |
US11051674B2 |
Glass rinser spin stop
A glass rinser apparatus is provided. The glass rinser apparatus may include a spray nozzle configured to output a liquid, a shank configured to be coupled at a first end to the spray nozzle, and to transmit the liquid to the spray nozzle, and a nut configured to be coupled to the second end of the shank. The shank may be shaped so that the shank does not rotate when the nut is coupled to the second end of the shank. The cross section of the shank may be substantially circular, and may include at least one flat portion. |
US11051672B2 |
Cleaning hand mitt with selectively invertable scrubbing pad
A cleaning hand mitt with a selectively invertible scrubbing pad that includes a mitt body having a relatively soft and non-abrasive cleaning surface covering the outer surface of the hand mitt, the hand mitt body having an enclosed cavity shaped and sized to receive a user's hand and a seam configuration defining a tight seam opening defined thereon. Inside of the hand mitt is an invertible pocket coupled to the seam configuration, wherein the invertible pocket is operably configured to be selectively concealed within the enclosed cavity of the hand mitt and selectively removed from the enclosed cavity to expose an abrasive outer surface of the invertible pocket for scrubbing debris and dirt off a user's vehicle. |
US11051671B2 |
Cleaner
A cleaner includes a body forming an external appearance, a rotating plate provided at a lower side of the body, a mop unit coupled to a lower side of the rotating plate so as to be in contact with a floor, a spin shaft connected to an upper side of the rotating plate so as to rotate the rotating plate, a water supply reservoir configured to surround a periphery of the spin shaft and spaced apart from the spin shaft so as to define a water supply space, and a water supply module configured to supply water to the water supply space. The rotating plate forms a water supply hole configured to interconnect the water supply space and the lower side of the rotating plate. |
US11051666B2 |
Pre-moistened wipe package with applicator
A pre-moistened wipe package with applicator includes a multi-ply applicator body that defines a first interior space between a first layer and a second layer and a second interior space between the second layer and a third layer. The first layer has an opening that is open to an exterior and provides access to the first interior space with a lid member being coupled to the first layer and configured to cover the opening in a closed position thereof. The second interior space is configured to receive a hand of a user. The package also includes an arrangement of wipes disposed within the first interior space and being removable through the opening. An outer exposed surface of the third layer is configured so as to releasably hold one of the wipes along the outer exposed surface. |
US11051665B2 |
Rolled sheet material dispenser
A rolled sheet material dispenser, used for dispensing a sheet material on a reel, includes a box and a clamping assembly. The clamping assembly includes a first clamping member, a second clamping member and at least one elastic member. The first clamping member or/and the second clamping member may be a roller. The roller is pivotally connected to the box through a pair of rolling bearings and adjacent to a dispensing opening. The roller is connected with the elastic member so that the roller can be displaced by an elastic force of the elastic member to a clamping position and can be supported by the rolling bearings to clamp the sheet material stably. |
US11051660B2 |
Plastomer spring with captive valve
The disclosure relates to a fluid pump including a plastomer spring with a captive valve element provided in an integrally formed valve chamber. The spring includes a first end portion and a second end portion and one or more spring sections connecting the first end portion to the second end portion, which spring sections can be compressed in the axial direction from an initial condition to a compressed condition and can subsequently expand to their initial condition. The valve chamber is formed in the first end portion. |
US11051658B2 |
Cover element for a preparation vessel of a food processor
A cover element for at least partially covering a vessel opening of a preparation vessel of a food processor and/or a cover opening of a vessel cover for the preparation vessel, wherein the cover element has a radially outwardly facing support edge to be supported on the preparation vessel and/or vessel cover. The support edge has a continuously curved base contour viewed in the axial direction, and has at least two support elements, which lie opposite each other, are separate from each other and protrude over the base contour. The support elements extending in an imaginary circular ring surface that reaches from a radially outer edge of the support elements up to the base contour are identically designed on both opposing sides viewed in the axial direction and formed in the same plane extending perpendicular to the axial direction. |
US11051655B2 |
Table having a heating appliance
A table (1) has a table top (2) containing an opening (3). A heating appliance (10) is in the opening (3) wherein the heating appliance (10) extends at least beneath the table top (2). The table top opening (3) comprises a recess (5) in which the heating appliance (10) is received, and the recess (5) has at least one wall (7) below the table top (2). The heating appliance (10) has a substantially sealed chamber (13) for receiving combustible fuel (47) with which the heating appliance (10) is used, and the chamber (13) has at least one window (35, 45). |
US11051651B1 |
Indoor smokeless grill
The present technology provides a device, such as an electric grill, that cooks food items on two or more sides. The electric grill includes upper and lower elements to create the sealed interior cooking environment. One of the elements of the electric grill includes a pressure plate that compresses the distance between the upper and lower thermal plate to create a sealed interior cooking environment and to engage the food item with both an upper and lower element. The pressure plate may be compressed by one or more spring-actuated cylinders or any other suitable mechanism. The compressed cooking area allows the cooking environment to contain any smoke generated from the cooking environment. |
US11051646B2 |
Cooking apparatus
The invention features a cooking apparatus having a number of compartments for the cooking of different foods under different cooking conditions. Aspects of embodiments of the contemplated invention include a lid portion, an upper portion that is vertically retractable and removably engaged with a bottom portion. The cooking apparatus is modular and, as such, enables the use of multiple cooking apparatuses for the steaming and/or boiling of different foods within the same pot or cooking unit at the same time. |
US11051642B1 |
Plastic garment hanger with collapsible plastic hook
A plastic garment hanger having a plastic hook moveable between an upright in-use position for displaying garments and a folded stowage position for reducing the footprint of the hanger during packaging/transportation of pre-hung garments. |
US11051641B2 |
Smart bottle
The invention discloses portable beverage vessel for storing beverage to be consumed by a human, having a beverage container in which the beverage is stored; and an electronic device having a vessel controller, a transmitter and a receiver, said vessel controller being adapted to communicate with a beverage dispenser by exchanging messages using the transmitter and receiver of the electronic device; wherein the vessel controller is adapted to send an identification message to the beverage dispenser, by which the beverage dispenser can identify the portable beverage vessel. The invention also discloses a communicating between the portable beverage vessel and a fluid dispenser and a personal electronic device. |
US11051638B2 |
Image display device, image display system, image display method, and program
An image display device includes an approach situation information acquirer that acquires approach situation information indicating approach of at least part of a customer's body to a shelf on which a plurality of items are displayed and indicating, when there is the approach, a position of the approach on the shelf at each time; an associator that associates the approach situation information with one item of the plurality of items according to the position indicated by the approach situation information; an index value calculator that calculates an index value relating to the customer's behavior on the basis of information indicating the item associated with the approach situation information; and a display unit that displays the index value calculated by the index value calculator together with an image of the item on the basis of the association made by the associator. |
US11051635B2 |
Pillow for treating and preventing plagiocephaly
In general, example embodiments are drawn to a pillow having a body with a neck support and at least one arm extending from a first end of the neck support to a second end of the neck support, the at least one arm having forming a center void. In example embodiments, a cover may be provided over or around the body. |
US11051634B2 |
Adjustable child carrier
An adjustable child carrier includes an adjustable bucket seat that can be adjusted to accommodate children of a wide range of sizes. The child carrier includes one or more adjustments that work alone or in cooperation to adjust the depth and width of the bucket seat area provided by the child carrier. The carrier is capable of supporting children of various sizes in an ergonomic position appropriate for the child's size. |
US11051628B2 |
Disassemble bed frame
A disassemble bed frame includes two longitudinal supporting arms, a plurality of bed slats, and a plurality of clearance lockers. Each of the supporting arms has a plurality of engaging slots spacedly formed at an inner side thereof, such that the engaging slots along the supporting arms are aligned when the supporting arms are extended parallelly. Two end portions of each of the bed slats are received at two of the engaging slots of said supporting arms respectively, such that the bed slats are spacedly extended between the supporting arms. The clearance lockers are detachably coupled at the supporting arms and are biased against the end portions of the bed slats to minimize clearances of the end portions of the bed slats within the engaging slots and to prevent the bed slats being detached from the supporting arms. |
US11051623B2 |
Backrest device
A backrest device includes a backrest carrier having a support arm, a backrest mounted on the support arm, and an actuator that is adjustable between a blocking position and a movement position. The support arm is equipped with a latching row. The backrest is movable along the support arm. The actuator is connected to the backrest and has an engaging piece. In the blocking position, the engaging piece is engaged with the latching row, so that a movement of the backrest along the support arm is blocked. In the movement position, the engaging piece is disengaged from the latching row, so that the backrest is movable along the support arm. The actuator is manufactured in one piece from an elastic material, in the movement position the actuator being elastically deformed by a manually applied force, so that the engaging piece is moved out of the latching row. |
US11051621B2 |
Actuator and backrest device, and piece of seating furniture having one such
An actuator device is disclosed that permits a first element to be moved linearly, in particular quasi-vertically, relative to a second element. The actuator device may be provided, in particular, for a vertical movement of a backrest, for example in a piece of seating furniture such as an office chair. The actuator device includes a displacement profile within a guide housing and a locking element. The displacement profile includes a latching row and the locking element is configured for engagement with the latching row. In a latching position, the locking element is resiliently rotated into the latching row of the displacement profile, and rotates back and forth when the displacement profile moves in a first direction with respect to the guide housing. In a release position, the locking element is rotated into a retaining position until it is disengaged from the latching row of the displacement profile. |
US11051620B2 |
Controller chair
A backrest portion supported, such as to be pivotable around an axis extending along its width direction center line, by a base, a left arm holding portion projecting forward from a left side portion of the backrest portion and supported, such as to be pivotable up and down around its base end portion, by the backrest portion, a right arm holding portion projecting forward from a right side portion of the backrest portion and supported, such as to be pivotable up and down around its base end portion, by the backrest portion, a left leg holding portion extending downward from a vicinity of a left side portion of a front edge of a seat portion at a front side of the base and supported, such as to be pivotable up and down around its upper end portion, by the base, and a right leg holding portion extending downward from a vicinity of a right side portion of the front edge of the seat portion at the front side of the base and supported, such as to be pivotable up and down around its upper end portion, by the base are included. |
US11051617B2 |
Telescoping adjustable leg
The telescoping adjustable leg comprises a tubular housing, a tubular toe, a cylindrical toe, a base and an externally threaded rod. The adjustable leg 10 is expandable from a fully retracted position to a fully extended position by rotation of the housing and cylindrical toe relative to the tubular toe. |
US11051616B2 |
Concentric circular rotating table(s)
Two tables in the form of concentric circular rings provide seating positions for people on the interior of the inner ring table and the exterior of the outer ring table. People on the interior face outwards, and people on the exterior face inwards. At least one table rotates relative to the other, such that each person positioned on the interior of the inner ring table will interface with each person positioned on the exterior of the outer ring table during one full revolution of the at least one rotating table. |
US11051614B1 |
Wash/sanitation rack for athletic equipment
A modular wash/sanitation rack including an inside channel, outside channel, gear rack mount, wall support, and gear support. A light-weight, structurally sound support assembly of the wash/sanitation rack includes one or more of the inside channel, the outside channel, the gear rack mount, and the wall support formed as a three-dimensional support from a flat pattern of a single sheet of material. The gear rack mount is connected to a flange of the gear support and is housed within an inside channel of the support assembly. The inside channel is housed within an outside channel. The outside channel is connected to the anchored wall support. The wash/sanitation rack is assembled as a secured or a moveable unit. |
US11051611B2 |
Desk system
A desk system including desktop, legs, and foot elements is presented. Each leg is rotatably attached at one end to the desktop and attached at another end to one foot element which is also rotatable. The system is disposed in a stowed configuration when legs and foot elements are substantially parallel to the desktop and legs are disposed between and substantially parallel to foot elements. The system is disposed in an upright configuration when legs are substantially perpendicular to the desktop and each leg is substantially perpendicular to one foot element. The system is configured from stowed to upright by separately rotating legs about a minor axis in opposite directions away from one another and by separately rotating foot elements about a major axis in opposite directions toward one another. The system is configured from upright to stowed by separately rotating foot elements about the major axis in opposite directions away from one another and by separately rotating legs about the minor axis in opposite directions toward one another. |
US11051610B2 |
Lighted toothbrush with front base button
A toothbrush including a handle extending in a longitudinal direction and including an upper portion and a base. The upper portion includes an insert portion. The base is made of a flexible material and overlaps the insert portion and includes an interior cavity. A light is configured to emit light visible from outside the handle. An activation device is positioned in the interior cavity and is configured to be pressed in a direction transverse to the longitudinal direction to activate the light upon a user pressing the base. |
US11051609B2 |
Methods and systems for optical sensing of forces in a toothbrush
An oral cleaning device (10) for characterizing a position of a brush head of the device. The oral cleaning device includes: a body portion (12); a brush head (14) extending from the body portion, where at least a portion of the brush head is configured to move relative to the body portion; a controller (30); and an optical sensor (28) positioned relative to the brush head member and body portion and being in communication with the controller, where the optical sensor is configured to obtain optical sensor data resulting from a deflection or rotation of the brush head member relative to the body portion; the controller being configured to receive the optical sensor data and determine the deflection or rotation of the brush head member relative to the body portion. |
US11051608B1 |
Bolt grease removal device
A device has a rectangular box, a roller driving unit and a controller are arranged to a side surface of the rectangular box, a grease removal unit is arranged to an inner surface of the rectangular box. The bolt grease removal device drives a conveyor belt to rotate through an electric motor, swing levers of clamping components play a role in fixing bolts, rotation of the conveyor belt drives bolts to make a circular motion to move bolts to a position of a cleaning brush to achieve an effect of removing grease on outer surface of bolt. Different rollers drive different cleaning brushes to rotate, use different sizes of driven wheels to make cleaning brushes have a certain relative speed to achieve an effect of rotating bolts and to increase the contact surface. |
US11051607B1 |
Painting system
The painting system comprises a paint brush, a brush hose, a pump, a power source, a cap, and a suction hose. Paint may be pumped from a paint can to the paint brush by the pump such that the paint brush may continuously apply the paint to a surface without necessitating that bristles of the paint brush be dipped into the paint can. The cap may couple to the top of the paint can to retain the suction hose in position within the paint can. A bristle attachment of the paint brush may be detached so that the bristle attachment may be cleaned or replaced. A sprayer attachment may be coupled to the handle in place of the bristle attachment and may be activated to spray paint the surface. |
US11051606B2 |
Oral care implement and method of assembling the same
An oral care implement that dispenses an oral care agent during use and a method of assembling such an oral care implement. The oral care implement may include a body having a head portion. The head portion may have a cavity with an open end. There may be at least one opening extending from the cavity to an outer surface of the head portion. A dissolvable element that includes an oral care agent may be positioned in the cavity. Furthermore, a supporting member may be positioned in the cavity. The supporting member may include a first coupling feature that couples the supporting member to the dissolvable element. Finally, an oral cleaning member may be coupled to the head portion to close the open end of the cavity. |
US11051605B2 |
Oral care implement and method for manafacturing such oral care implement
An oral care implement comprises a head and a handle made of a first material. The handle has a distal end and a proximal end closest to the head. The handle comprises a thumb rest made of a second material, the second material being different from the first material. The thumb rest comprises an area from about 202 mm2 to about 360 mm2 and has a concave shape. The thumb rest comprises a portion being inclined with respect to a remaining portion of the thumb rest by an angle α of about 20° to about 25°, the angle α being defined by a first line and a second line. The first line extends between a most elevated point and a lowest point of the thumb rest, and the second line extends between the lowest point and an end point of the thumb rest, the end point of the thumb rest being closest to the distal end of the handle. |
US11051602B2 |
Powder discharging container
Provided is a powder discharging container. The powder discharging container includes a container main body in which powder is stored, a button part which is disposed at an upper side of the container main body to be pressed by a user and which has a discharge hole formed at one side, a stem which is configured to ascend or descend according to whether the button part is pressed and which has a movement hole formed inside an upper portion to communicate with the discharge hole, a path forming part which is disposed inside the stem, communicates with the inside of the container main body, and has a powder movement path in which the powder moves and an air movement path in which air moves formed therein, and a compression chamber part which is coupled to lower portions of the stem and the path forming part, has a chamber formed therein to store air, and is configured to, as the button part is pressed, inject the air inside the chamber into the movement hole through the air movement path, wherein, as the air is injected from the chamber into the movement hole due to the button part being pressed, the powder inside the container main body moves through the powder movement path and the movement hole and is discharged to the outside through the discharge hole. |
US11051601B2 |
Beard shaping device
A device for guiding grooming of facial hair on a face and methods for using the device are disclosed. The device may include a strip of flexible material with an adhesive surface. The adhesive surface may temporarily attach the strip to a face having at least some facial hair. At least one edge of the strip may have a selected shape. The strip may be positioned on the face to cover a portion of the facial hair to be retained on the face while allowing an exposed portion of the facial hair to be removed by a shaving device. At least some part of the exposed portion of the facial hair lies along the edge of the strip with the selected shape. |
US11051600B2 |
Hair wrap towel article
A hair wrap article comprises a plurality of swaths of cloth dimensionally cut and stitched together to form the article comprising a volume, wherein an article first end comprises a first volume opening greater than a second volume opening at an article second end. The article comprises a securing tab at an exterior portion of the article first end or a plurality of through slits, either one to receive and secure the article second end. The article may comprise the following: the securing tab comprising an isosceles trapezoid geometric configuration; a secondary securing tab proximate the securing tab to alternately operate to receive and secure the article second end; a semi-rigid ribbing stitched into the stitched together portion of the article; and a portion of the second volume opening may be stitched together to close the second volume opening to create an article second end internal volume. |
US11051598B2 |
Magnetic closure, particularly for bags, rucksacks and the like
A magnetic closure, particularly for bags, rucksacks and the like, comprising a male element adapted to accommodate a magnet or ferromagnetic element, and a female element; the male element can be associated with a first flap of a bag, rucksack or the like, and the female element is associable with a second flap of the bag, rucksack or the like; the male element comprises an enclosure with a cavity for accommodating the magnet or ferromagnetic element, the enclosure being adapted to mate in a cavity of the female element. |
US11051592B2 |
Bracelet with expandable element
An accessory includes a band member and a button. The band member includes an elongated body defining a band interior cavity containing a fluid (gas or liquid) and further includes a band contact region formed along a length of the elongated body. The button has top and bottom portions and a body extending therebetween. The bottom portion is operably coupled to the band member. The body defines a button interior cavity that is in fluid communication with the band interior cavity, and further includes an expandable mechanism that includes first and second ends and a longitudinal axis. The expandable mechanism is movable between an expanded configuration and a collapsed configuration to selectively move the button between an expanded position and a collapsed position. Upon engaging the band contact region, the fluid urges the button to the expanded position. |
US11051591B2 |
Jewelry with cremains and print image and method of forming the same
An item of jewelry includes a first and second glass component. The first component includes a base layer with cremains deposited on a front surface. The second component is the same size and shape as the first component so that its outer edges align with those of the first component. The second component includes an image of a print placed on a substrate. The first component is placed on, and annealed to, the second component such that the cremains are sandwiched between the base layer and the substrate to form a durable image of the print on glass. |
US11051588B2 |
Overshoe footwear traction device
A footwear traction device is provided that is removably attachable to an item of footwear. The footwear traction device comprises a traction portion having one or more traction elements on a bottom thereof, a heel support portion disposed at a rear traction portion, and a forefoot support portion disposed at a forefoot traction portion. A cable extends through cable guides or channels and attaches the traction portion, the heel support portion, and the forefoot support portion together. A cable reel device is rotatably operable to adjust a length of the cable to selectively secure and unsecure the footwear traction device to the item of footwear. Shortening the length of the cable tightens the traction portion, the heel support portion and the forefoot support portion inwardly against the item of footwear, thereby securing the footwear traction device to the footwear. |
US11051586B2 |
Insole and footbed for golf shoes that improves balance, posture and stability to enhance the golf swing
Disclosed herein is an insole or footbed for a shoe. The insole includes a forefoot portion having a first thickness at a latitudinal midpoint thereof, a midfoot portion attached to the forefoot portion, and a hindfoot portion attached to the midfoot portion. An energy plug is attached to the midfoot portion and hindfoot portion and covering lateral portions of the dominant foot thereof. The hindfoot portion has a second thickness at a latitudinal midpoint thereof, the second thickness being less than a first thickness. The hindfoot portion includes a support stabilizer at an outside lateral portion of the dominant foot thereof. |
US11051581B2 |
Footwear sole structure having a fluid-filled chamber including a tensile member
A footwear sole structure having a fluid-filled chamber including a tensile member is provided. The fluid-filled chamber includes a first barrier sheet, a second barrier sheet and the tensile member. The first barrier sheet is formed from a first thermoplastic material. The second barrier sheet is attached to the first barrier sheet and is formed from a second thermoplastic material. The first barrier sheet and the second barrier sheet cooperate to define an internal cavity. The tensile member is disposed within the internal cavity and is formed from a third thermoplastic material. A first weld attaches the first barrier sheet, the second barrier sheet, and the tensile member together by melding the first thermoplastic material of the first barrier sheet, the second thermoplastic material of second barrier sheet, and the third thermoplastic material of the tensile member. |
US11051579B2 |
Toe guider device for footwear
A footwear includes a shoe sole, a shoe upper member coupled on the shoe sole, and a toe guider device which includes first and second spacers. Bottom ends of the first and second toe spacers are retained by the shoe sole while top ends of the first and second toe spacers are retained by the shoe upper. The first toe spacer is retained for being worn between first and second toes of a wearer. The second toe spacer is retained for being worn between second and third toes of the wearer. |
US11051576B2 |
Shoe with interchangeable sole
A shoe having a removable sole is provided. The shoe includes one or more straps that are insertable through corresponding apertures in the soles to attach a sole to a base of the shoe. The removable soles provide a shoe with capability to interchange soles, thereby providing for specialized soles to supply for a single shoe, which allows use of the shoe with various athletic sports. |
US11051574B2 |
Intelligent electronic footwear and control logic for automated pedestrian collision avoidance
Presented are intelligent electronic footwear with controller automated features, methods for making/using such footwear, and control systems for executing automated features of intelligent electronic footwear. An intelligent electronic shoe includes an upper that attaches to a user's foot, and a sole structure attached to the upper for supporting thereon the user's foot. A collision threat warning system, a detection tag, a wireless communications device, and a footwear controller are all mounted to the sole structure/upper. The detection tag receives a prompt signal from a transmitter-detector module and responsively transmits thereto a response signal. The footwear controller receives, through the wireless communications device, a pedestrian collision warning signal generated by the remote computing node responsive to the response signal. Responsively, the footwear controller transmits a command signal to the collision threat warning system to generate a visible, audible and/or tactile alert warning the user of an impending collision with a vehicle. |
US11051573B2 |
Braided articles and methods for their manufacture
Aspects herein are directed to braided articles and methods for their manufacture. The braided articles may include articles of footwear having braided uppers. The braided uppers may include a base yarn and a high performance yarn. The high performance yarn may form a braided structure within the braided upper. The braided structure may be continuously braided to provide continuous support to a wearer's foot when the article of footwear is worn as intended, by a wearer. |
US11051568B2 |
Barrier panel for selective coupling between jacket and trousers
A barrier panel is coupled between a jacket and a pair of trousers which provides a moisture resistant barrier therebetween about a full circumference of the torso of the user. The barrier panel cam be joined to both the jacket and trousers by zippers extending about a full circumference thereof, together with an end zipper joining the ends of the panel along the full width thereof to provide a complete barrier between the trousers and jacket. Alternatively, the barrier panel can be stitched to the trousers and received within a pocket formed by a cover panel on the trousers when not in use. The barrier panel has an elastic member spanning the full width and height of the panel and a moisture resistant membrane fully spanning one side of the elastic member. |
US11051567B2 |
Device for dynamic fluid pinning
The present disclosure provides microstructured hydrophobic surfaces and devices for gripping wet deformable surfaces. The surfaces and devices disclosed herein utilize a split contact Wenzel-Cassie mechanism to develop multi-level Wenzel-Cassie structures. The Wenzel-Cassie structures are separated with a spatial period corresponding to at least one wrinkle eigenmode of a wet deformable surface to which the microstructure or device is designed to contact, allowing grip of the deformable surface without slippage. Microstructures of the present invention are specifically designed to prevent the formation of Shallamach waves when a shear force is applied to a deformable surface. The multi-level Wenzel-Cassie states of the present disclosure develop temporally, and accordingly are characterized by hierarchical fluid pinning, both in the instance of slippage, and more importantly in the instance of localization. This temporal aspect to the multi-level Wenzel-Cassie state delays or prevents the transition from a wrinkled eigenmode state in a deformable surface to a buckled state in a deformable surface. |
US11051562B2 |
Rain garment
A garment in a preferred embodiment includes front, rear and first and second side panels and a hood all formed from a single piece of a high performance, water-proof, breathable material. The user may use releasable fasteners affixed above fixed connection points along each opposite side of the front and rear panels to adjust the size of the sleeve openings. Releasable fasteners are provided below the fixed connection points to allow the user to open or close the side edges of the front and rear panels below the fixed connection points. A plurality of releasable fasteners is provided along the bottom edges of the front and rear panels to allow the user to selectively adjust the fit about the user's torso. |
US11051559B2 |
Shirts configured for enhancing worker mobility
The present invention provides shirts, such as shirts that are worn as work uniform shirts, which are configured to provide significant improvements in a wearer's comfort, performance, and mobility over a predefined range of motions. Embodiments of the shirts comprise one or more stretch panels that are configured to provide for stretching of the shirt at an identified micro site in order to provide a wearer with enhanced mobility. In other embodiments, the manner in which the various portions of the shirt are shaped and connected together, and specifically the connection between the sleeve and the rear panel of the shirt, may be adjusted in order to provide a wearer with enhanced mobility. |
US11051554B2 |
MEMS-based sensor for an aerosol delivery device
An aerosol delivery device is provided that includes a housing, microelectromechanical systems-based (MEMS-based) sensor and microprocessor. The MEMS-based sensor is within the housing and configured to detect a pressure on the MEMS-based sensor caused by airflow through at least a portion of the housing. The MEMS-based sensor is configured to convert the pressure to an electrical signal, and output the electrical signal. The microprocessor is configured to receive the electrical signal from the MEMS-based sensor, and control operation of at least one functional element of the aerosol delivery device based thereon. |
US11051553B2 |
Atomizer with upgraded air passage structure and electronic cigarette having same
An atomizer with an upgraded air passage structure includes a housing, a heating piece and an air passage disposed in the housing; the heating piece is disposed inside an atomizer chamber, a blocking piece is disposed in the air passage and configured for blocking an airflow; the blocking piece divides the air passage into an air inlet area and an air outlet area; the air outlet area and the air inlet area are both disposed at a different axial position with the atomizing chamber; the atomizing chamber is respectively communicated with the air inlet area and the air outlet area; the airflow in the air inlet area flows downwards to the atomizing chamber, then flows upwards to the air outlet area. An electronic cigarette having the aforementioned atomizer is further disclosed. |
US11051551B2 |
Heating smokable material
An apparatus comprising a smokable material heater, configured to heat a first region of smokable material to a volatizing temperature sufficient to volatize a component of smokable material and to concurrently heat a second region of smokable material to a temperature lower than said volatizing temperature but which is sufficient to prevent condensation of volatized components of the smokable material. A method of heating smokable material is also described. |
US11051549B2 |
Electronic smoking device with liquid reservoir/wick portion
The invention relates to a liquid reservoir/wick portion and to an electronic smoking device comprising a liquid reservoir/wick portion. In order to avoid different liquids undesirably mixing in a wick of the electronic smoking device, the liquid reservoir/wick portion comprises a wick. The wick comprising a liquid receiving side coupled to a liquid storage volume of the liquid reservoir/wick portion, and a liquid supply side coupled to an atomizing element of the electronic smoking device. |
US11051548B2 |
Device for storing and vaporizing liquid media
A device for storing and vaporizing liquid media can comprise an annular liquid media storage tank and a heater configured to vaporize liquid stored in the annular liquid media storage tank. |
US11051547B2 |
Electronic cigarette and atomizing assembly thereof
An electronic cigarette has a conduit arranged in a atomizing stem, the conduit has a first segment and a second segment in communication with the first segment, the first segment has a wider inner space than the inner space of the second segment; a storage chamber is inside the atomizing stem and surrounds the conduit; and a heating device arranged inside the inner space of the first segment of the conduit for atomizing an atomizable material coming from the storage chamber. |
US11051545B2 |
Aerosol-generating system with improved air flow control
There is provided an aerosol-generating system including an aerosol-generating device and an aerosol-forming cartridge including at least one aerosol-forming substrate, wherein in use the aerosol-forming cartridge is at least partially received within the aerosol-generating device. The system further includes at least one electric heater configured to heat the at least one aerosol-forming substrate, at least one air inlet, and at least one air outlet. The system further includes an air flow channel extending between the at least one air inlet and the at least one air outlet. The air flow channel is in fluid communication with the aerosol-forming substrate, and has an internal wall surface on which one or more flow disturbing devices are disposed, the flow disturbing devices being arranged to create a turbulent boundary layer in a flow of air drawn through the air flow channel. |
US11051543B2 |
Alginate on adhesive bilayer laminate film
An ingestible compositions includes a first polymer layer, an adhesive layer associated with the first polymer layer, where the adhesive layer includes an adhesive material and is configured to releasably adhere to the first polymer layer, an alginate layer adhered to the adhesive layer, and a second polymer layer associated with the alginate layer and configured to releasably adhere to the alginate layer. Aspects further include methods of making and using the compositions. |
US11051538B2 |
Plated flavor powders
A flavor composition of a mixture of a) a first powder that includes a liquid flavor having a log P of up to about 3.5 loaded onto a first solid matrix material; and b) a second powder that includes a solvent loaded onto a second solid matrix material. The second solid matrix material is different than first solid matrix material and the flavor composition is in the form of a free-flowing powder. Also, methods of making a plated flavor powder and food compositions that include the powder. |
US11051535B2 |
Development of an asparagine-reducing yeast by adaptive evolution and uses thereof to reduce acrylamide formation
The present disclosure relates to a method of isolating a yeast strain that is able to degrade L-asparagine under non-inducing conditions comprising repeated cycles of adaptive evolution and mutagenesis followed by strain selection. Also included are yeast strains obtained by the method, and methods and uses thereof for reducing asparagine, and thus acrylamide, during food preparation and processing. |
US11051534B2 |
Separation of fat and lean using a decanter centrifuge
Methods for separating lean and fat from beef or other meats and the separation apparatus are shown. The methods use microbiocidal fluids to reduce or eliminate possible sources of contamination. |
US11051527B2 |
Cheese and method for its manufacturing
The invention relates to a method for making cheese wherein cheese is salted with a salting agent comprising milk minerals and NaCl or a mixture thereof. The invention also relates to ripened cheese having a ratio of K/Na of 0.39 to 4.0 and a K content of more than 0.08%. |
US11051525B2 |
Gas supply device, interior air adjustment device, and container refrigeration device
A gas supply device is provided with a heating unit that heats gas flowing into a filter provided in a filter unit. |
US11051524B2 |
Process for producing a composition for increasing muscle mass
A process for producing a composition from a biological source, which composition is preserved and, especially pathogen free and is storage stable, preferably at room temperature. Embodiments of the invention provide a process for producing a composition from eggs. |
US11051520B2 |
Lipolytic enzyme for use in baking
A polypeptide having lipolytic enzyme activity, selected from the group consisting of: (a) a polypeptide having at least 65% sequence identity to amino acids 21 to 309 of SEQ ID NO: 1; (b) a polypeptide encoded by a polynucleotide that hybridizes under medium stringency conditions with the polypeptide coding sequence of SEQ ID NO: 2; (c) a polypeptide encoded by a polynucleotide having at least 65% sequence identity to the polypeptide coding sequence of SEQ ID NO: 2; and (d) a fragment of the polypeptide of (a), (b) or (c) that has lipolytic enzyme activity. |
US11051514B2 |
Antifungal compounds
The present invention relates to compounds of Formula (I): wherein R1 is as defined herein, or an acceptable salt, solvate, prodrug or hydrate thereof. The compounds of Formula I are inhibitors of metalloenzymes, such as lanosterol demethylase (CYP51). |
US11051513B2 |
Pyridone compounds and agricultural and horticultural fungicides containing the same as active ingredients
An object of the invention is to provide compounds of formula (1) or salts thereof which are effective as agricultural and horticultural fungicides. In the formula, R1 represents, for example, a hydroxy group or a cyano group, R2, R3 and R4 are independent of one another and each represent, for example, a hydrogen atom or a halogen atom, R5 represents, for example, a hydrogen atom or a halogen atom, X represents an oxygen atom or a sulfur atom, Y represents, for example, a phenyl group or a pyridyl group, and the bond including the broken line represents a double bond or a single bond. |
US11051506B2 |
Weighted rodent bait stations and related methods
Rodent bait station assemblies and methods for assembly and bundling. |
US11051504B2 |
Pest control and detection system with conductive bait matrix
A pest control and/or detection system generally includes an electrically conductive bait matrix including at least one carrier material that is at least one of palatable, a phagostimulant and/or consumable and/or displaceable by pests, and a plurality of electrically conductive particles. The electrically conductive particles are substantially randomly interspersed throughout the at least one carrier material. The at least one carrier material includes a thermoplastic material and/or a resin. |
US11051501B2 |
Fishing reel
A fishing reel includes a reel body, a drive shaft, a handle, a first roller clutch, and a second roller clutch. The reel body includes a tubular body-side accommodating part. The handle includes a handle arm extending in a direction intersecting the drive shaft, and a tubular handle-side accommodating part disposed adjacent to the body-side accommodating part in the axial direction of the drive shaft and partially accommodating the drive shaft. The first roller clutch is disposed in the body-side accommodating part of the reel body and prohibits rotation of the drive shaft in a fishing line releasing direction. The second roller clutch is disposed in the handle-side accommodating part and transmits only rotation of the handle in a fishing line winding direction to the drive shaft. |
US11051497B2 |
Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics
The invention provides improved non-human vertebrates and non-vertebrate cells capable of expressing antibodies comprising human variable region sequences. The present invention is directed to the provision of long HCDR3s from non-human vertebrates and cells. The present invention is also directed to the provision of novel V, D and J pairings in immunoglobulin heavy and light chain loci. Novel, biased antibody diversities and potentially expanded diversities are provided. The invention also provides for novel and potentially expanded diversity or diversity that is biased towards variable gene usage common to antibodies useful for treating and/or preventing certain diseases or conditions, such as infectious diseases. The invention also provides methods of generating antibodies using such vertebrates, as well as the antibodies per se, therapeutic compositions thereof and uses. |
US11051496B2 |
Urokinase-type plasminogen activator transgenic mouse
The present invention provides a mouse with liver damage, having a high degree of damage against the mouse's original hepatocytes while having a uPA gene in a heterozygous form, and a method for efficiently preparing the mouse. Specifically, the method for preparing a mouse with liver damage having the uPA gene in a heterozygous form comprises the following steps of: (i) transforming mouse ES cells with a DNA fragment containing a liver-specific promoter/enhancer and cDNA that encodes a urokinase-type plasminogen activator operably linked under the control thereof; (ii) injecting the transformed mouse ES cells obtained in step (i) into a host embryo; (iii) transplanting the host embryo obtained in step (ii) via the injection of the ES cells into the uterus of a surrogate mother mouse, so as to obtain a chimeric mouse; and (iv) crossing the chimeric mice obtained in step (iii), so as to obtain a transgenic mouse in which the DNA fragment is introduced in a heterozygous form. |
US11051493B2 |
Method and system for distinguishing identities based on nose prints of animals
A system for distinguishing identities based on nose prints of animals contains: an input end, a database, an identification unit, and an output end. The input end is configured to input image data. The database includes multiple animal identity data which are actual nose prints data, actual body information, actual face data, and identity information of the animals. The identification unit is electrically connected with the input end, the database, and an output end. The identification unit includes multiple identification programs configured to analyze the image data, thus obtaining compared nose prints data, compared body information, and compared face data of the animals. The compared nose prints data, the compared body information, and the compared face data of the animals are compared with the actual nose prints data, the actual body information, and the actual face data of the animal identity data respectively. |
US11051491B1 |
Portable pet water dispensing system
The portable pet water dispensing system is configured for use with a companion animal. The portable pet water dispensing system is configured for use in a vehicle. The vehicle further comprises a passenger seat. An example of a suitable vehicle includes, but is not limited to an automobile. The portable pet water dispensing system is a watering device. The portable pet water dispensing system provides a source of water for the companion animal as the companion animal is traveling in the vehicle. The companion animal controls when the water is dispensed. The portable pet water dispensing system table comprises a harness, a housing, and a sipper water structure. The harness attaches the housing to the passenger seat. The housing contains the sipper water structure. The sipper water structure dispenses the water to the companion animal. |
US11051490B2 |
Insect water supply system
The insect water supply system is configured to prevent the insects (such as crickets) from self-contaminating the water supplied to the insects' rearing enclosure. The system is designed so that the insects drink in an inverted (i.e. upside down) and elevated position—consequently the insects' feces fall downward toward the ground and away from their water source—and therefore do not contaminate the insects' water supply. |
US11051489B2 |
Apparatus, liquid reservoir, system, and use of a liquid reservoir for electrolessly sprinkling animal feed
The present invention relates to an apparatus for electrolessly sprinkling animal feed. The apparatus comprises a housing, a mount for a liquid reservoir with a mechanically actuatable spray head, and a transmission element. The transmission element is movably mounted in the housings and configured to be moved by a conveying system. The transmission element comprises a section actuating the spray head, said section being configured to transmit movement of the transmission element to the spray head. The invention further relates to a liquid reservoir, a system, and a use of the liquid reservoir. |
US11051487B2 |
Pet guide platform for a pet door opening
A foldable pet apparatus has a rigid platform member, a rigid barrier member, and a support member. The rigid barrier member is attached to one end of the rigid platform member by a hinge. The support member is attached to the rigid platform member at its other end with a hinge. The support member may be attached to a vertical wall below a pet door opening. When the foldable pet apparatus is in a deployed position, the rigid platform member provides a place for a pet to stand after it passes through the pet door. The rigid barrier member prevents the pet from going straight off of the end of the rigid platform member. The pet must turn to the right or left to leave the platform. When the foldable pet apparatus is in the collapsed position, it blocks the pet door opening. |
US11051486B1 |
Animal enclosure
An animal enclosure for housing or transporting an animal such as a dog includes a kennel body having a top side, a bottom side opposite the top side, a front side, a back side opposite the front side, a right side and a left side opposite the right side. The animal enclosure includes a lower rear edge at the intersection between the back side and the bottom side. First and second wheels are passively disposed along the lower rear edge when the animal enclosure is in a resting position. A user can move the animal enclosure by lifting up the front edge of the kennel body, causing the first and second wheels to engage a surface on which the kennel rests. Once the wheels are engaged, a user may then maneuver the kennel in a tilted position using the first and second wheels as a rolling fulcrum. |
US11051485B2 |
Stackable and pallet-transportable cheese log forming and holding tray
A tray that eliminates the need for wrapping or packaging edible food articles that are in a malleable form, such as when made or otherwise produced, with the tray formed with at least a plurality of pairs of article holding compartments each three dimensionally contoured so as to define an edible food article mold that shapes or forms an edible food article received therein that is in a formable or moldable state so as to substantially conform at least a portion of the edible food article to the shape of the three-dimensional contour of the mold of the compartment in which the article is received. A preferred embodiment of the tray has at least a plurality of pairs of elongate article holding compartments that are generally parallel with one another with the article shaping or forming mold defined by each compartment formed of a compartment sidewall that has a concavely curved cross-section that preferably is generally semicircular in a transverse cross-section. In a preferred embodiment, each compartment has a mouth through which an edible food article enters during the filling of the tray with the mouth preferably defined by opposed portions of the generally semicircular compartment sidewall that are generally parallel to one another and which preferably can be obtuse the angled relative to one another to define a guide chute that guides the article into a desired position and/or orientation in the mold of the compartment that optimizes forming or shaping of the article before it cools, dries, cures or otherwise hardens thereby setting or fixing its shape memory so as to substantially conform at least a part of the shape of the article disposed in contact with the sidewall with the mold of the compartment in which the article is received. |
US11051482B2 |
Anthracnose resistant alfalfa plants
The present disclosure provides alfalfa plants exhibiting broad spectrum resistance to Race 1, Race 2, and Race 5 anthracnose. Such plants may comprise novel introgressed genomic regions associated with disease resistance from Race 1, Race 2, and Race 5 anthracnose. In certain aspects, compositions, including novel polymorphic markers and methods for producing, breeding, identifying, and selecting plants or germplasm with a disease resistance phenotype are provided. Also provided are alfalfa varieties designated as C0416C4164 and H0415C4114. Provided by the invention are the seeds, plants and derivatives of alfalfa varieties C0416C4164 and H0415C4114. Also provided by the invention are tissue cultures of alfalfa varieties C0416C4164 and H0415C4114, and the plants regenerated therefrom. Still further provided by the invention are methods for producing alfalfa plants by crossing alfalfa variety C0416C4164 or H0415C4114 with itself or another alfalfa variety and plants produced by such methods. |
US11051479B1 |
Soybean cultivar 94140580
A soybean cultivar designated 94140580 is disclosed. The invention relates to the seeds of soybean cultivar 94140580, to the plants of soybean cultivar 94140580, to the plant parts of soybean cultivar 94140580, and to methods for producing progeny of soybean cultivar 94140580. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 94140580. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 94140580, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 94140580 with another soybean cultivar. |
US11051475B2 |
Variety corn line HID4323
The present invention provides an inbred corn line designated HID4323, methods for producing a corn plant by crossing plants of the inbred line HID4323 with plants of another corn plant. The invention further encompasses all parts of inbred corn line HID4323, including culturable cells. Additionally provided herein are methods for introducing transgenes into inbred corn line HID4323, and plants produced according to these methods. |
US11051472B1 |
Maize hybrid X13N187W
A novel maize variety designated X13N187W and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X13N187W with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X13N187W through backcrossing or genetic transformation, and to the maize seed, plant and plant part produced thereby are described. Maize variety X13N187W, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X13N187W are provided. Methods for producing maize varieties derived from maize variety X13N187W and methods of using maize variety X13N187W are disclosed. |
US11051468B2 |
Hydrophonic planter
A hydrophonic planter for growing plants, comprising one or more growing cups filled with growing bed substrate, one or more dry tubes attached to a bottom side of the growing cup(s) where the dry tube(s) is mechanically coupled to a container containing nutrient solution, one or more water pumps driving a sprinkle of the nutrient solution through water pipes into the growing cup(s), a controller controlling operation of the water pump(s) and a communication component electronically coupled to the controller for communicating with one or more remote devices to transfer data between the controller and the remote device(s). Wherein the sprinkle flows over roots of one or more plants planted in the growing cup(s). A residue of the sprinkle flows through one or more holes located at the bottom side of the growing cup(s) and through the dry tube(s) to be accumulated at the bottom of the dry tube(s). |
US11051467B2 |
Drip irrigation emitter
A drip emitter sized for insertion into a liquid supply tube and positioned adjacent to a dripping aperture in the tube comprises an emitter body having a convex side configured to internally and adjacently fit the tube and an opposite flat side comprising a regulator, wherein the convex side comprises an outlet chamber configured to be fluidically connected to the dripping aperture; a membrane covering at least the regulator; a cover provided with a liquid intake having a filter, wherein the cover is configured to envelop the emitter body except of most of said convex side; and a locking mechanism connecting the flat side and an inner surface of the cover that is adjacent to the flat side so as to join the cover to the emitter body, wherein the membrane is retained therebetween. |
US11051461B2 |
Stackable planter assembly
A stackable planter assembly includes a plurality of planting boxes that each has a plurality of planting portions for have plants being planted therein. Each of the planting boxes has a drain that is centrally positioned between each of the planting portions for has water pass therethrough. The planting boxes are stackable on top of each other and having the planting portions on each of the planting boxes being offset with the planting portions on an adjacent one of the planting boxes. A plurality of receivers is each coupled to and extends outwardly from a respective one of the planting boxes. Each of the receivers is aligned with a respective one of the receivers when the planting boxes are stacked on top of each other. A plurality of poles is each extendable through respective ones of the receivers for retaining the plurality of planting boxes on top of each other. |
US11051457B2 |
Variable width twine disc assembly
In one embodiment, a variable width twine disc assembly, comprising: a fixed assembly comprising a first disc (24) having notches spaced along a periphery of the first disc (24) and a shaft (28); and a second disc (22) having notches spaced along a periphery of the second disc (22) and configured to be moveably adjusted along the shaft (28). |
US11051452B2 |
Auto-cycling deck plates for an agricultural vehicle
A method for operating an agricultural vehicle. The method includes an initial step of providing the agricultural vehicle which includes a feeder housing and a header. The header includes at least one row unit, which has a pair of deck plates, and a deck plate adjustment system. The deck plate adjustment system includes at least one actuator connected to the deck plates, an electronic control unit operably connected to the at least one actuator, and at least one sensor. The method includes the further steps of pivoting the feeder housing to raise the header, sending, by the at least one sensor, a signal to the electronic control unit, and cycling the deck plates, by the electronic control unit actuating the at least one actuator to move the deck plates, for removing a buildup of material on the deck plates. |
US11051450B2 |
Walk reel mower with a telescopic handle assembly
A walk reel mower has a traction frame that carries a rotatable cutting reel that pushes grass against a bedknife for cutting the grass. A handle assembly extends rearwardly and upwardly from the traction frame. The handle assembly carries a handle that is gripped by a user to operate the mower as the user walks on the ground behind the traction frame. The handle assembly has upper and lower portions that have a telescopic connection to one another to adjust the height of the handle above the ground to accommodate users of different heights. |
US11051447B2 |
Variable rate air seeding system for seeds
An air seeding system and method includes a manifold mounted across a plurality of row planter units. Electric motors are mounted on the manifold and are operatively connected to the seed meters. A microprocessor or controller adjusts the speed of the motors in response to field data input so as to adjust the rate of seed dispensement to achieve desired plant population. The motor speeds can be adjusted on the fly, without stopping the air seeder. The system senses ground speed, senses the raised and lowered positioned of the row planter units, and senses any blockage of the row planter units. The motors eliminate the need for a ground drive wheel. |
US11051444B2 |
Seed activation system and method
A seed activation system includes a shattering layer applied to an outer surface of a seed. The shattering layer forms a water-resistant coating around the seed that prevents the seed from germinating. An activation mechanism for transmitting electromagnetic energy is provided such that the shattering layer is compromised to break the water-resistant coating. The seed is then able to receive water and germinate. A seed activation method includes applying a shattering layer to an outer surface of a seed. The shattering layer forms a water-resistant coating around the seed that prevents the seed from germinating. The method further includes planting the seed in a soil, selecting an activation time, and activating the seed at the activation time by transmitting electromagnetic energy into the soil such that the shattering layer is compromised thereby breaking the water-resistant coating. The seed is then able to receive water for germinating. |
US11058040B2 |
Operation checking device of electronic mounting machine
An operation checking device of an electronic component mounting machine is provided with a first memory section configured to memorize an operation program of the electronic component mounting machine including at least a collection operation of an electronic component by a collecting device; a second memory section configured to memorize shape data of the electronic component and shape data of the collecting device; a first acquiring section configured to acquire information of the electronic components and information of the collecting device based on the operation program required for a current operation memorized on the first memory section; and a second acquiring section configured to acquire corresponding shape data of the electronic component and shape data of the collecting device from the second memory section based on the information of the electronic component and the information of the collecting device acquired by the first acquiring section. |
US11058035B2 |
Electric power inverter
An electric power inverter may include a capacitor board having a plurality of capacitors, and at least one semiconductor board each having a plurality of power semiconductors. The capacitor board and the at least one semiconductor board may be mutually stacked in a stacking direction, with a clearance, in a stack formation, and may be electrically interconnected. The capacitors may be arranged in the stacking direction, and fitted to a side facing the at least one semiconductor board. The capacitors may be arranged on the capacitor board to form at least one open location space between the capacitors, each positioned to accommodate one semiconductor board. Each semiconductor board may be arranged within the respective location space with a clearance to the capacitor board. At least some of the capacitors may be arranged in the middle of the capacitor board and each semiconductor board may be arranged on an edge of the capacitor board, so that current paths on the capacitor board may extend generally radially from the middle to the edge of the capacitor board. |
US11058034B2 |
Modular network switch
A modular network switch is disclosed. In an embodiment, removable interface modules and a switch circuit board (SMB) are housed in a chassis. Each of the interface modules includes a circuit board that is positioned in parallel with other interface modules. The SMB is oriented in a plane perpendicular to orientation planes of the interface modules, and the circuit boards are connected to the switch circuit board. A switch chip is electrically connected to SMB, and configured to switch network traffic between network connections of the interface modules. The chassis may include airflow regions separated by a divider with respective air intake vents. A power supply is housed in one of the regions and the SMB/interface modules are housed in another region. Power supplies provide power to the interface modules via a bus bar and provide power to the switch circuit board via a connection separate from the bus bar. |
US11058033B2 |
Receptacle assembly and thermal-transfer assembly
Receptacle assembly includes a receptacle cage and a thermal-transfer module that is coupled to a thermal side of the receptacle cage. The thermal-transfer module has a base portion and a plurality of heat-transfer fins coupled to the base portion. The thermal-transfer module is configured to absorb thermal energy from a pluggable transceiver in the receptacle cage and transfer the thermal energy through the base portion and to the heat-transfer fins. The receptacle assembly also includes a retention clip configured to hold the thermal-transfer module to the receptacle cage. The retention clip includes a resilient beam that extends across the thermal-transfer module. The resilient beam directly engages at least some of the heat-transfer fins and applies a resilient force against the heat-transfer fins. |
US11058029B2 |
Liquid immersion-cooled electronic device and liquid immersion-cooled processor module
A processor module includes a first circuit substrate and a second circuit substrate each having a processor mounting area and a memory mounting area on one surface thereof. One processor is mounted in the processor mounting area, while comb-like arranged memory modules are mounted in the memory mounting area. The surface of the first circuit substrate and the surface of the second circuit substrate are combined face-to-face and positioned such that the processor mounting area and the memory mounting area of the first circuit substrate are placed face-to-face respectively with the processor mounting area and the memory mounting area of the second circuit substrate, and end parts of the plurality of comb-like arranged memory modules of the first circuit substrate and end parts of the plurality of comb-like arranged memory modules of the second circuit substrate are alternately arranged with clearances produced between adjacent memory modules. |
US11058025B1 |
Two-stage modular server chassis structure
A two-stage modular server chassis structure includes a first chassis and a second chassis. A first assembling portion and a second assembling portion are disposed at the front of the first chassis, a first relative assembling portion and a second relative assembling portion of the second assembling portion corresponding to the two first assembling portions are disposed at the rear of the second chassis for connecting and fixing the two first assembling portions and the two first relative assembling portions, and the second assembling portion and the second relative assembling portion, so that the first chassis and the second chassis are integrally formed as a whole. |
US11058018B1 |
Electronic device including flexible display
An electronic device is provided. The electronic device includes a housing, a plate capable of being slid out from the housing, a flexible display including a first area disposed on one surface of the plate, and a second area extending from the first area and at least partially drawn out from an inner space of the housing when the plate is slid out, a curved member positioned in an inner space of the housing to correspond to the second area, a first linear gear positioned on another surface of the plate, and including a plurality of gear teeth arranged in a first direction in which the plate is slid out, a second linear gear including a plurality of gear teeth arranged in the first direction, and a circular gear capable of being rotated about a rotation shaft perpendicular to the first direction, and disposed between the first linear gear and the second linear gear to be spaced apart from the curved member in a second direction opposite to the first direction, the circular gear being engaged with the first linear gear and the second linear gear. |
US11058017B2 |
Video converter with integrated power supply
A professional video converter is a video signal processing device built for audio-video applications to convert from one video format to another. It includes a heavy-duty enclosure, an electronic circuit to convert/distribute/scale/buffer/amplify video and/or audio and an internal power supply unit. The power supply comes from a mains-level electrical input connector. An additional electrical output connector may be added to power extra equipment. The unit can be installed and suspended safely, thanks to a built-in rigging thread and attachment points on its enclosure. The unit may be placed securely on any surface using the rubber pad, and magnets allow clean stacking of multiple devices. The connectors are also protected by the specific shape of the enclosure of the converter. |
US11058013B2 |
Method of manufacturing battery module and interconnect board assembly with integrated PCB and flex circuit
A method of manufacturing an interconnect board (ICB) assembly for a battery module, the ICB assembly having a printed circuit board assembly (PCBA) and a carrier frame, includes depositing solder paste onto a printed circuit board (PCB) and/or a flexible printed circuit (flex circuit). The flex circuit has a conductive foil substrate coated with insulating material, and defines tabular flying leads radially-projecting from the flex circuit's periphery. The method may include positioning the PCB adjacent to the flex circuit such that the PCB and flex circuit are in direct contact along a flex interface surface of the PCB, and integrally joining the PCB and flex circuit along the interface surface to form the PCBA. The PCBA connects to the carrier frame to construct the ICB assembly. The battery module may be manufactured by connecting the ICB assembly to battery cells of the battery module. |
US11058012B2 |
Circuit board structure and manufacturing method thereof
A circuit board structure includes a circuit layer structure, an electronic component, and a stopper. The circuit layer structure includes a plurality of dielectric layers and circuits in the dielectric layers. The electronic component is disposed in the circuit layer structure; the electronic component includes a chip and a conductive bump; the chip has a first surface and a second surface that are oppositely disposed, and the first surface of the chip contacts one of the dielectric layers; the conductive bump is on the second surface of the chip and is electrically connected to the chip. The stopper is within the circuit layer structure and abuts against the conductive bump. A method for fabricating a circuit board structure is also provided herein. |
US11058003B2 |
Capacitor and board having the same
A capacitor includes a body including a plurality of dielectric layers, first and second internal electrodes alternately disposed with respective dielectric layers interposed therebetween, and first and second insulating regions. The first insulating region is disposed in each of the first internal electrodes and includes a first connection electrode disposed therein. The second insulating region is disposed in each of the second internal electrodes and includes a second connection electrode disposed therein. The products D1×Td and D2×Td are greater than 20 μm2, where Td is a thickness of the dielectric layer, and D1 and D2 are widths of the first and second insulating regions, respectively. |
US11057997B2 |
High-frequency module
A high-frequency module (1) includes a substrate (10), a first electronic component (30) and a second electronic component (40) mounted on a main surface (10a) of the substrate (10). The substrate (10) has a protruding portion (20) projecting from the main surface (10a), the first electronic component (30) is mounted in a region of the main surface (10a) different from a region in which the protruding portion (20) is provided, and the second electronic component (40) is mounted on the protruding portion (20). |
US11057986B2 |
Printed circuit board and optical transceiver with the printed circuit board
The present invention provides a printed circuit board comprising: a dielectric layer (130); N pairs of differential signal vias (2) which penetrate through the dielectric layer wherein N is an integer more than one; N pairs of first strip conductors (101,102) disposed on a first surface of the dielectric layer; a first ground conductor layer (103) disposed in the dielectric layer forming N first differential transmission lines (100) with the N pairs of first strip conductors and the dielectric layer; N pairs of second strip conductors (111,112) disposed on a second surface of the dielectric layer; a second ground conductor layer (113) disposed in the dielectric layer forming N of second differential transmission lines (110) with the N pairs of second strip conductors and the dielectric layer. |
US11057984B2 |
High-speed hybrid circuit
A circuit includes a printed circuit board including a first portion defining a window formed as a first void on a first side of the printed circuit board and a second portion defining a cavity formed as a second void opposite the first void on a second side of the printed circuit board. The circuit further includes a heat sink inserted in the second void, the heat sink having a first side forming a bottom of the first void and the bottom of the first void within the printed circuit board. The circuit yet further includes at least one electronic circuit die mounted to the first side of the heat sink and electrically coupled to the first side of the printed circuit board. |
US11057983B2 |
PCB assembly and method of manufacturing a PCB assembly
The present invention provides a PCB assembly. The PCB assembly comprises a PCB board element comprising an outer surface, and a micro heat pipe configured for heat transport. The micro heat pipe has a pipe wall and at least a section of the pipe wall is connected to the outer surface of the PCB board element in a thermally conductive manner. The thermally conductive connection may comprise a solder connection. Thus, a corresponding micro heat pipe may comprise a pipe wall, wherein at least a section of the pipe wall is configured to be soldered to a PCB element. Furthermore, the present invention provides a corresponding method of manufacturing a PCB assembly. |
US11057981B2 |
System and method for providing high power factor wired lamp control
A system and method for providing high power factor wired lamp control that include receiving a lighting control input though a switch that is associated with at least one of: an operation and a function of at least one lamp. The system and method also include processing a digital data packet that includes at least one electronic data command associated with the lighting control input. The system and method additionally include implementing at least one powerline interruption associated with an AC power cycle to communicate the digital data packet to the at least one lamp. The system and method further include controlling the at least one lamp to operate based on the lighting control input based on the receipt of the digital data packet communicated through the AC power cycle. |
US11057975B2 |
Two-terminal integrated circuits with time varying voltage-current characteristics including phased-locked power supplies
A two-terminal IC chip and method thereof. For example, a two-terminal IC chip includes a first chip terminal and a second chip terminal. A first terminal voltage is a voltage of the first chip terminal, a second terminal voltage is a voltage of the second chip terminal, and a chip voltage is equal to a difference between the first terminal voltage and the second terminal voltage. The chip is configured to allow a chip current to flow into the chip at the first chip terminal and out of the chip at the second chip terminal, or to flow into the chip at the second chip terminal and out of the chip at the first chip terminal. The chip current is larger than or equal to zero in magnitude. The chip is further configured to change a relationship between the chip voltage and the chip current with respect to time. The chip is an integrated circuit, and the chip does not include any additional chip terminal other than the first chip terminal and the second chip terminal. |
US11057973B2 |
Retrofit LED lighting device having improved timing event detection for increasing stable driver operation without light flicker
A retrofit Light Emitting Diode, LED, lighting device for connection to a ballast, wherein said ballast is arranged to provide for a ballast current, said retrofit LED lighting device comprising at least one LED for emitting light, a rectifier arranged for rectifying said ballast current and for providing a lamp current to said at least one LED, a shunt switch for shunting said at least one LED thereby preventing said lamp current to flow through said at least one LED, a control unit for controlling said shunt switch, wherein said control unit is arranged to detect a particular amplitude offset current level in one of said ballast current and said lamp current, said particular amplitude offset current level being a particular non-zero value of said ballast current or said lamp current and to activate said shunt switch triggered by said detection. |
US11057969B2 |
Low cost solid state RF generation system for electromagnetic cooking
A solid state radio frequency generation system is provided for an electromagnetic cooking device having an enclosed cavity. The radio frequency generation system includes: an RF feed for introducing electromagnetic radiation into the cavity to heat a food load; a high-power RF amplifier coupled to the RF feed, the amplifier comprising at least one amplifying stage configured to output a signal that is amplified in power with respect to an input RF signal; a small signal generator for supplying the input RF signal to the amplifier; and a switching power supply unit including a single DC-DC converter that converts AC mains power to low voltage DC for supply to the amplifier, and a controller configured to adapt an input current from the AC mains power to form a predefined periodic waveform with the same frequency as the AC mains power for supply to the small signal generator. |
US11057968B2 |
Food preparation
Devices and methods for RF heating of food, using techniques which allow uniformity and/or controlled non-uniformity. |
US11057966B2 |
Device and method for plasma arc melting through magnetostatic soft-contact stirring and compounding
The present invention discloses a device for plasma arc melting through magnetostatic soft-contact stirring and compounding, which includes a furnace body, where a water-cooled copper crucible and a tungsten electrode are mounted in the furnace body, the tungsten electrode is located above the water-cooled copper crucible, and a groove for containing a metal raw material is opened in the water-cooled copper crucible; and a drive shaft penetrates through a side wall of the water-cooled copper crucible, one end, located at the exterior of the water-cooled copper crucible, of the drive shaft is connected with a stepper motor, one end, located in the water-cooled copper crucible, of the drive shaft is sleeved with two rotary tables, magnets having reverse magnetisms are interleaved in the rotary table, and the rotary tables are located on two sides of the groove. |
US11057963B2 |
Lamp infrared radiation profile control by lamp filament design and positioning
Methods and apparatus disclosed herein generally relate to lamp heating of process chambers used to process semiconductor substrates. More specifically, implementations disclosed herein relate to arrangement and control of lamps for heating of semiconductor substrates. In some implementations of the present disclosure, fine-tuning of temperature control is achieved by dividing different lamps within an array of lamps into various subgroups or lamp assemblies defined by a specific characteristic. These various subgroups may be based on characteristics such as lamp design and/or lamp positioning within the processing chamber. |
US11057960B2 |
Radio terminal and base station
A user equipment for a mobile communication system, includes: a receiver configured to receive, from a base station, an RRC (Radio Resource Control) connection release message including information instructing a transition to a specific state; and a controller configured to cause the user equipment to transit to the specific state in response to receiving the RRC connection release message including the information. The specific state is a different RRC state from an RRC connected and an RRC idle, and a connection for the user equipment is maintained between the base station and a core network. |
US11057958B2 |
Method and device for establishing/reconfiguring data bearer
The present application provides a method for establishing/reconfiguring a data bearer that comprises receiving a request message for data bearer establishment/reconfiguration, wherein the request message comprises a data bearer identity used to identify a data bearer and a bearer type indication cell used to indicate a type of a to-be-established/reconfigured data bearer; and establishing/reconfiguring a corresponding data bearer according to the request message. The present application further provides user equipment and a base station for establishing/reconfiguring a data bearer. |
US11057954B2 |
Network assistance via a local breakout function-gateway in RAN
A method in a network node (115) comprises establishing (1604) a first bearer (1310, 1520) between a local breakout function gateway (1220), the local breakout function gateway collocated at the network node, and an application client (1210, 1405, 1505) of a wireless device (110). The method comprises transmitting (1608) network assistance information to the wireless device over the first bearer via application-layer signaling in the user plane, the network assistance information comprising information related to optimizing transmission of user data over a second bearer (1305, 1515) established between the wireless device and a core network node (130). |
US11057951B2 |
Communication apparatus, method of controlling communication apparatus, and non-transitory computer-readable storage medium
A communication apparatus operable to perform communication with another communication apparatus that supports a first version of a predetermined communication method or a second version of the predetermined communication method different to the first version, registers a version of the communication method that the other communication apparatus supports, transmits, in a case where the version of the communication method that the other communication apparatus supports is registered, a signal according to the first version or the second version that is registered, and transmits, in a case where the version of the communication method that the other communication apparatus supports is not registered, both a signal according to the first version and a signal according to the second version. |
US11057945B2 |
Apparatus and method for random access in wireless communication system
The present disclosure provides an apparatus and a method for random access in a wireless communication system having a base station and wireless terminals, where the wireless terminal can select a detection sub-segment from a preamble detection segment that is divided into a multiple number of detection sub-segments, transmit a random access preamble with the timing adjusted such that the random access preamble is received at the base station in the selected detection sub-segment, and when a random access response message is received from the base station, transmit a terminal identification message to the base station and receive a contention resolution message from the base station. |
US11057942B2 |
Data transmission method for multiplexing data portion, device, and system
Disclosed are a data transmission method, device, and system. The method comprises: for the transmission of random access uplink data, according to the correspondence between preambles and data resources as described by a protocol, determining the data resource corresponding to the preamble in the uplink data transmission, different preambles corresponding to different data resources; transmitting the preamble and the uplink data that uses the determined data resource. In the embodiments of the present invention, a protocol describes the correspondence between preambles and data resources. For the transmission of random access uplink data, the data resource corresponding to the preamble in the uplink data transmission can be determined, and different preambles correspond to different data resources. Thus it can be ensured that different users use different data resources to bear uplink data, thereby enabling the data portion multiplexing for multiple users. |
US11057940B2 |
Apparatus and method of transmitting and receiving message 3 protocol data unit
A communication method and system for converging a fifth generation (5G) communication system for supporting higher data rates beyond a fourth generation (4G) system with a technology for Internet of things (IoT) are provided. The communication method and system may be applied to intelligent services based on the 5G communication technology and the IoT-related technology, such as smart home, smart building, smart city, smart car, connected car, health care, digital education, smart retail, security and safety services. A method of a terminal for performing a random access procedure in a wireless communication system is provided. A method includes identifying whether physical random access channel (PRACH) occasions are configured for an active uplink (UL) bandwidth part (BWP) of a serving cell; based on the PRACH occasions not being configured for the active UL BWP and the serving cell being a special cell (SpCell), switching an active downlink (DL) BWP of the SpCell; and performing the random access procedure on the active DL BWP of the SpCell and the active UL BWP of the serving cell. A method by a terminal for transmitting a message 3 (Msg3) in a random access procedure is provided. In addition, a method by a terminal for system information (SI) request is provided. |
US11057939B2 |
Apparatus, system, and method for preambles for unlicensed access
Apparatuses, systems, and methods for transmitting a preamble. The UE may transmit a preamble to a base station in a random access channel (RACH). The RACH may be located in unlicensed spectrum. The bandwidth of the preamble may cover a majority of a nominal channel bandwidth of the RACH. The UE may receive a random access response and establish a connection with the base station in response to receiving the random access response. |
US11057936B2 |
Mechanism for merging colliding RACH procedures
The present disclosure presents example techniques for merging multiple concurrent RA procedures. For instance, the present disclosure describes an example method performed by a user equipment, UE (102), for performing random access to connect to a wireless access network. In an aspect the method includes determining that a second RA procedure (122) is triggered during a first RA procedure (120) that is ongoing. In a further aspect, the example includes combining the second RA procedure (122) and the first RA procedure (120). Corresponding UE, computer program, and processor/memory embodiments are also described. |
US11057933B2 |
Method for avoiding collision in synchronous wireless communication system
The present invention relates to a method of avoiding collision in a. More specifically, the present invention relates to a method of effectively avoiding collision when resources are allocated to and used by substantial mobile terminals in a synchronous wireless distribution communication system. The method of avoiding collision includes: determining, by a terminal, a slot to be transmitted in a main frequency channel; in a slot prior to the determined slot, performing contention using a contention deputy channel having a different frequency from the main frequency channel; and using the selected slot of the main frequency channel when winning the contention. |
US11057930B2 |
Method, system, and terminal device for data transmission in unlicensed spectrum
The present disclosure provides a method, system, and terminal device for data transmission in an unlicensed spectrum, effectively reduce mutual signal interference between different systems while meeting regulation constraints on use of the unlicensed spectrum. The method in the present disclosure includes: at a processing start moment of a terminal device in a current channel occupancy time window of a network device, when remaining duration of the current channel occupancy time window of the network device is greater than or equal to duration for the terminal device to transmit a to-be-sent data packet to the network device, selecting based on a user attribute of the terminal device and from a mapping relationship between a user attribute and a transmission mode; and sending the to-be-sent data packet to the network device in the selected transmission mode. |
US11057927B2 |
Control channel design for many-antenna MU-MIMO systems
Disclosed embodiments include methods for control channel design in many-antenna multi-user (MU) multiple-input multiple-output (MIMO) wireless systems. A beacon comprising an identifier of a many-antenna base station is encoded into a base sequence. A plurality of synchronization sequences is generated based on the encoded base sequence and a set of orthogonal beam sequences. The many-antenna base-station transmits, using a plurality of antennas, the plurality of synchronization sequences in a plurality of beam directions associated with the set of orthogonal beam sequences for synchronization and associated with users without knowledge of channel state information (CSI). |
US11057926B2 |
Physical uplink shared channel coverage enhancements
Methods, systems, and devices for wireless communication are described. A user equipment (UE) may receive an uplink grant that conveys an indication of a multi-transmission opportunity (TxOP) grant. The UE may transmit, during a first TxOP, a first uplink transmission in one or more subframes in accordance with the multi-TxOP grant. The UE may transmit, during a second TxOP, a second uplink transmission in one or more subframes in accordance with the multi-TxOP grant. |
US11057924B2 |
Method and apparatus for decoupling uplink and downlink cell selection
A method includes receiving information at a user equipment from a first apparatus, the information indicating to the user equipment is to communicate with a second apparatus. |
US11057923B2 |
Transmission method, terminal device and base station
Embodiment of the present application provides a transmission method, a terminal device, and a base station, used to solve the technical problem in the related art that there is no method supporting CBG-based retransmission and ACK/NACK feedback. The transmission method comprises: receiving by the terminal device a downlink control channel; and acquiring by the terminal device a first indication field from the downlink control channel, the first indication field being used to indicate whether each code block group (CBG) in the corresponding CBGs in an initial transmission of TB needs to be retransmitted. |
US11057920B2 |
Radio terminal, radio base station, channel signal forming method and channel signal receiving method
A base station is disclosed, including an information size adjusting section configured to adjust a size of control information based on a first basic information size of control information mapped on a user equipment (UE) specific search space in a first component carrier. The base station also includes a transmitter configured to transmit the control information mapped on the UE specific search space. A first determination method for determining the first basic information size is different from a second determination method for determining a second basic information size of control information mapped on a common search space in the first component carrier. The first determination method for determining the first basic information size is different from a third determination method for determining a third basic information size of control information mapped on a search space in a second component carrier that is different from the first component carrier. |
US11057917B2 |
Quasi co-location relation configuration for periodic channel state information reference signals
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment (UE) may receive information configuring one or more occasions of a periodic channel state information reference signal (P-CSI-RS) without associated quasi co-location (QCL) information for the one or more occasions of the P-CSI-RS. The UE may receive an occasion of the P-CSI-RS, of the one or more occasions of the P-CSI-RS, using a QCL relation determined based at least in part on whether a physical downlink shared channel (PDSCH) is scheduled for a same set of symbols as the occasion of the P-CSI-RS. Numerous other aspects are provided. |
US11057915B2 |
Candidate transmission configuration information states for slot aggregation
Methods, systems, and devices for wireless communications are described. A user equipment (UE) may determine, during a multi-slot downlink transmission, that a mapping from a transmission configuration information (TCI) state index to a first TCI state configuration has changed to a second TCI state configuration. The UE may select, based at least in part on the determined change, the first TCI state configuration or the second TCI state configuration to use for at least a portion of the multi-slot downlink transmission. The UE may receive the multi-slot downlink transmission during one or more slots according to the selected TCI state configuration and the TCI state index. |
US11057906B2 |
Radio communication apparatus and radio communication method
A radio communication apparatus functioning as a transmitter in a radio communication system including the transmitter and a receiver includes a first data generation unit that generates first data which are to be transmitted in accordance with a first transmission scheme, a second data generation unit that generates second data which are to be transmitted in accordance with a second transmission scheme, and a transmission unit that, when the second data are generated during transmission of the first data, punctures a portion in which a predetermined signal is transmitted in a resource allocated for the transmission of the first data, transmits the first data in an unpunctured portion, and transmits the second data in the punctured portion. |
US11057905B2 |
Communication method, network device and terminal device
Provided are a communication method, a network device and a terminal device. The method comprises: a network device obtains signature information of a terminal device, the signature information comprising level information of the terminal device; the network device allocates a first network configuration for the terminal device according to the level information; the network device sends the first network configuration to the terminal device, so that the terminal device communicates with the network device according to the first network configuration. The network device obtains the signature information comprising the level information of the terminal device and sends the network configuration allocated for the terminal device according to the level information to the terminal device, thereby enabling the network device to perform differentiated network configuration for different terminal devices, thus improving the quality of service provided to high-level terminal devices. |
US11057902B2 |
Channel rank updates in multiple-input multiple-output communication systems
Embodiments of the disclosure provide a system and method for providing channel feedback information (CFI) from a user equipment device to a base station. CFI is transmitted from the user equipment device on first and second communication channels. The user equipment device is operable to measure the channel rank of a downlink channel and to select a preferred channel rank that is used to configure the CFI that is transmitted to the base station. The base station is operable to use the preferred channel rank to interpret the CFI transmitted by the user end device. |
US11057896B2 |
Methods and apparatuses of determining quasi co-location (QCL) assumptions for beam operations
A method of wireless communications is provided. The method includes monitoring, by a user equipment (UE), at least one of a plurality of Control Resource Sets (CORESETs) configured for the UE within an active BWP of a serving cell in a time slot, and applying, by the UE, a first Quasi Co-Location (QCL) assumption of a first CORESET of a set of one or more monitored CORESETs to receive an aperiodic Channel Status Information-Reference Signal (CSI-RS). The first CORESET is associated with a monitored search space configured with a lowest CORESET Identity (ID) among the monitored CORESET(s). |
US11057894B2 |
Apparatus, method and computer program for non-stand-alone wireless communications
An apparatus including control circuitry; first radio circuitry for communicating with a first radio circuitry of a first base station; second radio circuitry for communicating with second radio circuitry of a second base station; wherein the control circuitry is configured to use information received from a user equipment, for configuring the second radio circuitry of the apparatus such that a connection can be established between the second radio circuitry of the apparatus and the second radio circuitry of a base station. |
US11057882B1 |
Systems and methods for dynamically setting frame configuration in a wireless network
A system for dynamically setting a frame configuration in a wireless network in an emergency event includes an access node configured to deploy a first radio air interface. The system also includes a plurality of end-user wireless devices attached to the first radio air interface. The system further includes a processor configured to determine a trigger indicating the emergency event associated with one or more of the plurality of end-user wireless devices. The processor is also configured to switch the frame configuration for the access node from a first frame configuration to a second frame configuration, the second frame configuration including more uplink subframes than the first frame configuration. |
US11057877B2 |
Reference signal design for numerology ambiguity
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a transmitter may identify a set of resource elements on which to transmit a reference signal based at least in part on a numerology being used by the transmitter and at least one of a maximum system numerology or a minimum system numerology; and transmit the reference signal on the identified set of resource elements. In some aspects, a receiver may identify a set of resource elements from which to obtain a reference signal based at least in part on a numerology being used by the receiver and at least one of a maximum system numerology or a minimum system numerology; and obtain the reference signal from the identified set of resource elements. Numerous other aspects are provided. |
US11057876B2 |
Downlink control for multiple transmit receive point configurations
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment may receive an indication of a set of corresponding physical downlink control channel (PDCCH) candidates that includes at least a first PDCCH candidate included in a first control resource set (CORESET) and a corresponding second PDCCH candidate included in a second CORESET, wherein the first CORESET and the second CORESET have different transmission configuration indication (TCI) states; and selectively perform, based at least in part on a configuration, at least one of: independent decoding of the first PDCCH candidate, independent decoding of the second PDCCH candidate, or joint decoding of the first PDCCH candidate and the second PDCCH candidate. Numerous other aspects are provided. |
US11057871B2 |
Frequency hopping in an uplink control channel
Methods, systems, and devices are described for wireless communications. A wireless device may receive an allocation of uplink resources for an uplink transmission of uplink control information (UCI) during a long physical uplink control channel (PUCCH), which may range from four to fourteen symbol periods in length. The wireless device may identify a frequency hopping location based on the length of the PUCCH and a number of bits used to represent the UCI. In some cases, the frequency hopping location partitions the long PUCCH into a first set of symbol periods and a second set of symbol periods. After identifying the frequency hopping location, the wireless device may transmit a UCI message, which may include information and reference symbols, over a first frequency bandwidth during the first set of symbol periods and over a second frequency bandwidth during the second set of symbol periods. |
US11057870B2 |
Method and apparatus for indicating time gap for device-to-device communication in a wireless communication system
A method and apparatus are disclosed from the perspective of a first User Equipment (UE). In one embodiment, the method includes the first UE being configured or pre-configured with a sidelink resource pool for sidelink transmission. The method also includes the first UE being triggered to select resources for a TB (Transport Block). The method further includes the first UE selecting a first resource for transmission of the TB. In addition, the method includes the first UE selecting a second resource for HARQ-ACK (Hybrid Automatic Repeat Request-Acknowledgement) based retransmission of the TB, wherein the second resource is later than the first resource, and a time gap between the first resource and the second resource is larger than or equal to a first time duration. Furthermore, the method includes the first UE transmitting a SCI (Sidelink Control Information) and the TB on the first resource in a slot to a second UE, wherein the SCI indicates the first resource and the second resource. |
US11057868B2 |
Method and apparatus for providing channel assignment information used to support uplink and downlink channels
A wireless transmit/receive unit (WTRU) receives radio resource assignment information over a physical downlink control channel. The WTRU determines whether the radio resource assignment information is intended for the WTRU based on WTRU identity-masked (ID-masked) cyclic redundancy check (CRC) bits. The WTRU determines whether the radio resource assignment information is for an uplink shared channel or a downlink shared channel. The WTRU utilizes the radio resource assignment information to transmit data over the uplink shared channel on a condition that the radio resource assignment information is determined to be for the uplink shared channel. The data is transmitted over the uplink shared channel a predetermined number of time slots after reception of the radio resource assignment information. |
US11057864B2 |
Paging method, device, and system
Embodiments of the present disclosure provide a paging method, a device, and a system, and relate to the communications field, so as to reduce signaling exchange performed when an access network device pages UE, save a network resource, and improve data transmission efficiency. The paging method includes: receiving, by user equipment (UE), paging information sent by an access network device, where the paging information is used to instruct the UE to send a paging response by using an uplink data sending resource; and obtaining, by the UE, the uplink data sending resource according to the paging information, and sending paging response information to the access network device by using the uplink data sending resource. |
US11057862B2 |
Wi-Fi radar detection using synchronized wireless access point
A Wireless Local-Area Network (WLAN) access point includes a WLAN transmitter, a WLAN receiver, and a processor. The WLAN transmitter is configured to transmit WLAN packets via one or more transmit antennas, and to send a timing-synchronization signal over an internal interface. The WLAN receiver is configured to receive, via one or more receive antennas, echo packets including reflections from an object of a selected subset of the WLAN packets transmitted by the WLAN transmitter, to receive the timing-synchronization signal from the WLAN transmitter over the internal interface, and to time-synchronize the echo packets and the corresponding WLAN packets using the timing-synchronization signal. The processor is configured to estimate one or more parameters of the object based on the time-synchronized echo packets and WLAN packets, and to output the estimated parameters to a user. |
US11057860B2 |
Network entities, a wireless communication system and a method for collecting data for multiple mobile network operators
A method for at least one service provider to collect wireless communication unit location related data for multiple mobile network operators, MNOs. The method comprises, at a base station supporting multiple MNOs: broadcasting on a first frequency only a first public land mobile network identifier, PLMN-ID, of a first MNO at a first instant in time for detection by first wireless communication units associated with the first MNO; receiving location related information from the first wireless communication units associated with the first MNO in response to the broadcast first PLMN-ID; broadcasting on a second frequency only a second PLMN-ID of a second MNO, at a second instant in time for detection by second wireless communication units associated with the second MNO; and receiving location related information from the second wireless communication units associated with the second MNO in response to the broadcast second PLMN-ID. |
US11057844B2 |
Technique for performing clear channel assessments in a wireless communication network
An aspect of the present disclosure is directed to a network node for performing communication in a wireless communication network. The network node is configured to receive a signal transmitted by a user device in the wireless communication network, measure a received power level at which the signal is received by the network node, determine, based on a predefined transmit power level of the network node, based on a predefined transmit power level of the user device and based on the received power level, a threshold power level for a clear channel assessment to be performed by the user device, and trigger transmitting an indication of the threshold power level to the user device. Further aspects of the disclosure pertain to a user device, methods and a computer program product. |
US11057842B2 |
Interference aware transmission power control method and device for IEEE 802.11 based wireless network with nodes having a directional antenna
The present disclosure relates to a transmission power control method and device capable of dynamically selecting optimal transmission power for the nodes in wireless network considering its surrounding interference. An embodiment comprises calculating a reduced transmitted power which will cause a corresponding reduced received power, such that: (a) transmitter interface and receiver interface can maintain connectivity of the active link with the reduced transmitted power, in the antenna direction between transmitter interface and receiver interface; (b) the reduced transmitted power does not create additional link-interference edges from any other active link, even if the transmission power of the other active link is maintained, in the antenna direction between the transmitting interface of the other active link and the receiver interface; and (c) the reduced transmitted power does not create additional hidden nodes, such that a CSRange of the reduced transmission power is still sufficient to inhibit transmission by any other interfering network node interface, in the antenna direction between said any other interfering network node and the receiver interface. |
US11057841B2 |
Method and apparatus for controlling ue transmission power in wireless communication system
The disclosure relates to a communication method and a system for converging a 5th-Generation (5G) communication system for supporting higher data rates beyond a 4th-Generation (4G) system with a technology for Internet of Things (IoT). The disclosure may be applied to intelligent services based on the 5G communication technology and the IoT-related technology, such as smart home, smart building, smart city, smart car, connected car, health care, digital education, smart retail, security and safety services. |
US11057838B2 |
Adapting output power of a radio transmitting entity
A method of adapting the output power of a radio transmitting entity within a cage having at least one aperture. The method includes the steps of providing at least one sensor operable to sense the condition of the at least one aperture and providing a controller to adjust the output power of the radio transmitting entity in accordance with the sensed condition of the at least one aperture. |
US11057830B2 |
Media access control for wakeup radios
Methods, systems, and devices for wireless communication are described. An access point (AP) may identify a jitter pattern for a wakeup message. A station may listen using a wakeup radio for a wakeup message during wakeup listening periods according to the identified jitter pattern. A station may receive a preamble having a first bandwidth and a wakeup message having a second bandwidth. An AP may transmit an identifier key to a station, and the station may determine a rotating identifier associated with the AP based on the received identifier key. The station may receive a wakeup message from the AP, compare a sender identifier with the rotating identifier, and power on a second radio. A station may also receive a wakeup message that includes an indication of which station are to be activated. |
US11057829B2 |
Power saving for non-trigger-based ranging
Methods for performing a ranging procedure according to the non-trigger-based protocol may include negotiating timing parameters associated with the ranging procedure, performing a ranging measurement, and transmitting/receiving, after completion of the ranging measurement, a message announcing initiation of another ranging measurement. The timing parameters may indicate a time window in which an initiating device can initiate a subsequent ranging measurement and the message announcing initiation of the second ranging measurement may be received during the time range specified. Timing parameters may indicate a responding device's required minimum and maximum time between ranging measurements. Additional parameters may indicate an initiating device's required minimum and maximum time between ranging measurements. A power savings mode may be entered after the first ranging measurement and during at least a portion of a time period specified by the parameters. |
US11057823B2 |
Distribution of system access information in wireless communication system
The present disclosure relates to methods for efficiently transmitting system access information that is used by wireless terminals (200) to access a cell (20) in a wireless communication network (10). The system access information may include synchronization signals, system information, or reference signals used for channel estimation. In exemplary embodiments of the disclosure, the access nodes (100) within the wireless communication network (10) may be configured to operate in two or more operating modes. The information density of the system access information transmitted by the access node varies depending on the operating mode. For example, the access node (100) may vary the information density by varying the amount of system access information that is transmitted or the periodicity of the system access information that is transmitted. |
US11057822B2 |
Electronic apparatus, wireless communication method, and computer program product
According to an embodiment, an electronic apparatus includes communication circuitry and processing circuitry. The communication circuitry is configured to transmit a first packet to a first next hop and transmit a second packet to a second next hop in accordance with communication control information. The processing circuitry is configured to measure first information on the first packet transmitted to the first next hop, measure second information on the second packet transmitted to the second next hop, determine whether to change the communication control information based on both the first information and the second information, and change the communication control information if it is determined to change the communication control information. |
US11057820B2 |
Dynamic mapping of nodes responsible for monitoring traffic of an evolved packet core
Introduced here are visibility platforms able to process the traffic handled by the gateways of an Evolved Packet Core (EPC) with Control and User Plane Separation (CUPS). A visibility platform can include a control processing node (CPN) and one or more user processing nodes (UPNs). The visibility platform may populate a data structure in which the CPN and UPNs are associated with locations along an interface on which Sx/N4 traffic is exchanged between the control and user planes. Each location may be representative of the point on the Sx/N4 interface at which Sx/N4 traffic processed by the corresponding node is acquired. The CPN can use the data structure to program session flows that impact how user traffic is handled by the UPNs. |
US11057816B2 |
System and method for interference management in cellular networks
Notifying served user equipments (UEs) of the presence or absence of cell-specific reference signal (CRS) symbols transmitted by neighboring base stations in the physical downlink shared channel (PDSCH) region of a subframe can be achieved through various of signaling techniques. The served UE may be notified by communicating a one or multi-bit indicator in a physical layer signaling channel of the serving cell, such as the physical downlink control channel (PDCCH) of the subframe. Alternatively, the served UE may be notified through higher layer signaling. |
US11057813B2 |
Method and apparatus for transmitting downlink data
The present application discloses a method and an apparatus for transmitting downlink data, to resolve the issue of erroneous transmission of downlink data of UE when the UE moves from an EPS network to a 5G network. The method comprises: after receiving a request message for updating a session management context of the UE, a session management function entity in embodiments of the present application determining that the UE has moved from a first network to a second network; the session management function entity notifying a user plane function entity to delete a user plane connection of the UE in the first network, and creating a user plane connection of the UE in the second network, such that the user plane function entity transmits downlink data of the UE through the newly created user plane connection. |
US11057808B2 |
Method and device for managing Pcell or PScell
The present application discloses a method and a device for managing a Pcell or a PScell, used to resolve the technical issue in the prior art of a lack of effective management in switching of a Pcell or a PScell in CU-DU architecture, and provides a timely and efficient strategy for switching a PScell, so as to improve communication system resource utilization efficiency. The method comprises: a CU determining a Pcell or a PScell of a UE; and the CU transmitting a Pcell/PScell change message to a DU, wherein the Pcell/PScell change message comprises a cell identifier of the cell required to be switched to the Pcell or the PScell, and the CU and the DU jointly serving the UE. |
US11057804B2 |
Method and device for adjusting random access backoff parameter
Provided are a method for a terminal adjusting a random access backoff parameter in a wireless communication system, and a device supporting same. The method may comprise the steps of: receiving priority information; initiating a random access procedure while executing a handover; receiving, from a base station, a random access response including a backoff indicator; and on the basis of the priority information, adjusting a random access backoff parameter indicated by the backoff indicator. |
US11057803B2 |
Method and device of handling mobility to a NR standalone network
A communication device for transmitting capabilities for mobility to a network supporting a standalone mode of a first radio access technology (RAT), comprises at least one storage device; and at least one processing circuit, coupled to the at least one storage device. The at least one storage device stores, and the at least one processing circuit is configured to execute instructions of: the communication device transmitting a first capability of the first RAT and a second capability of the first RAT to a first base station (BS) of a second RAT via the second RAT, wherein the first capability indicates a support of a standalone mode of the first RAT and the second capability indicates a plurality of supported bands of the first RAT. |
US11057799B2 |
Devices and methods for slice-compliant handover control
A network entity is configured to control a handover of a user equipment from a serving base station to a candidate target base station of a mobile communication network. The serving base station provides at least a first slice of a first slice type, and the candidate target base station provides at least a second slice of a second slice type. The user equipment is registered to the first slice of the serving base station. The network entity includes a processor configured to control, in response to a handover trigger, the handover of the user equipment on the basis of a requested slice type and the second slice type provided by the candidate target base station. |
US11057797B2 |
Method and device for processing information
A method for processing information and a device for processing information are provided. The method for processing information is applied to a first node. The method includes: receiving, by the first node, an indication message from a network side, wherein the indication message indicates a user equipment under the first node to hand over to a second node; and negotiating, by the first node, with the second node to reserve radio link layer control protocol (RLC) status information and cached data of all bearers of the user equipment, so that the second node provides a continuing data service to the user equipment based on the reserved information. |
US11057795B2 |
Transmission rate control method and apparatus
Example transmission rate control methods and apparatus are described. One example method includes obtaining a user equipment aggregate maximum bit rate (UE-AMBR) by a master base station. The master base station determines, based on the UE-AMBR, a first UE-AMBR used for the master base station and a second UE-AMBR used for a secondary base station. The master base station sends the second UE-AMBR to the secondary base station, and sends instruction information used to instruct the secondary base station to control data splitting for the master base station to the secondary base station. In this application, a transmission rate between each base station and a UE is controlled by allocating a UE-AMBR. |
US11057794B2 |
Redundancy version indication in fifth generation (5G) or other next generation communication systems
An adaptive downlink control channel structure is utilized for control channel transmission for 5G and other next generation wireless systems. Moreover, the adaptive downlink control channel structure can utilize a reduced length/size to decrease signaling overhead for each transport block. In an aspect, a first downlink control channel structure for a data transmission can be utilized to implicitly indicate redundancy version (RV) and a second downlink control channel structure for a subsequent data transmission can be utilized to explicitly indicate the RV. In another aspect, the RV can be indicative via an adaptive bit load. Further, in yet another aspect, the RV can be indicated based on a joint encoding of RV and new data indicator (NDI) information. |
US11057789B2 |
Methods for measurement reporting, a user equipment and network nodes
Embodiments of the present disclosure relate to methods and network nodes and user equipment for measurement reporting. In example embodiments, a method implemented in a user equipment is provided. According to the method, the user equipment detects a plurality of beams from one or more of the UE's neighboring nodes, forms one measurement result of a group based on beam grouping information, and then send measurement report to the UE's serving node, including the measurement result of the group is included in the measurement report. According to the present disclosure, more neighboring nodes can be reported by the UE in a measurement report. |
US11057788B2 |
Method and system for abnormal value detection in LTE network
A method and system for detecting abnormal values in an LTE network is provided: dividing measured data into a training and a testing set; defining clusters and parameters in the training set, and finding the cluster to which each point belongs using clustering algorithms; calculating a likelihood of each point based on parameters and clustering results; assigning the likelihood into an abnormal, an intermediate or a normal region according to a set warning and alarming threshold; and applying a calculated model to the testing set, the likelihood of each point is calculated and assigned to a region, thereby finding abnormal values in the testing set. The variation of data points versus time may be better understood by introducing time axes into the model, thereby multiple abnormal values may be discovered from a sequence of multiple points. The method can immediately detect abnormal values and the error rate is low. |
US11057784B2 |
Communication system with accelerated data exchange
A data communication system able to provide a speedy response to a user equipment transmitting data includes a base station and a data center. The base station is disposed adjacent to the data center, the base station is coupled between the data center and the user equipment, and the base station transmits data provided by the user equipment to the data center. The data center processes first data from the user equipment, and transmits a second data to the user equipment through the base station. Therefore, the data transmission time between the data center and the user equipment is shortened, and the data can be quickly fed back to the user equipment. |
US11057780B2 |
Channel utilization in unlicensed spectrum
In an aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus may be a UE. The UE receives, from a base station, one or more downlink reference signals on an unlicensed carrier. The UE determines that the base station occupies the unlicensed carrier for a predetermined first channel occupancy time based on the one or more downlink reference signals. The UE receives, on the unlicensed carrier and in the predetermined first channel occupancy time, a control burst including a plurality of down link control channels. The UE attempts to decode a first down link control channel directed to the UE from the control burst. |
US11057778B2 |
Complex composite tokens
Technologies are shown for trust delegation that involve receiving a first request from a subject client and responding by sending a first token having first permissions to the subject client. A second request from a first actor includes the first token and responding involves linking the first actor to the subject client in a trust stack and sending a second token to the first actor with second permissions, the second token being a first complex token that identifies the subject client and the first actor. A third request from a second actor includes the second token and responding to the third request involves linking the second actor to the first actor in the trust stack, and sending a third token to the second actor partner with third permissions, the third token being a second complex token that identifies the first actor and the second actor. |
US11057777B2 |
Distance based session roaming
Typically, when a user switches sessions between devices, the user authenticates the sessions by providing user account information, password, and/or pin code input or other credentials. However, when the user is frequently switching sessions between devices, authenticating sessions may result in the user reducing or even stopping switching across mobile devices. Systems and methods according to this disclosure provide automatic session roaming across mobile devices using proximity authentication. Upon detecting an indication to initiate session roaming, the source device automatically roams the session on the source device to a target device based on a proximity of the source device to the target device. The session is handed off from the source device to the target device as an authenticated user session. |
US11057769B2 |
Detecting unauthorized access to a wireless network
Systems and methods detect a potential hacking attack by monitoring the number and timing of DELBA (Delete Block Acknowledgement) action frames. When the number and timing of the DELBA action frames correspond to an unauthorized access pattern, an unauthorized access is detected. The potential unauthorized access may be detected by an access point (AP) or by the AP and a backend system. When a potential unauthorized access is detected, the AP may remain in silent mode for a longer period of time and limit access to the network to only trusted devices. In addition, an alarm or other notification of the potential unauthorized access may be provided to a user or other designated contact. |
US11057764B2 |
Communication device, communication method, communication system, and storage medium
A communication device for offloading communication traffic includes: first means for identifying an attribute of a terminal based on information included in a message transmitted by the terminal to connect to a wireless network; and second means for determining whether or not to connect a base station that has received the message from the terminal and the terminal based on the identified attribute, wherein the second means is capable of transmitting the message transmitted by the terminal having a predetermined attribute to a virtual network node operated by a virtual machine. |
US11057761B2 |
Cloud SIM card management server, binding device, management method, binding method and system
The present disclosure provides a SIM card management server, a binding device, a management method, a binding method and a binding system. By allocating a cloud SIM card and the network access information to an intelligent terminal of a user, so that the network access information of the original SIM card is replaced to acquire service from a carrier's network, and resource is conserved, the user is facilitated in flexibly replacing a cloud SIM card to access a network, and a system management of cloud SIM card is facilitated. |
US11057760B2 |
Methods and entities for ending a subscription
A method (30) of ending a subscription performed in a network entity (20) is disclosed. The method (30) comprises receiving (33), from a device (10) comprising an Embedded Universal Integrated Circuit Card, eUICC, (14), a signed confirmation of a profile having been deleted in the device (10), the profile being associated with a subscription for the device (10); sending (34), to a Subscription Manager Data Preparation entity (19), a command for deletion of the profile; and deleting (35) the user subscription and related profile in case an acknowledgement of the deletion of the profile is received from the Subscription Manager Data Preparation entity (19). Method (60) in a device (10), method (90) in a Subscription Manager Data Preparation entity, devices and entities, computer programs and computer program products are also provided. |
US11057757B2 |
Techniques for providing subscriber-specific routing of a roaming user equipment in a visited communication network
A method for initiating a roaming communication link with a user equipment in a visited communication network comprises: transmitting a registration request by the UE to a network entity of the visited communication network; detecting by the network entity of the visited communication network that the registration request is related to a roaming communication with the UE; determining by the network entity of the visited communication network a home communication network of the UE; retrieving, by the network entity of the visited communication network, subscriber-specific data of the UE from a routing data layer entity of the visited communication network for roaming the UE in the visited communication network, wherein the RDL entity is coupled to the home communication network of the UE via a data base interface; and initiating the roaming communication link with the UE based on the subscriber-specific data of the UE received via the RDL entity. |
US11057754B2 |
Method for operating a wireless communication device
The present invention relates to a method for operating a wireless communication device in a cellular network, the wireless communication device comprising a communication unit and a controlling appliance, interconnected by a control interface, the communication unit comprising a network access manager unit, the method comprising for the communication unit the steps of: —receiving from the cellular network a network access guidance —handling the received network access guidance at the network access manager unit, —as part of handling the network access guidance, interpreting the received network access guidance and providing information relating to the network access guidance resulting from said interpretation step to the controlling appliance, —ascertaining by means of the control interface from the controlling appliance a response relating to said network access guidance, —handling in the network access manager unit the response relating to said network access guidance. |
US11057751B1 |
User identification system using directional antennas and cameras
A facility may include antennas directed to a known location and cameras with a field-of-view that encompasses the known location. The antennas acquire a device identifier and device data from a mobile device carried by a user at the known location. Antenna data is then generated to describe the data acquired by the antennas. Image data is also generated from the cameras to include images of a person at the known location. The antenna data and image data are then processed to determine estimated motion values and a comparison of such values is performed to check if such motion values are within a threshold of one another. If the motion values are within a threshold of each other, data indicative of presence of the mobile device at the known location is generated. |
US11057749B2 |
Method and apparatus for providing message service in mobile communication system
The present disclosure provides a short message service (SMS) in a mobile communication system, to thus guarantee continuity of the SMS service. According to an embodiment of the present disclosure, an operating method of a control node for providing a message service in a mobile communication system includes receiving a message from a user equipment (UE) or a message delivery center, determining an active or inactive state of the message service using a first interface, and if the message service using the first interface is disabled, transmitting detach request information for re-attach of the UE to the UE. |
US11057748B1 |
Prioritized communication windows in a wireless mesh network
A wireless network may include a server, a network, a network access device and a plurality of nodes configured to communicate wirelessly. Messages may be communicated through the network wirelessly in an uncoordinated manner. Some nodes may be assigned a first priority indicating that the node has a higher priority than other nodes assigned a second priority. During a certain time period or window, referred to as a “quality of service window,” nodes assigned the first priority may continue transmitting in the uncoordinated manner, while nodes associated with the second priority may wait to transmit their messages until after the expiration of the quality of service window. Thus, during the quality of service window, there should be less congestion since nodes assigned the second priority remain quiet, thereby increasing the likelihood that messages transmitted by the nodes assigned the first priority will be successfully communicated. |
US11057747B2 |
Providing data file updates using multimedia broadcast multicast services
A method is provided for providing application data. The method includes a network node receiving at least one application identifier (App-ID) associated with at least a first user equipment (UE) and a second UE; the network node requesting to receive notifications of updates to application data associated with the at least one App-ID; the network node configuring a broadcast entity to transmit application data associated with the at least one App-ID; and the network node sending configuration data to the first and second UEs for receiving application data from the broadcast entity. |
US11057745B2 |
Data transmission method and related apparatus
A data transmission method and a related apparatus are disclosed. The method is performed by a local MBMS functional entity, and includes obtaining local MBMS bearer information by using an interface between the local MBMS functional entity and an MBMS functional entity in a core network, after receiving application layer data sent by a local application server, determining a local MBMS bearer information matching the application layer data, and sending the application layer data based on the local MBMS bearer information matching the application layer data. |
US11057744B2 |
Geolocationing system, personal locator device, and method for use of same
A geolocationing system, personal locator device, and method for providing awareness in a multi-space environment, such as a hospitality environment or educational environment, are presented. In one embodiment, a personal locator device includes a first operational mode that determines an estimated location of the personal locator device by communicating with a server via an array of gateway devices defining an area of coverage. The personal locator device also has a second operational mode that determines the estimated location of the personal locator device by communicating with a server via a proximate wireless-enabled interactive programmable device. The second operational mode may be utilized when the personal locator device is out of the area of coverage. |
US11057743B2 |
Many to many ranging techniques
A mobile device can include ranging circuitry to determine distance to another mobile device. Ranging between multiple mobile devices can present challenges due to clock drift between the devices resulting in missed messages due to collisions between ranging messages. Techniques can be implemented to reduce the number of collisions by designating time slots for ranging sessions based on timing from a coordinator mobile device. Alternative techniques allow for splitting up channels at different time amount different pairs of devices. The ranging techniques can be used to share information between devices with a predefined distance for applications such as augmented reality. |
US11057734B2 |
Geospecific information system and method
A method, computer program product, and computing system for receiving a request for information, concerning a geographically-proximate entity, on a consumer electronic device included within a vehicle. A location of the vehicle is determined; and the geographically-proximate entity is identified based, at least in part, upon the location of the vehicle. |
US11057732B2 |
Wireless home phone configured for receiving emergency alerts
A wireless telephone base station for a telephone includes a transceiver configured to receive emergency alerts, a display configured to show the emergency alerts, an output device configured to play the emergency alerts, and a processor configured to show the emergency alerts on the display and to play the emergency alerts on the output device. |
US11057729B2 |
Communication device with position-dependent spatial source generation, communication system, and related method
A communication device includes a processor; a radio interface for connection to a radio unit; and an output interface; wherein the processor is configured to: obtain a first position signal indicative of first position of a first source; obtain a user position signal indicative of position of the user; obtain a direction signal indicative of a head direction of the user; determine a first angle between the head direction and a first direction from the user to the first source; determine a first filter function based on the first angle; apply the first filter function to a first audio signal for provision of a first left output signal and a first right output signal; and output a left signal and a right signal, wherein the left signal is based on the first left output signal, and wherein the right signal is based on the first right output signal. |
US11057723B2 |
Hearing aid antenna for high-frequency data communication
Hearing aids having example antennas tuned to transmit and receive signals having a frequency greater than or equal to 2.4 GHz are described. The antenna includes a first segment and a second segment. The first segment is configured to fit inside a housing of the hearing aid and to be within the ear canal when the hearing aid is inserted into an ear of a wearer. The second segment is configured to be within the housing and disposed near a side of the housing facing toward an outside of the ear canal when the hearing aid is inserted into the ear of the wearer. |