Document Document Title
US09315932B2 Sewing machine and non-transitory computer-readable medium storing sewing machine control program
A sewing machine includes at least one ultrasonic wave detecting portion, a thickness detecting portion, a processor, and a memory. The at least one ultrasonic wave detecting portion is configured to detect an ultrasonic wave. The thickness detecting portion is configured to detect a thickness of a work cloth. The memory configured to store computer-readable instructions that instruct the sewing machine to execute steps that includes identifying a position, on the work cloth, of a transmission source of the ultrasonic wave, based on information pertaining to the ultrasonic wave that has been detected by the at least one ultrasonic wave detecting portion and on the thickness that has been detected by the thickness detecting portion, and controlling sewing on the work cloth based on the position of the transmission source that has been identified.
US09315929B2 Non-wovens with high interfacial pore size and method of making same
A Nonwoven fibrous structures with a high interfacial pore size and substrates made therefrom are provided. The substrates may be used, for example, in wipes. In one embodiment, the wipes include a hydromolded pattern on one side. The hydromolded pattern has an average pore-size of the interface between two stacked wipes that is greater than 180 microns in radius. In addition, a method for manufacturing nonwoven fibrous structures with high interfacial pore size is also provided.
US09315927B2 Method for producing a solid part
A method for producing a solid part, including weaving a three-dimensional fibrous structure, the weaving being carried out with metal braids consisting of a plurality of metal strands mutually twisted about the longitudinal axis of the braid; and performing hot isostatic pressing on the fibrous structure causing the agglomeration of the metal braids of the fibrous structure so as to produce a solid part.
US09315924B2 Methods of making and using elastic fiber containing an anti-tack additive
Methods of making and using anti-tack additives for elastic fibers are disclosed. The elastic fibers include CE additive.
US09315918B2 Crystalline silicon ingot and method of fabricating the same
A crystalline silicon ingot and a method of fabricating the same are disclosed. The crystalline silicon ingot of the invention includes multiple silicon crystal grains growing in a vertical direction of the crystalline silicon ingot. The crystalline silicon ingot has a bottom with a silicon crystal grain having a first average crystal grain size of less than about 12 mm. The crystalline silicon ingot has an upper portion, which is about 250 mm away from said bottom, with a silicon crystal grain having a second average crystal grain size of greater than about 14 mm.
US09315917B2 Apparatus and method for the production of ingots
Apparatus and method for a crucible-less production of silicon ingots, wherein a support with a seed layer and a liquid layer is gradually lowered in a temperature field with a vertical gradient to solidify the liquid layer in a controlled way.
US09315914B2 Light metal production
An electrochemical process for the production of light metals, particularly aluminum. Such a process involves contacting a light metal source material with an inorganic acid to form a solution containing the light metal ions in high concentration. The solution is fed to an electrochemical reactor assembly having an anode side containing an anode and a cathode side containing a cathode, with anode side and the cathode side separated by a bipolar membrane, with the solution being fed to the anode side. Light metal ions are electrochemically transferred through the bipolar membrane to the cathode side. The process further involves reducing the light metal ions to light metal powder. An associated processing system is also provided.
US09315906B2 Anode, corrosion-protecting structure for concrete constructions using this, and corrosion protection method
To provide an anode, corrosion-protecting structure of a concrete constructions using this, and a corrosion protection method capable of protecting electrical corrosion, with little generation of gas due to electrolysis of water or chlorine compounds, by decreasing as far as possible the amount of processing performed on the structural body in on-site construction work and suppressing the voltage that is conducted therethrough to a low level. [Solution] A corrosion-protecting structure (1) is constituted by attaching an anode (10) to the surface layer (3) of a corrosion-protecting body (4) through a first electrolyte layer (12) on one face of a conductive layer (11) formed as a sheet. The electrolyte is formed as a sheet. The first electrolyte layer (12) having adhesiveness is attached to the conductive layer (11) and the surface layer (3) of the corrosion-protecting body (4).
US09315903B2 Laser microcladding using powdered flux and metal
A laser microcladding process utilizing powdered flux material (93b). A jet (92) of propellant gas containing powdered alloy material (93a) and the powdered flux material are directed toward a substrate (94). The powdered materials are melted by a laser beam (96) to form a weld pool (98) which separates into a layer of slag (100) covering a layer of clad alloy material (102). The flux material deoxidizes the weld pool and protects the layer of clad alloy material as it cools, thereby allowing the propellant gas to be nitrogen or air rather than an inert gas. In one embodiment, the substrate and alloy materials are superalloys with compositions beyond the traditional zone of weldability.
US09315901B2 Method for the production of layers containing indium oxide
The present invention relates to a liquid phase process for producing indium oxide-containing layers from nonaqueous solution, in which an anhydrous composition containing at least one indium oxo alkoxide of the generic formula MxOy(OR)z[O(R′O)cH]aXb[R″OH]d where x=3-25, y=1-10, z=3-50, a=0-25, b=0-20, c=0-1, d=0-25, M=In, R, R′, R″=organic radical, X=F, Cl, Br, I and at least one solvent are applied to a substrate, optionally dried, and converted to an indium oxide-containing layer, to the layers producible by the process according to the invention and to the use thereof.
US09315898B2 TEM sample preparation method
A TEM sample preparation method including: placing a thin sample on a sample holder so that a first side surface of the thin sample which is closer to a desired observation target is opposed to a focused ion beam column; setting a processing region, which is to be subjected to etching processing by a focused ion beam so as to form a thin film portion including the observation target and having a thickness direction substantially parallel to a thickness direction of the thin sample, to a region of the first side surface that is adjacent to the thin film portion; and performing the etching processing to a portion of the thin sample extending from the first side surface thereof to a front surface thereof by irradiating the processing region with the focused ion beam from the focused ion beam column.
US09315896B2 Synthesis and use of precursors for ALD of group VA element containing thin films
Atomic layer deposition (ALD) processes for forming Group VA element containing thin films, such as Sb, Sb—Te, Ge—Sb and Ge—Sb—Te thin films are provided, along with related compositions and structures. Sb precursors of the formula Sb(SiR1R2R3)3 are preferably used, wherein R1, R2, and R3 are alkyl groups. As, Bi and P precursors are also described. Methods are also provided for synthesizing these Sb precursors. Methods are also provided for using the Sb thin films in phase change memory devices.
US09315895B2 Apparatus for producing polycrystalline silicon
An apparatus for producing polycrystalline silicon having: a bell jar having a circumferential wall forming a chamber of a reactor and a jacket covering a circumferential wall, and in which a cooling path formed between the circumferential wall and the jacket that allows cooling medium including water to flow therethrough; a coolant feeding system which is connected to the bell jar so as to feed the cooling medium to the cooling path; a coolant recovering system which is connected to the bell jar so as to recover the cooling medium from the cooling path; a pressure control part controlling a pressure in the cooling path; and a flow-rate control part controlling a flow rate of the cooling medium, wherein the cooling medium flows in the cooling path as boiling two-phase flow by controlling the pressure and flow rate of the cooling medium.
US09315893B2 Vapor deposition device
A vapor deposition device has a plurality of moving plates between the cooling plate and moving vapor deposition source is controlled by the blowout panel. Moreover, when the vapor deposition materials absorbed by the blowout panel are up to the predetermined value, the moving plates are rotated around their axis simultaneously by the linkage to form a new blowout panel for performing the subsequent vapor deposition process. Consequently, the adsorption ability of the blowout board is greatly improved, and the crack and peeling off of the blowout panel caused by absorbing too many vapor deposition materials are avoided. Hence, the volume production of the evaporative coating equipment is improved.
US09315892B2 Method and apparatus for controlling beam angle during ion implantation of a semiconductor wafer based upon pressure
One or more techniques or systems for ion implantation are provided herein. A pressure control module is configured to maintain a substantially constant pressure within an ion implantation or process chamber. Pressure is maintained based on an attribute of an implant layer, pressure data, feedback, photo resist (PR) outgassing, a PR coating rate, a space charge effect associated with the implant layer, etc. By maintaining pressure within the process chamber, effects associated with PR outgassing are mitigated, thereby mitigating neutralization of ions. By maintaining charged ions, better control over implantation of the ions is achieved, thus allowing ions to be implanted at a desired depth.
US09315890B1 System and method for volatilizing organic compounds
An electronic device for volatilizing organic matter is described. The electronic device includes a housing, a removable transparent tube, a heating element, a setting profile, a memory and a processor. The removable transparent tube has a chamber distal end within the housing. The heating element is proximate to the chamber distal end of the transparent tube. The chamber distal end holds vaporizable organic matter. The settings profile includes a first wattage setting and a first timer setting for the heating element and the heating element vaporizes the vaporizable material. The memory stores the settings profile. The processor is operatively coupled to the memory module and controls the heating element according to the settings profile.
US09315889B2 Hydride assembling system and method of making a hydride batch
A hydride assembling system includes a first spool configured to support a sensor tube assembly comprising a wire disposed within a sensor tube. Also included is a hydrogen inlet fluidly coupled to the first spool for providing hydrogen from a hydrogen plenum. Further included is a second spool configured to receive the sensor tube assembly as the sensor tube assembly is fed from the first spool. Yet further included is a heated section at a temperature above an ambient temperature and configured to heat the sensor tube assembly as the sensor tube assembly is fed through the heated section.
US09315885B2 Heat treatable aluminum alloys having magnesium and zinc and methods for producing the same
New heat treatable aluminum alloys having magnesium and zinc are disclosed. The new aluminum alloys generally contain 3.0-6.0 wt. % Mg, 2.5-5.0 wt. % Zn, where (wt. % Mg)/(wt. % Zn) is from 0.60 to 2.40.
US09315883B2 High strength and low density particle-reinforced steel with improved E-modulus and method for producing said steel
A particle-reinforced high strength and low density steel with improved E-modulus and method for producing the steel.
US09315878B2 System and method for iron ore byproduct processing
Processing byproduct material from a direct reduction process of iron ore to reclaim iron and other materials from the byproduct. The systems and methods employ gravity separation tables to separate the iron from other byproduct material constituents. The byproduct material constituents may be size reduced, processed to remove dust, and sized prior to processing by the gravity separation.
US09315874B2 Bacillus subtilis mutant strain and a fermentation method for producing acetoin using this organism
The present invention provides a mutant strain of Bacillus subtilis SFA-H31 and includes an optimized method for producing of acetoin using this strain. The advantage of this method to produce acetoin has been defined by its high-yield without mixture with diacetyl or 2,3-butanediol, both of which are usually accompanied with acetoin in other strain. This Bacillus subtilis mutant strain has been deposited in China General Microbiological Culture Collection (CGMCC) and the accession number is CGMCC No. 1869, in which the process of fermentation for acetoin production is composed of (1) strain activation, (2) seed culture, (3) fermentation, (4) quantification of substrates and products. Based on current method, the concentration of acetoin in the ferment broth can reach to 35-55 g/L and the conversion rate of glucose to acetoin is in the range of 40-50%.
US09315873B2 Marker vaccine for classical swine fever
The invention relates to a marker vaccine for prophylactic treatment of classical swine fever comprising modified live attenuated classical swine fever virus. The viral amino acid sequence of the TAV-epitope of the E2 protein comprises a different sequence from that of a wild-type classical swine fever virus. The invention relates to pharmaceutical compositions of the marker vaccine. The invention also relates to a method of manufacturing marker vaccines for prevention of classical swine fever using selective antibody pressure.
US09315857B2 Digital counting of individual molecules by stochastic attachment of diverse label-tags
Compositions, methods and kits are disclosed for high-sensitivity counting of individual molecules by stochastic labeling of a identical molecules in mixtures of molecules by attachment of a unique label-tags from a diverse pool of label tags to confer uniqueness to otherwise identical or indistinguishable events. Individual occurrences of target molecules randomly choose from a non-depleting reservoir of diverse label-tags. Labeled molecules may be detected by hybridization or sequencing based methods. Molecules that would otherwise be identical in information content are labeled to create a separately detectable product that can be distinctly detected. The disclosed stochastic transformation methods reduce the problem of counting molecules from one of locating and identifying identical molecules to a series of binary digital questions detecting whether preprogrammed label-tags are present. The methods may be used, for example, to count a given species of molecule within a sample.
US09315846B2 Fluidic channel based on a filtered, free-space electromagnetic wave source
A fluid-channeling device comprising: a fluid source; and a beam generator configured to generate a collimated vortex beam, wherein the beam generator is operatively coupled to the fluid source such that fluid from the fluid source may be introduced into a vortex of the collimated vortex beam, and wherein the collimated vortex beam is tuned such that when the fluid is in the vortex the fluid interacts with the collimated vortex beam to create an insulating pseudo-wall between the collimated vortex beam and the fluid such that the fluid is suspended in, and capable of traveling through, the vortex.
US09315843B2 Methods of producing hybrid antibodies
A method for engineering and utilizing large DNA vectors to target, via homologous recombination, and modify, in any desirable fashion, endogenous genes and chromosomal loci in eukaryotic cells. These large DNA targeting vectors for eukaryotic cells, termed LTVECs, are derived from fragments of cloned genomic DNA larger than those typically used by other approaches intended to perform homologous targeting in eukaryotic cells. Also provided is a rapid and convenient method of detecting eukaryotic cells in which the LTVEC has correctly targeted and modified the desired endogenous gene(s) or chromosomal locus (loci) as well as the use of these cells to generate organisms bearing the genetic modification.
US09315842B2 Helicase dependent amplification of DNA molecules using nucleotide analogs
This invention covers processes for the isothermal amplification of DNA molecules having a preselected sequence. It is based on the unexpected discovery that primers having, at some positions, adenine substituted by 2-aminopurine or diaminopurine, guanine by inosine, thymine by 2-thiothymine, and cytosine by N4-ethylcytosine (“SAMRS nucleotides”) were accepted by enzymes used in the standard helicase-dependent amplification (HDA). Further unexpected was the discovery that target nucleotides are efficiently amplified in an HDA-like process (hereinafter abbreviated as simply HDA) using substituted primers. Also discovered was the diminution of spurious products through the use of SAMRS-substituted primers.
US09315839B2 Processes for producing coenzyme Q10
The present invention relates to a process for producing reduced coenzyme Q10 which comprises obtaining microbial cells containing reduced coenzyme Q10 at a ratio of not less than 70 mole % among the entire coenzymes Q10, optionally disrupting the cells and recovering thus produced reduced coenzyme Q10. The present invention also relates to a process for producing oxidized coenzyme Q10 which comprises either recovering oxidized coenzyme Q10 after oxidizing the above-mentioned microbial cells or disrupted product thereof, or recovering reduced coenzyme Q10 from the above-mentioned microbial cells or disrupted product thereof to oxidize thus-obtained reduced coenzyme Q10 thereafter. According to the processes of the present invention, reduced coenzyme Q10 and oxidized coenzyme Q10 can be produced simply on the industrial scale.
US09315836B2 Fatty acid desaturase used in the biosynthesis of long chain omega-3 polyunsaturated fatty acids
The present invention provides novel fatty acid desaturases genes used for synthesis of polyunsaturated fatty acids, especially ω3 desaturases (FADS15). The present invention also provides nucleic acid sequence coding the above-described desaturases, expression vector of the above-described desaturases and recombinant microorganism expressing above-described desaturases.
US09315835B2 Lysophospholipid acyltransferase
The present invention provides novel lysophospholipid acyltransferases. The object of the present invention is attained by the nucleotide sequences of SEQ ID NOs: 1 and 6 and the amino acid sequences of SEQ ID NOs: 2 and 7 of the present invention.
US09315834B2 Manufacture of xylonic acid
Provided is a method for producing xylonic acid from xylose with a recombinant fungal strain that is genetically modified to express a xylose dehydrogenase gene, which is able to convert xylose to xylonolactone, which is spontaneously or enzymatically hydrolyzed to xylonic acid. The xylonic acid is excreted outside the host cell. Xylonate production may be coupled with xylitol production. Alternatively, if xylitol production is not desired, its production is reduced by removing the aldose reductase (or specific xylose reductase) enzyme, which converts xylose to xylitol. Expression of a heterologous lactonase encoding gene may result in higher acid concentrations. The method is suitable for producing xylonic acid from a hemicellulose hydrolysate such as hydrolyzed lignocellulosic plant biomass.
US09315832B2 Cyanobacterium sp. host cell and vector for production of chemical compounds in Cyanobacterial cultures
A cyanobacterial host cell, Cyanobacterium sp., that harbors at least one recombinant gene for the production of a chemical compounds is provided, as well as vectors derived from an endogenous plasmid isolated from the cell.
US09315831B2 Direct starch to fermentable sugar as feedstock for the production of isoprene, isoprenoid precursor molecules, and/or isoprenoids
Provided herein are compositions and methods related to the direct conversion of the starch in a ground or fractionated grain into a fermentable sugar feedstock capable of serving as a carbon source for the industrial production of one or more products by a fermenting organism, such as isoprene, isoprenoid precursor molecules, and/or isoprenoids. Such conversions may be performed at temperatures at or below the initial gelatinization temperature of the starch present in the grain and may utilize one or more isolatable endogenous enzymes present in certain unrefined grains.
US09315828B2 Prompt nucleic acid delivery carrier composition
An object of the present invention is to provide a carrier composition for nucleic acid delivery, which can efficiently deliver a nucleic acid into cells when a nucleic acid such as siRNA is administered to animal-derived cells or animals, and also has low toxicity and high safety, and a composition for nucleic acid delivery containing the carrier composition and nucleic acid.A carrier for nucleic acid delivery is prepared by using (A) a diacylphosphatidylcholine, (B) at least one member selected from the group consisting of cholesterol and derivatives thereof, and (C) an aliphatic primary amine. Also, a composition for nucleic acid delivery is prepared by mixing the carrier for nucleic acid delivery with a nucleic acid.
US09315813B2 Compositions and methods for inhibition of expression of apolipoprotein C-III (APOC3) genes
The invention relates to double-stranded ribonucleic acid (dsRNA) targeting an APOC3 gene, and methods of using the dsRNA to inhibit expression of APOC3.
US09315812B2 Methods of using microRNA 195 in providing neuroprotection
The invention relates to a method for providing neuroprotection comprising administering to a subject an effective amount of a miRNA or a variant thereof. By providing neuroprotection, stroke or ischemic stroke can be prevented and/or treated.
US09315810B2 Oligonucleotide derivative, oligonucleotide derivative-containing pharmaceutical composition for treatment and pharmaceutical composition for diagnosis, and oligonucleotide derivative for regulation of miRNA function
An oligonucleotide derivative comprises repeating structural units represented by the following general formula (wherein B represents adenine, guanine, cytosine, or uracil; X represents a sulfur atom or an oxygen atom; n represents an integer of 6 to 60; and B and X are independently represented in each of the repeating structural units), wherein X is a sulfur atom in at least one of the repeating structural units represented by the general formula:
US09315808B2 Cell-specifically effective molecules on the basis of siRNA and application kits for the production thereof and use thereof
A biologically inactivated cell-specifically effective molecule for biologically inactive transfection into a target cell to inhibit expression of genes in the target cell after biological activation of the molecule, by bonding to mRNA and with the formation of a RISC complex, the biologically inactivated cell-specifically effective molecule comprising siRNA coupled with at least one peptide via a linker which remains at the siRNA after biological activation of the molecule, the linker comprising an amino Cn linker wherein n is an integer of 1-6. Kits include the molecule or the constituents thereof and transfection reagents in ampoules and injection equipment for injecting mixtures of the ampoule contents into a medium containing a target cell.
US09315806B2 Massively parallel combinatorial genetics
The invention relates to methods and compositions that enable the rapid generation of high-order combinations of genetic elements, and that provide a barcoded basis for rapid characterization of the specific combination of genetic elements encoded within a single cell or in a pooled population.
US09315805B2 Alphabody libraries and methods for producing the same
The invention provides single-chain Alphabody library comprising at least 100 different-sequence single-chain Alphabody polypeptides, wherein said Alphabody polypeptides differ from each other in at least one of a defined set of 5 to 20 variegated amino acid residue positions, and wherein at least 70% but not all of said variegated amino acid residue positions are located either in the loop, helix surface or linker region of the Alphabody. The invention further provides methods for use of the Alphabody libraries and Alphabodies obtainable by the methods of the invention.
US09315804B2 Method of selecting aptamers
The present invention is a method for the identification of one or more aptamers to at least one target molecule, the method comprising: selecting candidate aptamer sequences that bind to a target molecule, assigning to the bound sequences a measure (fitness function) of each sequence's aptameric potential, allowing evolution of some or all of the sequences to create a new mixture of candidate sequences, and repeating the method with the newly created candidate aptamer pool until the aggregate aptameric potential of the candidate pool reaches a plateau, wherein sequences present in the final pool are optimal aptamers to the target molecule.
US09315803B2 Method for the preparation of modified bacteriophages by insertion of random sequences in the targeting proteins of said bacteriophages
The invention relates to a method for obtaining a variety of recombinant bacteriophages in which the screening proteins have been modified by the insertion in their genetic sequence of randomly produced oligonucleotides, and to bacteriophages banks that can be obtained according to said method.
US09315802B2 RNA isolation from soluble urine fractions
The invention provides methods for isolating RNA from the soluble fraction of urine. The methods can be used for detecting the presence or absence of an RNA, or quantifying the amount of an RNA. The methods are useful for diagnosing an individual suspected of having a disease by detecting the level of RNA associated with the disease in the soluble fraction of urine. The methods are also useful for prognosing an individual diagnosed with a disease by detecting the level of RNA associated with the disease in the soluble fraction of urine.
US09315800B2 Method for isolating nucleic acids and composition used therefor
The disclosure provides a composition and method for isolating nucleic acids, in which the composition includes at least one halocarbon, at least one salt and at least one surfactant. Mixing the composition and a biosample to form a homogenized solution, nucleic acids in the solution can be easily isolated with a simple treatment and good yield.
US09315796B2 Method for activating catalyst using photothermal nanomaterials
Disclosed is a method for activating a catalyst using the photothermal effects of photothermal nanomaterials, and more particularly to a method of activating a catalyst at a temperature, at which the catalyst has low or no activity, by irradiating a catalyst-photothermal nanomaterial composite with light. The method can activate the catalyst by increasing only the temperature around the nanomaterials without substantially changing the temperature of the reaction medium. A catalyst that generally has high activity at room temperature can be activated even at low temperature. Catalysts having high activity only under mild conditions are immobilized on photothermal nanomaterials so that they have activity even under low temperature and extreme conditions. The invention is useful when a catalyst substrate unstable at room temperature is used or a catalytic product unstable at room temperature is produced.
US09315794B2 Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of aspartyl-tRNA synthetases
Provided are compositions comprising newly identified protein fragments of aminoacyl-tRNA synthetases, polynucleotides that encode them and complements thereof, related agents, and methods of use thereof in diagnostic, drug discovery, research, and therapeutic applications.
US09315792B2 Nitrilases, nucleic acids encoding them and methods for making and using them
The invention relates to nitrilases and to nucleic acids encoding the nitrilases. In addition methods of designing new nitrilases and method of use thereof are also provided. The nitrilases have increased activity and stability at increased pH and temperature.
US09315789B2 Antibody conjugates
Antibody/signal-generating moiety conjugates are disclosed that include an antibody covalently linked to a signal-generating moiety through a heterobifunctional polyalkyleneglycol linker. The disclosed conjugates show exceptional signal-generation in immunohistochemical and in situ hybridization assays on tissue sections and cytology samples. In one embodiment, enzyme-metallographic detection of nucleic acid sequences with hapten-labeled probes can be accomplished using the disclosed conjugates as a primary antibody without amplification.
US09315787B2 Modified DNA polymerases for improved amplification
The present invention provides improved DNA polymerases that may be better suited for applications in recombinant DNA technologies, in particular technologies involving plant-derived samples. Among other things, the present invention provides modified DNA polymerases derived from directed evolution experiments designed to select mutations that confer advantageous phenotypes under conditions used in industrial or research applications.
US09315785B2 Pyripyropene a biosynthetic gene
An isolated novel polynucleotide comprising a nucleotide sequence encoding at least one polypeptide involved in biosynthesis of pyripyropene A, a recombinant vector comprising the polynucleotide and a transformant comprising the polynucleotide are disclosed. By the present invention, a pyripyropene A biosynthetic gene useful for production of a novel pyripyropene analog, improvement of productivity of a pyripyropene A-producing bacterium, production of an insecticidal agent for microorganisms, creation of a plant resistant to insect pests or the like are provided.
US09315784B2 Modified transketolase and use thereof
The present invention relates to a improved process for the biotechnological production of compounds for which ribose-5-phosphate, ribulose-5-phosphate or xylulose-5-phosphate is biosynthetic precursor like riboflavin (vitamin B2), FAD, FMN, pyridoxal phosphate (vitamin B6), guanosine, GMP, adenosine, AMP. The invention further pertains to the generation of the organism producing those compounds. It furthermore relates to the generation of mutated transketolases that allow normal growth on glucose but reduced growth on gluconate when introduced into the production strains and to polynucleotides encoding them.
US09315781B2 Infectious CDNA clone of european PRRS virus and uses thereof
The present invention belongs to the field of animal health and relates to a nucleic acid sequence which comprises the genome of an infectious genotype I (EU) PRRS virus clone useful for studying Porcine Reproductive and Respiratory Syndrome (PRRS), a viral disease affecting swine, and in the development of vaccines, therapeutics and diagnostics for the prophylaxis, treatment and diagnosis of PRRS.
US09315763B2 Photolabile latex for the release of perfumes
The present invention relates to the field of perfumery. More particularly, it concerns co-polymeric latex particles derived from 2-oxo-2-(3- or 4-vinylphenyl)acetates capable of liberating an active molecule such as, for example, an aldehyde or ketone upon exposure to light. The present invention concerns also the use of said latex in perfumery as well as the perfuming compositions or perfumed articles comprising the invention's latex.
US09315762B2 SMB process for producing highly pure EPA from fish oil
The present invention provides a chromatographic separation process for recovering a polyunsaturated fatty acid (PUFA) product from a feed mixture which is a fish oil or which is derived from fish oil, which process comprises the steps of: (i) purifying the feed mixture in a chromatographic separation step, to obtain a first intermediate product; and (ii) purifying the first intermediate product obtained in (i) in a simulated or actual moving bed chromatographic separation step, to obtain a second intermediate product; and (iii) purifying the second intermediate product obtained in (ii) in a simulated or actual moving bed chromatographic separation step, to obtain the PUFA product; wherein an aqueous organic solvent is used as eluent in each separation step; saturated and/or monounsaturated fatty acids present in the feed mixture are removed in the first separation step; the PUFA product is separated from different components of the feed mixture in steps (ii) and (iii); and the PUFA product obtained in the third separation step contains EPA or an EPA derivative in an amount greater than 90 wt %.
US09315755B2 Catalytic system for preparation of high branched alkane from olefins
The present invention discloses a catalytic system for preparing highly branched alkane from olefin, which contains novel nickel or palladium complexes. In the presence of the catalytic system, highly branched oily alkane mixture can be efficiently obtained from olefins (such as ethylene) under mild conditions. The alkane mixture has a low bromine number, and can be used as a processing aid(s) and lubricant base oil with high-performance. Provides also was a method for preparing the catalyst and a method for preparing an oily olefin polymer.
US09315754B2 Compositions
An additive composition for use in a diesel fuel formulation, comprising a cetane improver in an inclusion complex with a modified cyclodextrin of formula (I): wherein n is an integer from 6 to 20, and R1, R2 and R3 are each independently selected from hydrogen, optionally substituted alkyl, optionally substituted aryl and carbonyl, provided that R1, R2 and R3 are not all hydrogen. Also provided is a diesel fuel formulation comprising the additive composition, and the use of a modified cyclodextrin (I) as a vehicle for a cetane improver in an additive composition or diesel fuel formulation.
US09315753B2 Diesel fuel compositions
A diesel fuel composition comprising, as an additive, the product of a Mannich reaction between: (a) an aldehyde; (b) an amine; and (c) a substituted phenol; wherein the phenol is substituted with at least one branched hydrocarbyl group having a molecular weight of between 200 and 3000; and wherein in the Mannich reaction used to form the additive the molar ratio of component (a) to component (b) is 2.2-1.01:1; the molar ratio of component (a) to component (c) is 1.99-1.01:1 and the molar ratio of component (b) to component (c) is 1:1.01-1.99.
US09315752B2 Fuel compositions
A diesel fuel composition comprising a performance enhancing additive, wherein the performance enhancing additive is the product of a Mannich reaction between: (a) an aldehyde; (b) a polyamine; and (c) an optionally substituted phenol; wherein the molar ratio of component (c) to component (b) in the reaction mixture used to prepare the performance enhancing additive is at least 1.5:1.
US09315748B2 Cold flow additives
This invention relates to a fuel composition, comprising: (A) a normally liquid fuel; and (B) a cold flow improving amount of (i) a metathesized natural oil; (ii) a metathesized natural oil derivative; or (iii) a mixture of (i) and (ii). The invention also relates to metathesized derivatives formed by the reaction of a metathesized natural oil with a nucleophile, oxidizer, aromatic compound, enophilic acid reagent, or a mixture of two or more thereof.
US09315747B2 Nano-sized zinc oxide particles for fuel
A fuel composition contains a liquid fuel and a specific amount of nano-sized zinc oxide particles and a surfactant that does not contain sulfur atoms. The nano-sized zinc oxide particles can be used to either improve combustion or increase catalytic chemical oxidation of fuel.
US09315745B2 Ebullated-bed process for feedstock containing dissolved hydrogen
An improved system and method for processing feedstocks in an ebullated-bed hydroprocessing reactor is provided in which hydrogen gas is dissolved in the fresh and recycled liquid feedstock by mixing and/or diffusion of an excess of hydrogen, followed by flashing of the undissolved hydrogen upstream of the reactor inlet, introduction of the feed containing dissolved hydrogen into the ebullated-bed hydroprocessing reactor whereby the dissolved hydrogen eliminates or minimizes the prior art problems of gas hold-up and reduced operational efficiency of the recycle pump due to the presence of excess gas in the recycle stream when hydrogen gas was introduced as a separate phase into the reactor.
US09315743B2 Process for mild hydrocracking of heavy hydrocarbon fractions with optimized thermal integration for the purpose of reducing greenhouse gas emissions
This invention describes a process for mild hydrocracking of heavy hydrocarbon fractions of the vacuum distillate type or the deasphalted oil type with optimized thermal integration for the purpose of reducing greenhouse gas emissions.
US09315736B2 Methods of fuel production
Presented are one or more aspects and/or one or more embodiments of catalysts, methods of preparation of catalyst, methods of deoxygenation, and methods of fuel production.
US09315725B2 Method of making EU2+ activated inorganic red phosphor
A method of manufacturing an Eu2+ activated inorganic red phosphor is provided, wherein the phosphor exhibits an emission spectrum resolvable into a first Gaussian emission curve and a second Gaussian emission curve; wherein the first Gaussian emission curve has a first Gaussian emission curve peak, P1; wherein the first Gaussian emission curve peak, P1, has a peak 1 height, HP1, a peak 1 peak wavelength, PλP1, and a peak 1 area, AP1; wherein the second Gaussian emission curve has a second Gaussian emission curve peak, P2; wherein the second Gaussian emission curve peak, P2, has a peak 2 height, HP2, a peak 2 peak wavelength, PλP2, a peak 2 full width at half max, FWHMP2, and a peak 2 area, AP2; wherein PλP1
US09315723B2 Polymer compound, luminescent material, and light emitting device
This invention provides a luminescent composition comprising a polymer and at least one phosphorescent compound, characterized in that the electronic conjunction chain coefficient Ze of the main repeating minimum unit of the polymer falls within the following range: 0
US09315722B1 Methods for improving friction reduction in aqueous brine
Methods for improving friction reduction properties of an aqueous treatment fluid are provided, wherein the resultant aqueous treatment fluid has an improvement in friction reduction, when compared to a similar aqueous treatment fluid in which the inverted emulsion does not contain salt.
US09315719B2 Low surface friction proppants
A proppant having low surface friction is described, which is useful in hydrocarbon recovery. Methods of making low surface friction proppants are further described, as well as uses thereof.
US09315714B2 Degradable non-aqueous gel systems
A method of treating a formation that includes exposing a region of the formation occupied by a hydrolysable gel to a hydrolyzing agent; and allowing sufficient time for the hydrolyzing agent to hydrolyze the gel. Various methods may also include the use of a swelling agent to allow for expansion of the gel.
US09315710B2 Plastic phase change material and articles made therefrom
The present invention generally relates to a method for manufacturing phase change material (PCM) pellets. The method includes providing a melt composition, including paraffin and a polymer. The paraffin has a melt point of between about 10° C. and about 50° C., and more preferably between about 18° C. and about 28° C. In one embodiment, the melt composition includes various additives, such as a flame retardant. The method further includes forming the melt composition into PCM pellets. The method further may include the step of cooling the melt to increase the melt viscosity before pelletizing. Further, PCM compounds are provided having an organic PCM and a polymer. Methods are provided to convert the PCM compounds into various form-stable PCMs. A method of coating the PCMs is included to provide PCMs with substantially no paraffin seepage and with ignition resistance properties.
US09315705B2 Sealant composition
A sealant composition having between 30 wt % and 60 wt % of a dispersion of a hydrophilic binder; between 30 wt % and 70 wt % of a filler; between 0.05 wt % and 1 wt % of a thickener, wherein the pigment volume concentration (PVC) is between 40% and 80%. A method for preparing such a sealant composition.
US09315703B2 Fixing member and method of manufacturing the member, fixing device, and electrophotographic image-forming apparatus
Provided is a fixing member having a silicone rubber elastic layer blended with a carbon nanotube, the fixing member suppressing peeling at an interface in association with insufficient adhesion between a base member and the silicone rubber elastic layer at the time of the use of the fixing member, and hence securing adhesion durability. The fixing member includes a base member, an elastic layer, and a surface layer, in which: the elastic layer contains a silicone rubber and a carbon nanotube; a ratio E200/E50 of an elastic modulus E200 of the elastic layer at 200° C. to an elastic modulus E50 of the elastic layer at 50° C. is 0.5 or more and less than 1.0; an adhesive strength between the elastic layer and the base member is 3.0 N/cm or more and 20.0 N/cm or less; and the elastic layer undergoes a cohesive failure at the time of a peel test.
US09315702B2 Polyetherimides, methods of manufacture, and articles formed therefrom
A polyetherimide composition comprising a polyetherimide manufactured by reaction of an alkali metal salt of a dihydroxy aromatic compound with a bis(halophthalimide) composition comprising, based on the weight of the bis(halophthalimide) composition, at least 15 wt. % of a 3,3′-bis(halophthalimide) of the formula from more than 17 wt. % to less than 85 wt. % of a 4,3′-bis(halophthalimide) of the formula  and from more than 0 to less than 27 wt. % of a 4,4′-bis(halophthalimide) of the formula
US09315699B2 Photocurable adhesive composition
Provided is an adhesive composition comprising: a thermosetting epoxy resin formed with an epoxy copolymer containing a hydroxyl group; and a UV curable epoxy resin having an epoxy equivalence of 100 g/eq to 500 g/eq.
US09315697B2 Multi-block copolymer
Provided are a multi-block copolymer, a pressure-sensitive adhesive composition, a method of preparing a multi-block copolymer, a pressure-sensitive adhesive polarizing plate, and a liquid crystal display device. The pressure-sensitive adhesive composition including the multi-block copolymer may have excellent durability regardless of a temperature and/or humidity. In addition, the method of preparing a multi-block copolymer may prepare a multi-block copolymer increased in molecular weight which is structurally controlled with a simple process using a compound containing at least two halogen atoms. Accordingly, when included in a pressure-sensitive adhesive resin, the multi-block copolymer may have excellent cohesive strength in the resin, and a network structure during curing, and thus, when applied to a pressure-sensitive adhesive composition, the multi-block copolymer may be usefully applied to an optical member due to excellent durability regardless of a temperature and humidity.
US09315696B2 Ephemeral bonding
Compositions containing an adhesive material, a release additive and a compatibilizer are suitable for temporarily bonding two surfaces, such as a wafer active side and a substrate. These compositions are useful in the manufacture of electronic devices where a temporary bonding of a component to a substrate is desired.
US09315695B2 Actinic radiation and moisture dual curable composition
A dual curable, liquid adhesive composition capable of polymerization by exposure to actinic radiation and moisture. The composition is particularly useful for liquid adhesives for electronic applications. The composition comprises an alkoxysilane functional polyurethane acrylate oligomer; a free radical polymerizable reactive diluent; a free radical photoinitiator; a catalyst for moisture curing of silane groups; and an optional alkoxysilane functional oligomer having a polyolefin group; an optional acrylate or methacrylate functional polyurethane acrylate oligomer; an optional hydroxyl terminated monoacrylate or monomethacrylate functional reactive diluent; an optional UV-absorber and hindered amine light stabilizer antioxidant; an optional wax capable of reducing oxygen inhibition; an optional 1,3 dicarbonyl compound chelating agent; an optional thixotropic agent; and an optional adhesion promoter. optional adhesion promoter.
US09315694B2 Vinyl acetate/vinyl 3,5,5-trimethylhexanoate copolymer binder resins
The present invention relates to a copolymer composition comprising 5-95 pphwm of vinyl acetate and 95-5 pphwm of vinyl 3,5,5-trimethylhexanoate, wherein the corresponding 3,5,5-trimethylhexanoic acid has a content of the 3,5,5-trimethylhexanoic acid isomer of at least 88% by weight.Said copolymer is composed and synthesized so as to be useful in the formulation of binders for fibrous substrates such as woven or nonwoven products, paints, adhesives for porous or non-porous substrates, construction cementitious compositions, redispersible powders.
US09315693B2 Glyoxal adhesive system and process for manufacturing same
An optical adhesive product and a process for manufacturing an optical adhesive product, including laminated film ensembles, and laminated lenses, are described. The optical adhesive product includes a glyoxal water solution that is pH adjusted for use as an optical adhesive that demonstrates a wet peel force strength above about 6 Newtons. A water-based polymer, such as PVOH, may be added to the adhesive system. According to the process, the adhesive system is manufactured and utilized to laminate TAC-PVA-TAC films together to form a polar film ensemble. The polar film ensemble is laminated to an optical substrate and, when forming an ophthalmic lens, surfaced, coated and edged. The optical adhesive product avoids film separation in the polar TAC-PAV-TAC film ensemble during edging.
US09315692B2 Base material film for dicing sheet and dicing sheet
A base material film used for a dicing sheet, the dicing sheet including the base material film and a pressure-sensitive adhesive layer laminated on one surface of the base material film. The base material film includes a single layer of resin film or multiple layers of resin films, at least the resin film in contact with the pressure-sensitive adhesive layer being formed from a resin composition containing ethylene-(meth)acrylic acid copolymer as a main constituent, the resin composition further containing 0.3 to 17.0 parts by mass of an epoxy compound based on 100 parts by mass of the ethylene-(meth)acrylic acid copolymer. The dicing sheet that uses the base material film does not require application of physical energy such as an electron beam or a γ-ray, and can be reduced in dicing dust that is generated during the dicing of a cut object.
US09315691B2 Adhesive composition
An adhesive composition, an optical member, a surface protective film, and an adhesive sheet, the adhesive composition including 100 parts by weight of a (meth)acrylic copolymer having a weight average molecular weight of about 100,000 to about 2,000,000 g/mol; about 0.01 to about 5 parts by weight of a peroxide crosslinking agent; and about 0.001 to about 5 parts by weight of a carbodiimide.
US09315685B2 Process for preparing an aqueous ink jet printing ink
A process for preparing an aqueous ink composition including 1) preparing a colorant concentrate; 2) preparing a colorant wax dispersion by (a) melting and mixing a dry colorant with at least one wax to form a colorant concentrate, wherein the colorant concentrate contains at least 25 percent by weight of colorant; (b) milling the colorant concentrate of step (a) to form a milled colorant concentrate; (c) combining the milled colorant concentrate of (b) with water and dispersing to form a colorant wax dispersion comprising a plurality of colorant wax particles comprising a colorant core surrounded by a wax shell, wherein the colorant wax particles exhibit a particle size distribution of from about 150 nanometers to less than about 300 nanometers; wherein the melting and mixing of step (a) and the milling of step (b) is done in an immersion media mill; and wherein the combining of step (c) is done using a piston homogenizer; and 3) blending the colorant wax dispersion with an aqueous ink vehicle and optional ink additives to form an aqueous ink composition; and filtering the aqueous ink composition.
US09315682B2 Heat-transfer textile ink
A heat-transfer textile ink product comprising (a) silicone ink base composition; (b) one or more pigments; and (c) a heat-transfer adhesion promoter.
US09315678B2 Affinity of hardly soluble or insoluble substance solvent by water-soluble xylan
One object of the present invention is to provide a method of improving the affinity of a solvent for the surface of a hardly soluble or insoluble substances. Further object of the invention is providing a molded article comprising a hardly soluble or insoluble substances using the solution of a hardly soluble or insoluble substances. A method for improving affinity of a substance surface for a solvent, comprising: bringing the substance surface into contact with water-soluble xylan and the solvent, wherein the substance is hardly soluble or insoluble in the solvent in the absence of the water-soluble xylan. A solution comprising an added water-soluble xylan, a substance, and a solvent, wherein the substance is hardly soluble or insoluble in the solvent in the absence of the water-soluble xylan. A molded article comprising the added water-soluble xylan and the hardly soluble substance.
US09315677B2 Aqueous polyurethane resin composition for flame retardant coated materials and coated products obtained by applying said composition
The present invention is an aqueous polyurethane resin composition for a flame retardant coated material comprised of an aqueous dispersion of a polyurethane resin obtained by extending a chain of an urethane prepolymer in an aqueous dispersion. The aqueous dispersion of the urethane prepolymer is obtained by reacting (a) a polyisocyanate component with (b) a polyol component which contains a phosphorus-containing polyol compound represented by the following general formula (1) as an essential component then dispersed the obtained prepolymer in the water, wherein a unit corresponding to the compound represented by the said general formula (1) is contained so that the phosphorus content in the urethane resin solid is 0.3 to 5.0 mass percent; R1 in the formula (1) represents an alkylene group having 2 to 4 carbon atoms, and m and n represent a number from 1 to 10.
US09315673B2 Insulated ultrafine powder, method for producing same, and high dielectric constant resin composite material
Provided are an insulated ultrafine powder obtained by adding liquid metal alkoxide to a methanol-containing organic solvent in which a conductive ultrafine powder comprising a carbon material is dispersed and further adding water thereto and a method for producing the same. Also, provided are an insulated ultrafine powder obtained by adding liquid metal alkoxide to a methanol-containing organic solvent in which a conductive ultrafine powder comprising a carbon material is dispersed, further adding a coupling agent having an alkoxide group and then adding water thereto and a method for producing the same. Further, provided is a high dielectric constant resin composite material obtained by blending the insulated ultrafine powder of the present invention with a resin in a volume ratio (insulated ultrafine powder/resin) falling in a range of 5/95 to 50/50.
US09315672B2 Colorant, microcapsule pigment prepared by using the same and ink composition for writing instrument
Provided are a colorant represented by the following Formula (I) which is excellent in a color intensity and a lightfastness, a microcapsule pigment including the colorant, a developer and a chromic temperature controller and an ink composition for writing instruments including the microcapsule pigment: wherein X and Y represent a hydrogen atom, an alkyl group having 1 to 4 carbon atoms or a halogen atom; and X and Y may be identical or different from each other, provided that a case in which both of X and Y are a hydrogen atom is excluded.
US09315670B2 Composition for forming resist underlayer film and patterning process
The invention provides a composition for forming a resist underlayer film including: as a component (A), a silicon-containing compound obtained by hydrolysis and/or condensation of one or more kinds of silicon compounds represented by the following general formula (A-1). There can be provided a composition for forming a resist underlayer film having etching selectivity relative to a conventional organic film and a silicon-containing film and favorable pattern adhesiveness relative to fine pattern even in a complicated patterning process. R1Aa1R2Aa2R3Aa3Si(OR0A)(4-a1-a2-a3)  (A-1)
US09315665B2 Method for preparing resin composition for expandable polypropylene carbonate and expandable polypropylene carbonate prepared therefrom
Provided herein are a method for preparing a resin composition for an expandable polypropylene carbonate and an expandable polypropylene carbonate prepared therefrom. More particularly, the present invention relates to a method for preparing a resin composition for an expandable polypropylene carbonate capable of using supercritical carbon dioxide as a foaming agent and preparing a foam having excellent moldability by an appropriate foaming method, and an expandable polypropylene carbonate prepared therefrom. The expandable polypropylene carbonate capable of having high magnification, excellent thermal stability, and dimensional stability may be prepared by using the resin composition according to the present invention.
US09315662B2 Resin composition for direct metal plating, molded article, and metal-plated molded article
The objective of the present invention is to provide a resin composition for direct plating whose plating performance such as depositibility and appearance after forming a metal film including copper film and the like by electroplating in direct plating method is excellent, a molded article comprising this composition, and a plated article having a metal film or an alloy film, formed by direct plating. The present composition is a thermoplastic resin composition containing a rubber-reinforced vinyl-based resin and the rubber-reinforced vinyl-based resin comprises a diene-based rubbery polymer [a1] and an ethylene•α-olefin-based rubbery polymer [a2], the total amount of the diene-based rubbery polymer [a1] and the ethylene•α-olefin-based rubbery polymer [a2] is from 3 to 30% by mass based on the thermoplastic resin composition, and the ratio of the ethylene•α-olefin-based rubbery polymer [a2] to the total amount is from 0.01 to 0.4.
US09315661B2 Reducing fouling in heat exchangers
In the solution polymerization of ethylene co and homopolymers the solution leaving the reactor is heated to separate polymer from solvent and residual monomers. Fouling in the heat exchanger may be reduced by adding to the solution from 0.01 to 100 ppm by weight of a polyoxyalkylene compound of the formula HO—(CH2CH2O)M[CH2CH(CH3)O]N(CH2CH2O)PH wherein M, N and P each represent the average number of repeating units and M is from 0 to 20, N is from 2 to 50 and P is from 0 to 20 and passing the solution through a heat exchanger to increase its temperature by at least 20° C.
US09315659B2 Resin composition and optical compensation film formed using the same
There are provided a resin composition and an optical compensation film formed using the same, and more particularly, to a resin composition comprising (a) alkyl (meth)acrylate units, (b) styrene units, (c) 3 to 6 element heterocyclic units substituted with at least one carbonyl group and (d) vinyl cyanide units, and an optical film formed using the resin composition. Further, a resin composition according to the present invention can provide an optical film having excellent optical properties and superior optical transparency, less haze and superior mechanical strength and heat resistance simultaneously. Therefore, an optical film formed using a resin composition of the present invention can be used in various applications, e.g., electronic information devices such as display devices. Particularly, the optical film is suitable for a compensation film used in the IPS mode.
US09315654B1 Preparation of silica reinforced rubber with coupling agent comprised of siloxy trithiocarbonate and tire with component
The present invention relates to preparation of precipitated silica reinforced rubber compositions with silica coupling agent comprised of a siloxy trithiocarbonate, rubber compositions thereof and an article of manufacture such as a tire which contains a component comprised of such rubber composition.
US09315652B2 Dispersants having biobased compounds
The present disclosure is directed to compositions having lecithin and an organic acid and related methods. The disclosed compositions may also include one or more co-surfactants such as anionic surfactants and/or non-ionic surfactants, and may be used as a dispersant.
US09315643B2 Self priming spackling compound
A self-priming spackling compound includes between about 35% by weight and about 65% by weight acrylic latex resin, between about 20% by weight and about 50% by weight filler material, and between about 1% by weight and about 20% by weight water. In certain aspects, the latex resin may have an average latex particle size of less than about 0.18 microns, a minimum film formation temperature of less than about 15 degrees Celsius, and/or a glass transition temperature (Tg) of less than about 25 degrees Celsius. To further enhance the self-priming performance of the spackling compound, the formulation may further comprise a colorant such as titanium dioxide.
US09315642B2 Composite and method for forming the same
A method for forming composite is provided. The method comprises following steps. Firstly, a polypropylene homopolymer and at least one kind of inorganic particles are provided to a twin screw extruder, wherein the polypropylene homopolymer occupies 40 wt %˜90 wt % of the composite, the inorganic particles occupies 10 wt %˜60 wt % of the composite, the melt flow index of the polypropylene homopolymer is lower than 3.6 g/10 min, and the particle sizes of the inorganic particles are in a range of 100 nm to 1000 nm. The polypropylene homopolymer is heated to a molten state. Then, the molten-state polypropylene homopolymer and the inorganic particles are enabled to pass through at least five kneading blocks of the twin screw extruder to be mixed together such that the inorganic particles are dispersed in the polypropylene homopolymer.
US09315640B2 Polyacrylic acid-type water absorbent resin and method for producing same
Provided is a method for producing a water absorbent resin, which promotes the formation of interconnected voids (continuous gas bubbles) in a foamed polymer (foam-like water absorbent resin) by a more convenient method, and produces with high efficiency a water absorbent resin which exhibits a high water absorption rate even when stepped into a sheet form or a powder form in hygiene articles and the like. Disclosed is a method for producing a polyacrylic acid-type water absorbent resin, comprising (A) a step of obtaining an aqueous solution of acrylic acid-type monomers containing gas bubbles dispersed therein; (B) a step of polymerizing the aqueous monomer solution and thereby obtaining a foamed polymer; and (C) a step of heating and drying the foamed polymer, wherein gas bubbles are incorporated such that the volumetric expansion factor defined by the following formula (1); [Formula 1] Volumetric expansion factor=(Volume of aqueous monomer solution after gas bubble dispersion)/(volume of aqueous monomer solution before gas bubble dispersion)  Formula (1); exceeds 1.1 times, and the aqueous monomer solution having a monomer concentration defined by the following formula (2); [Formula 2] Monomer concentration [wt %]=(Weight of a monomer)/{(weight of a monomer)+(weight of solvent)}×100  Formula (2); of 40% by weight or greater is boiling polymerized at a temperature of 100° C. or higher.
US09315635B2 Biomaterial
The present invention provides a triblock copolymer and a viscoelastic biostable foam comprising the same.
US09315634B2 Graft copolymer, production method therefor, resin composition, and molded article
Disclosed are a method of producing a graft copolymer, comprising polymerizing a vinyl monomer (B) containing a polyfunctional vinyl monomer (b1) in the presence of a polyorganosiloxane rubber (A) comprising more than 20% by mass of a toluene-insoluble matter, wherein a mass percentage of the polyfunctional vinyl monomer (b1) is 11 to 19% by mass based on 100% by mass of a total amount of the polyorganosiloxane rubber (A) and the vinyl monomer (B); a graft copolymer obtained by the method; a resin composition being prepared by blending the graft copolymer with a resin and having high impact resistance and heat resistance and sufficient flame retardancy; and a molded article obtained by molding the resin composition.
US09315633B2 Nanomodified backbones for polyimides with difunctional and mixed-functionality endcaps
Polyimides containing a backbone with at least one nanoparticle component and made from oligomers having endcaps that are difunctional or a mix of di- and monofunctionality are provided. The endcaps may be nadic or phenylethynyl. The backbone may be wholly inorganic or made from a mixture of inorganic and organic groups. The oligomers may be created in-situ using standard polymerization of monomeric reactants chemistry using a solvent or may be provided as a pre-imidized compound that may be either a solid or liquid. It is believed that the nanoparticle component of the polymer backbone provides superior thermo-oxidative stability verses unmodified organic backbones. It is further believed that providing difunctional or a mixture of di- and monofunctional endcaps allows for increased crosslinking to provide improved strength and stiffness verses wholly monofunctional endcapped oligomers for polyimides. The nanoparticle is part of the backbone of the polymer and not solely a pendant group.
US09315631B2 Methods of making saccharide siloxane copolymers
A method of making a saccharide siloxane copolymer includes reacting an amine functional saccharide with an epoxy functional silane containing at least one condensable or hydrolysable group. This product is reacted with an oligomer to form the saccharide siloxane copolymer.
US09315630B2 Anion-conducting polymer
Disclosed herein are anion-conducting polymers that comprise a cationic benzimidazolium and imidazolium moieties. Methods of forming the polymers and membranes comprising the polymers are also provided.
US09315629B2 Benzoxazine-system composition, and thermosetting material and varnish thereof
A heat-curable composition comprises 30-70 mass % of a compound represented by formula (1) and 70-30 mass % of a compound represented by formula (2). In formulae (1) and (2), R1, R2, R3 and R4 are the same as or different from one another, and are independently selected from the group consisting of —H, —CH3, —C(CH3)3 and a group represented by formula (i) for each of compound molecules. In formula (i), Y is selected from the group consisting of —O—, —CH2— and —C(CH3)2—. The heat-curable composition containing the benzoxazine compound has excellent solubility in solvents, heat resistance and flame retardancy, and therefore can be used for providing a cured product of the composition or a varnish.
US09315626B2 Process for preparing polyamides
The present invention relates to a process for preparing a polyamide based on dicarboxylic acids and diamines, comprising the following stages: A) providing an aqueous monomer mixture composed of dicarboxylic acids and diamines, where the molar ratio of dicarboxylic acids to diamines is adjusted such that, at the outlet of stage C), there is a molar deficiency of dicarboxylic acids or diamines of 1 to 10 mol %, based on the respective other component, B) transferring the aqueous mixture from stage A) into a continuous evaporator reactor in which diamines and dicarboxylic acids are converted at a temperature in the range from 100 to 370° C. and a pressure in the range from 1 to 50 bar, C) transferring the mixture from stage B) into a separator which is operated at a temperature in the range from 100 to 370° C. and a pressure in the range from 1 to 50 bar with removal of gaseous components, D) transferring the mixture from stage C) together with diamine or dicarboxylic acid in an amount suitable for compensation for the molar deficiency into a tubular reactor which is operated at a temperature in the range from 100 to 370° C. and a pressure in the range from 1 to 50 bar, for a residence time in the range from 10 seconds to 30 minutes, E) transferring the mixture from stage D) into an extruder which is operated at a temperature in the range from 150 to 400° C. for a residence time in the range from 10 seconds to 30 minutes with removal of gaseous components through venting orifices.
US09315625B2 Melt-processable polyamide with high melting temperature
The invention relates to a polyamide comprising units derived from: A. a diamine comprising in its structure at least one cyclohexane fragment according to Structure I, in which the substituents are in the 1,4-trans-position (Structure I), with n a positive integer of at least 1, and the proviso that when n is 2 or higher the cyclohexane rings are connected to each other through the 1,4-trans position, B. an aliphatic dicarboxylic acid with at least 13 carbon atoms and optionally comprising units derived from: C. one or more aliphatic dicarboxylic acids other than B, D. one or more diamines other than A, E. one or more monofunctional carboxylic acids or monofunctional amines, F. one or more polyfunctional monomers comprising carboxylic acid and/or amine groups, G. one or more lactams or corresponding amino acids. The invention further relates to a composition comprising such a polyamide and its uses.
US09315617B2 Crosslinkable and crosslinked polymers, method for the production thereof, and use thereof
The present invention relates to cross-linkable and cross-linked polymers and to a method for the production thereof. The invention further relates to the use of said polymers in electronic devices and to the corresponding electronic devices themselves.
US09315616B2 Blocked prepolymers and acrylic plastisol compositions comprising the blocked prepolymers
The invention generally relates to blocked prepolymers. More specifically, the invention generally relates to plastisol compositions comprising the blocked prepolymers. The blocked prepolymer is the reaction product of at least an isocyanate terminated prepolymer and a blocking agent, wherein the blocking agent is a nitrogen containing blocking agent. The isocyanate terminated prepolymer is the reaction product of at least one or more polyols comprising at least one polyol having an amine initiator and a stoichiometric excess of one or more organic polyisocyanate components.
US09315615B2 Titanium dioxide pigment and manufacturing method
In one aspect, the invention provides a titanium dioxide pigment. The titanium dioxide pigment comprises a plurality of titanium dioxide particles, and a polymer deposited on the titanium dioxide particles for inhibiting agglomeration of the titanium dioxide particles in an aqueous based coating formulation. The titanium dioxide particles have anchoring moieties associated therewith for facilitating anchoring of the polymer to the particles. The polymer is a copolymer having anchoring groups for attaching to the anchoring moieties associated with the titanium dioxide particles and hydrophobic end groups for attaching to the resin of the coating formulation. In another aspect, the invention provides a method of manufacturing a titanium dioxide pigment.
US09315613B2 Nontemperature sensitive memory foam of MDI system suitable for horizontal foaming process
An MDI system non-temperature sensitive memory sponge suitable for a flat foam foaming process is made by using a polyol mixture, which includes a polyether polyol and a polymer polyol, to react with an isocyanate and an auxiliary agent mixture that includes: a chain extender, a foaming agent, a pore adjusting agent, and a catalyst. The polyether polyol includes a polyoxypropylene glycerol with a molecular weight of 700 and a polyoxypropylene trihydroxy ether with a molecular weight of 4800, the polymer polyol includes a graft polyether, and the isocyanate is methylene diphenyl diisocyanate.
US09315610B2 Dispersants from linear polyurethanes
The present invention provides a non-aqueous composition containing a particulate solid, an organic medium and polyurethane dispersant with a substantially linear anchoring segment pendant tertiary amine group(s) from said anchoring segment and terminally attached solvent-solubilising terminal chains of a polyester, polyether, or polyacrylate including mixtures of such terminal chains.
US09315608B2 Conjugated diene polymer rubber, and conjugated diene polymer rubber composition
A conjugated diene polymer rubber is provided that includes component (A) and component (B) below, component (A) having a content, with the total amount of component (A) and component (B) as 100% by weight, of from 5% to 90% by weight, and component (B) having a content of from 95% to 10% by weight, Component (A): a conjugated diene polymer rubber component modified with a carbonyl group- and substituted amino group-containing compound Component (B): a conjugated diene polymer rubber component modified with a compound represented by formula (IIa) below (R21O)mSi(R22A)nR234-m-n  (IIa) wherein m denotes a number from 1 to 3, n denotes a number from 1 to 3, m+n is from 2 to 4, R21 and R23 denote a hydrocarbyl group, R22 denotes a hydrocarbylene group, A denotes a substituted amino group or an optionally substituted hydrocarbyloxy group, when there are a plurality of R21s the plurality of R21s may be identical to or different from each other, when there are a plurality of R22s the plurality of R22s may be identical to or different from each other, when there are a plurality of R23s the plurality of R23s may be identical to or different from each other, and when there are a plurality of As the plurality of As may be identical to or different from each other.
US09315606B2 Photocurable composition and encapsulated apparatus prepared using the same
A photocurable composition, a composition for encapsulation of an organic light emitting diode, and an encapsulated apparatus, wherein, in the photocurable composition, when A represents a glass-metal alloy die shear strength in kgf between a glass substrate and a Ni/Fe alloy after curing, and B represents curing shrinkage in % as determined by Equation 1, below, and the photocurable composition has a value for A/B of about 0.7 kgf/% or more and the glass-metal alloy die shear strength of about 2.5 kgf or more, Curing shrinkage=|(Specific gravity of solid photocurable composition after curing)−(Specific gravity of liquid photocurable composition before curing)|/(Specific gravity of liquid photocurable composition before curing)×100.  
US09315604B2 Metathesis catalysts and methods thereof
The present application provides, among other things, novel compounds for metathesis reactions, and methods for preparing and using provided compounds. In some embodiments, the present invention provides compounds having the structure of formula I or II. In some embodiments, the present invention provides methods for preparing a compound of formula I or II. In some embodiments, the present invention provides methods for using a provided compound. In some embodiments, a provided compound is useful for stereoselective ring-opening metathesis polymerization. In some embodiments, a provided metathesis method provides cis and/or isotactic polymers.
US09315601B2 Solid catalyst component for olefin polymerization, and catalyst
A solid catalyst component for olefin polymerization and a catalyst are disclosed that exhibit high catalytic activity when used for gas-phase polymerization, suppress rapid reactions in the initial stage of polymerization relative to the polymerization activity, and can produce a propylene polymer in high yield while maintaining high stereoregularity. The solid catalyst component for olefin polymerization includes magnesium, titanium, a halogen, and an internal electron donor, the solid catalyst component including an asymmetrical phthalic diester represented by the following general formula (1) in a molar ratio of 0.2 to 0.8 relative to the total content of the internal electron donor. R1k(C6H4-k)(COOR2)(COOR3)  (1) wherein R1 is an alkyl group or the like, R2 is a linear or branched alkyl group having 2 to 6 carbon atoms or an alkenyl group, R3 is a linear or branched alkyl group having 1 to 5 carbon atoms, the number of carbon atoms included in R3 being smaller than the number of carbon atoms included in R2, and k is an integer from 0 to 4 that indicates the number of substituents R1.
US09315599B2 Functionalized polymers
A method for preparing a functionalized polymer, the method comprising the steps of: (i) polymerizing monomer to form a reactive polymer, and (ii) reacting the reactive polymer with an azodiester.
US09315595B2 Amine-terminated telechelic polymers and precursors thereto and methods for their preparation
Disclosed is a method of preparing terminally functionalized telechelic polymers using a cationic living polymer product or a terminal tert-chloride chain end of a carbocationic quasiliving polymer product, which comprises quenching the polymer product with a functionalized N-substituted pyrrole to thereby introduce the functionalized N-substituted pyrrole at the terminal reactive polymer chain end(s). A method is also disclosed whereby the N-substituent may be derivatized to a basic amine containing functional group. Also disclosed are the terminal functionalized polyisobuyl N-substituted pyrrole compounds where the polyisobutyl group is substituted at the 2 and 3 position of the N-substituted pyrrole.
US09315594B2 Titanium-catalyst system comprising substituted cyclopentadienyl, guanidine and diene ligands
The invention relates to a catalyst system for the polymerization of olefins comprising a metal complex of formula CyLMD and an activating cocatalyst, wherein M is titanium, Cy is a cyclopentadienyl-type ligand, D is a diene, L is a guanidinate-containing ligand of the formula (I) wherein each A is independently selected from nitrogen or phosphorous and R, R1, R2 and R3 are independently selected from the group consisting of hydrogen, hydrocarbyl, silyl and germyl residues, substituted or not with one or more halogen, amido, phosphido, alkoxy, or aryloxy radicals, and Cy is a mono- or polysubstituted cyclopentadienyl-type ligand, wherein the one or more substituents of Cy are selected from the group consisting of halogen, hydrocarbyl, silyl and germyl residues, optionally substituted with one or more halogen, amido, phosphido, alkoxy, or aryloxy residues. The invention further relates to a process for the preparation of a polymer comprising at least one aliphatic or aromatic hydrocarbyl C2-20 olefin wherein the at least one aliphatic or aromatic olefin is contacted with the catalyst system of the present invention.
US09315592B2 Process for producing procatalyst composition with alkoxyalkyl ester internal electron donor and product
Disclosed herein are processes for preparing procatalyst compositions with an internal electron donor containing greater than 4.5 wt % of a compounded alkoxyalkyl ester. Also disclosed are catalyst compositions containing the procatalyst composition and polymers, i.e., propylene-based polymers, produced therefrom. The present procatalyst compositions improve catalyst selectivity, catalyst activity, procatalyst morphology and polymer particle morphology, and improve hydrogen response during olefin polymerization.
US09315585B2 Anti-GD2 antibodies
In this application are described chimeric, humanized, affinity matured, stability enhanced, and bispecific Anti-GD2 antibodies and fragments thereof. Also provided are methods of using individual antibodies or compositions thereof for the detection, prevention, and/or therapeutical treatment of GD2-related diseases, in particular, neuroblastoma.
US09315584B2 LH-type bispecific antibody
Provided are a novel diabody type bispecific antibody, the function of which as a bispecific antibody is improved to provide a higher additional value, such as cost saving caused by a reduction in dose, to a drug; and a method for producing the same. A humanized diabody type bispecific antibody (LH-diabody type bispecific antibody) characterized in that an L-chain is located in the N-terminal side in each polypeptide (LH type); a humanized high-functional bispecific antibody which contains said LH diabody type bispecific antibody; a nucleic acid molecule encoding both of two kinds of single-stranded polypeptides constituting said bispecific antibody; and a method for producing said antibody which comprises culturing a host cell having been transformed by an expression vector containing said nucleic acid molecule.
US09315583B2 Assays for detecting antibodies specific to therapeutic anti-IgE antibodies and their use in anaphylaxis
The invention provides methods and reagents useful for detecting anti-drug antibodies of IgE isotype to therapeutic anti-IgE antibodies, and methods for assessing risk of anaphylaxis to administration of a therapeutic anti-IgE antibody.
US09315582B2 Anti-endoglin antibodies and knockin mice expressing novel human/mouse chimeric endoglin
Provided are compositions and methods that relate to prophylaxis and therapy of angiogenesis associated disease and includes novel knockin mice which express novel human/mouse chimeric endoglin, vectors for use in making such mice, and murine embryonic stem cells comprising the novel human/mouse transgene. Also provided are anti-human endoglin monoclonal antibodies (mAbs) which can be used as antiangiogenic agents for prophylaxis or therapy of human tumor angiogenesis and human angiogenesis-associated diseases having excessive vascularization. The mAbs do not cross react with murine endoglin. Also provides are methods for using the anti-human endoglin mAbs for prophylaxis or therapy of human tumor angiogenesis and for angiogenesis-associated diseases having excessive vascularization.
US09315576B2 Antigen binding polypeptides
The invention relates to a platform technology for production of antigen binding polypeptides having specificity for a desired target antigen which is based on the conventional antibody repertoire of species in the family Camelidae, and to antigen binding polypeptides obtained using this technology platform. In particular, the invention provides an antigen binding polypeptide comprising a VH domain and a VL domain, wherein at least one hypervariable loop or complementarity determining region (CDR) in the VH domain or the VL domain is obtained from a VH or VL domain of a species in the family Camelidae.
US09315571B2 Specific binding members for NGF
Specific binding members for Nerve Growth Factor (NGF), in particular anti-NGF antibody molecules, especially human antibody molecules, and especially those that neutralize NGF activity. Methods for using anti-NGF antibody molecules in diagnosis or treatment of NGF related disorders, including pain, asthma, chronic obstructive pulmonary disease, pulmonary fibrosis, other diseases of airway inflammation, diabetic neuropathy, cardiac arrhythmias, HIV, arthritis, psoriasis and cancer.
US09315568B2 Cadherin-11 EC1 domain antagonists for treating inflammatory joint disorders
The present invention relates to Cadherin-11 antagonists and compositions comprising Cadherin-11 antagonists. The invention also relates to methods for treating inflammatory joint disorders, such as rheumaotid arthritis, in a mammalian subject by administering a therapeutically effective amount of a Cadherin-11 antagonist.
US09315566B2 Pathogenic mycobacteria-derived mannose-capped lipoarabinomannan antigen binding proteins
Described herein are antigen binding proteins that bind to pathogenic mycobacteria-derived Mannose-Capped Lipoarabinomannan (ManLAM) and methods and kits for using and making the antigen binding proteins. Also described herein are antigen binding proteins that bind to the alpha 1-2 linkage mannose caps of ManLAM, antigen binding proteins that bind to a mannose cap with up to three alpha 1-2 linked mannose residues, and antigen binding proteins that bind to LAM with a mannose sugar capping motif.
US09315560B2 Purification of VWF for increased removal of non-lipid enveloped viruses
The present invention provides methods for purifying Von Willebrand factor (VWF) for increased removal of non-lipid enveloped viruses.
US09315558B2 Use of interleukin 10 mRNA transfected macrophages in anti-inflammatory therapies
The present invention relates to the field of cell-based therapeutics. Specifically, the invention is concerned with a composition comprising a macrophage overexpressing interleukin 10 (IL-10) from transfected IL-10 encoding mRNA for use as a medicament. Moreover, a method for manufacturing a medicament for treating and/or preventing inflammation or a disease or disorder associated therewith comprising the steps of obtaining a macrophage from a sample of said subject, transfecting mRNA encoding IL-10 into said macrophage, and formulating said macrophage in a composition suitable for administration to the said subject, whereby the medicament is manufactured. Finally, a kit is provided for manufacturing such a medicament.
US09315557B2 IL-17A binding molecules and medical uses thereof
The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
US09315556B2 Compositions and methods
The present invention is directed to a polypeptide which comprises: (i) an Rv1753c protein sequence; (ii) a variant of an Rv1753c protein sequence; or (iii) an immunogenic fragment of an Rv1753c protein sequence. In other aspects the invention is directed to associated polynucleotides, fusion proteins and methods for the treatment or prevention of tuberculosis.
US09315551B2 Porcine circovirus type 2 vaccines
The present invention is based on the ORF3 gene of Porcine Circovirus Type 2 (PCV2) and the identification of tis apoptotic role. This discovery has led to the development of an attenuated live vaccine against PCV2.
US09315550B2 Beta sheet tapes ribbons in tissue engineering
There is described a material comprising tapes, ribbons, fibrils or fibers characterized in that each of the ribbons, fibrils or fibers have an antiparallel arrangement of peptides in a β-sheet tape-like substructure wherein the material comprises a pair of self assembling complementary polypeptides.
US09315546B2 Growth hormone secretatogue receptor antagonists and uses thereof
The present invention provides novel peptides that can modulate the ghrelin receptor (growth hormone secretagogue receptor, GHS-R1a and sub-types, isoforms and variants thereof). These peptides are useful as antagonists of the ghrelin receptor as well as inverse agonist, partial agonist or a combination of these activities as medicaments for treatment and prevention of a range of medical conditions including, but not limited to, metabolic and/or endocrine disorders, gastrointestinal disorders, cardiovascular disorders, obesity and obesity-associated disorders, diabetes, central nervous system disorders, genetic disorders, and hyperpro-liferative disorders.
US09315540B2 Process for the preparation of fulvestrant
The present invention relates to an improved process for the preparation of Fulvestrant (I). Also, provided is novel intermediate of Fulvestrant and a process for the preparation of the same.
US09315537B2 Multiple orthogonal labelling of oligonucleotides
In summary, the present invention concerns a method for multiple orthogonal labelling of oligonucleotides, preferably RNA or DNA, by simultaneously performing the inverse Diels-Alder reaction (DAinv) and the copper-catalyzed click reaction (CuAAC), wherein the method is employed in a single step by just adding the different reaction components together and incubating the aqueous reaction mixture preferably for one hour at room temperature. In detail, the reaction components are one or more N3-modified labels, a copper compound, a stabilizing ligand, a reducing agent and one or more electron-deficient label-modified dienes that are added together with an at least double-modified oligonucleotide having one more nucleotides containing one or more N3-reactive groups and one or more electron-rich dienophiles, wherein a terminal alkyne moiety is preferably used as N3-reactive group(s) and a frans-cyclooctene moiety or norbornene is preferably used as electron-rich dienophile(s), more preferably frans-cyclooctene. Therefore, the present invention provides a one-pot method for post-synthetic multiple orthogonal labeling of oligonucleotides, which allows the site-specific introduction of more than one label, preferably of at least two labels into oligonucleotides after solid-phase synthesis, wherein the DAinv takes place on the dienophile modification only and the CuAAC selectively takes place on the N3-reactive group modification.
US09315536B2 Self-assembling oligonucleotides and methods
A composition comprising individual single-stranded oligonucleotides capable of self assembling to form a pair of complementary, substantially contiguous single strands of a double-stranded nucleic acid filament, and a method for forming such filaments are disclosed.
US09315533B2 Lactose crystallisation
The invention relates to a method of crystallizing lactose from a lactose-containing liquid comprising the steps of providing a lactose-containing liquid comprising less than 80% by weight total solids, providing an evaporator system that comprises a heat exchanger and an evaporation vessel, the heat exchanger comprising a tube or tubes that define a flowpath having an inlet and an outlet, heating the lactose-containing liquid in the heat exchanger to about 50 to about 90° C. such that the lactose-containing liquid passes along the flowpath by forced circulation or thermo-siphoning, concentrating the lactose-containing liquid in the evaporation vessel, to generate crystallized lactose in the lactose-containing liquid in the evaporator system.
US09315530B2 Adsorption of immunopotentiators to insoluble metal salts
Immunopotentiators can be adsorbed to insoluble metal salts, such as aluminum salts, to modify their pharmacokinetics, pharmacodynamics, intramuscular retention time, and/or immunostimulatory effect. Immunopotentiators are modified to introduce a moiety, such as a phosphonate group, which can mediate adsorption. These modified compounds can retain or improve their in vivo immunological activity even when delivered in an adsorbed form.
US09315524B2 Magnetic resonance imaging agents for calcification
The present invention discloses magnetic resonance compatible contrast agents for water-poor structures, such as bone and tissue calcification. In particular, the present invention discloses bisphosphonate-based magnetic resonance imaging contrast agents specific for hydroxyapatite, the calcium salt most commonly associated with malignant calcification.
US09315523B2 Cyclic dinucleosides
Provided herein are compounds of formula Ia: and salts thereof. Also provided are pharmaceutical compositions comprising a compound of formula Ia, processes for preparing compounds of formula Ia, intermediates useful for preparing compounds of formula Ia and therapeutic methods using compounds of formula Ia.
US09315514B2 1,3-dioxanomorphides and 1,3-dioxanocodides
The application is directed to compounds of Formula I and pharmaceutically acceptable salts, prodrugs, and solvates thereof, wherein G, R2-R5, and are defined as set forth in the specification. The invention is also directed to use of compounds of Formula I as synthetic intermediates or to treat disorders responsive to the modulation of one or more opiopid receptors. Certain compounds of the present invention are especially useful for treating pain.
US09315512B2 Crystal of 6,7-unsaturated-7-carbamoyl morphinan derivative and method for producing the same
Stable crystalline forms of a compound represented by the formula (IA): an acid addition salt, and/or a solvate thereof are provided by the present invention. Said crystalline forms are extremely useful as materials for preparing medicines. Novel processes for preparing 6,7-unsaturated-7-carbamoyl morphinan derivatives are also provided by the present invention.
US09315510B2 Method and application of unsymmetrically meso-substituted porphyrins and chlorins for PDT
Biologically active compounds are provided that can be used as photosensitizers for diagnostic and therapeutic applications, particularly for PDT of cancer, infections and other hyperproliferative diseases, fluorescence diagnosis and PDT treatment of a non-tumorous indication such as arthritis, inflammatory diseases, viral or bacterial infections, dermatological, ophthalmological or urological disorders as well as providing methods to obtain them in pharmaceutical quality. One embodiment consists of a method to synthesize a porphyrin with a defined arrangement of meso-substituents and then converting this porphyrin system to a chlorin system by dihydroxylation or reduction, and if more than one isomer is formed separate them by chromatography either on normal or reversed phase silica. In another embodiment the substituents on the porphyrin are selected to direct the reduction or dihydroxylation to the chlorin so that a certain isomer is selectively formed. Another embodiment is to provide amphiphilic compounds with a higher membrane affinity and increased PDT-efficacy. In another embodiment a method to reductively cleave the osmate(VI)ester avoiding the use of gaseous H2S is provided. In another embodiment substituents are identified that via their steric and/or electronic influence direct the dihydroxylation or reduction with diimine so that one isomer is favored. Another embodiment consists of formulate the desired isomer into a liposomal formulation to be injected avoiding undesirable effects like solubility problems or delayed pharmacokinetics of the tetrapyrrole systems.
US09315509B2 Diamine derivatives as inhibitors of leukotriene A4 hydrolase
This invention is directed to compounds of formula (I): where r, q, R, R2, R3, R4, R5a, R5b, R5c, R6a, R6b, R6c, R7, R8, and R9 are described herein, as single stereoisomers or as mixtures of stereoisomers, or pharmaceutically acceptable salts, solvates, clathrates, polymorphs, ammonium ions, N-oxides or prodrugs thereof; which are leukotriene A4 hydrolase inhibitors and therefore useful in treating inflammatory disorders. Pharmaceutical compositions comprising the compounds of the invention and methods of preparing the compounds of the invention are also disclosed.
US09315507B2 Compounds as HIF-1alphainhibitors and manufacturing process thereof
The present invention relates to novel compounds as HIF-1α inhibitors, manufacturing process thereof, and a pharmaceutical compositions. The compounds according to the present invention having inhibition activity against HIF-1α, can be used as a therapeutic prevention and/or treatment for various solid cancers such as colon cancer, liver cancer, stomach cancer and breast cancer. Also, the compounds according to the present invention are useful in the treatment of diabetic retinopathy and rheumatoid arthritis, which are aggravated by HIF-1α-mediated VEGFA expression.
US09315505B2 Heterocyclic compounds and uses thereof
Heterocyclic entities that modulate PI3 kinase activity, pharmaceutical compositions containing the isoquinolone entities, and methods of using these chemical entities for treating diseases and conditions associated with P13 kinase activity are described herein.
US09315504B2 Preparation of 4-((6BR,10AS)-3-methyl-2,3,6B,9,10, 10A-hexahydro-1H-pyrido[3′,4′:4,5]pyrrolo [1,2,3-de]quinoxalin-8-(7H)-yl)-1-(4-fluorophenyl)-1-butanone or a pharmaceutically acceptable salt thereof
The present invention provides methods for the preparation of 4-(3-methyl-2,3,6b,9,10,10a-hexahydro-1H-pyrido-[3′,4′:4,5]-pyrrolo[1,2,3-de]quinoxalin-8-(7H)-yl)-1-(4-fluorophenyl)-1-butanone in free form or a salt thereof.
US09315501B2 Bicyclic heterocycles as BET protein inhibitors
The present invention relates to bicyclic heterocycles which are inhibitors of BET proteins such as BRD2, BRD3, BRD4, and BRD-t and are useful in the treatment of diseases such as cancer.
US09315498B2 Arlethynyl derivatives
The present invention relates to ethynyl compounds of formula I-C1 wherein R1, R2, R2′, R3, R3′, R6, U, V and W are as defined herein and to a pharmaceutically acceptable acid addition salts, to a racemic mixtures, or to its corresponding enantiomers and/or optical isomers and/or stereoisomers thereof, which are allosteric modulators of the metabotropic glutamate receptor subtype 5 (mGluR5).
US09315496B2 Benzopyrone derivative and use thereof
The present invention relates to the field of pharmaceutical chemistry, and in particular, to a benzopyrone derivative and a use thereof. The benzopyrone derivative is compound having a structure of formula (I) or a pharmaceutically acceptable salt thereof. It has been found by experiments that, this type of compounds is useful in prevention or treatment of neuropsychical diseases.
US09315489B2 Compounds and compositions for inhibiting the activity of ABL1, ABL2 and BCR-ABL1
The present invention relates to compounds of formula I: in which Y, Y1, Y4, Y5, Y6, R1, R2, R3 and R4 are defined in the Summary of the Invention; capable of inhibiting the activity of BCR-ABL1 and mutants thereof. The invention further provides a process for the preparation of compounds of the invention, pharmaceutical preparations comprising such compounds and methods of using such compounds in the treatment of cancers.
US09315484B2 Mitochondrial aldehyde dehydrogenase-2 modulators and methods of use thereof
The present invention provides compounds that function as modulators of mitochondrial aldehyde dehydrogenase-2 (ALDH2) activity; and pharmaceutical compositions comprising the compounds. The present invention provides therapeutic methods involving administering a subject compound, or a subject pharmaceutical composition. The present invention further provides assays for identifying agonists of ALDH2.
US09315483B2 Synthesis of deuterated catechols and benzo[D][1,3]dioxoles and derivatives thereof
The present invention provides a convenient and efficient process for the synthesis of d2-benzo[d][1,3]dioxoles.
US09315482B2 Derivatives useful as antiviral agents
The invention relates to compounds of formula (I) for use in the prevention and/or treatment of viral infections: Wherein X, Y, Z, T, R1a and R1b are as defined in claim 1.
US09315481B2 Compounds and methods for treating leukemia
Compounds, and methods and uses of compounds, and pharmaceutical compositions thereof, are described herein for treating leukemia. In particular, compounds, and methods and uses of compounds, and pharmaceutical compositions thereof, are described herein for treating acute lymphoblastic leukemia (ALL) in its various forms.
US09315479B2 Process for preparing pyrrolidine
Process for preparing pyrrolidine of the formula I by reacting 1,4-butanediol (BDO) of the formula II with ammonia in the presence of hydrogen and a supported, metal-containing catalyst, wherein the catalytically active mass of the catalyst, prior to its reduction with hydrogen, comprises oxygen-containing compounds of aluminum, copper, nickel and cobalt and in the range from 0.2 to 5.0% by weight of oxygen-containing compounds of tin, calculated as SnO, and the reaction is carried out in the liquid phase at an absolute pressure in the range from 160 to 220 bar, a temperature in the range from 160 to 230° C., using ammonia in a molar ratio to BDO used of from 5 to 50 and in the presence of 1.0 to 4.5% by weight of hydrogen, based on the amount of BDO used.
US09315477B2 Materials having electron deficient moieties and methods of synthesizing thereof
Various materials and polymers having electron deficient moieties and methods of synthesizing thereof are described herein. Specifically, a C—H bond activation method is disclosed wherein an electron deficient group having one or more activated C—H bonds is coupled to one or more aryl groups to afford materials or polymers which may be used in organic electronic and photonic applications.
US09315475B2 HIV protease inhibitors
The compounds encompassed by Formula I include compounds which are HIV protease inhibitors and other compounds which can be metabolized in vivo to HIV protease inhibitors. The compounds and their pharmaceutically acceptable salts are useful for the prophylaxis or treatment of infection by HIV and the prophylaxis, treatment, or delay in the onset of AIDS. The compounds and their salts can be employed as ingredients in pharmaceutical compositions, optionally in combination with other antivirals, immunomodulators, antibiotics or vaccines.
US09315457B2 Crystalline polymorphic forms of an antidiabetic compound
The present invention relates to polymorphic forms of a compound of formula A: This compound is useful as a glucagon receptor antagonist and serves as a pharmaceutically active ingredient for the treatment of type 2 diabetes and related conditions, such as hyperglycemia, obesity, dyslipidemia, and the metabolic syndrome. Hydrates, hemihydrates, anhydrates and similar polymorphic forms are included.
US09315455B2 Process for isomerizing fused bicyclic structures and preparation of vitamin D analogs comprising the same
The present invention concerns a process of isomerizing trans fused bicyclic derivatives into cis fused bicyclic derivatives and the preparation of vitamin D or analogs thereof comprising said isomerization step.
US09315451B2 Tetracycline compounds
The present invention is directed to a compound represented by Structural Formula (I): or a pharmaceutically acceptable salt thereof. The variables for Structural Formula I are defined herein. Also described is a pharmaceutical composition comprising the compound of Structural Formula I and its therapeutic use.
US09315450B2 Desfesoterodine salts
The invention relates to substantially pure Desfesoterodine salts, Desfesoterodine salts, solid state forms thereof and pharmaceutical compositions comprising one or more of the Desfesoterodine salts and/or solid state forms thereof.
US09315449B2 Substituted pyrazoles as heat shock transcription factor activators
The present invention relates to substituted pyrazole compounds, methods for their discovery, and their research and therapeutic uses, and pharmaceutical Formulations thereof. In particular, the present invention provides substituted pyrazole compounds capable of facilitating HSF1 homotrimerization, and methods of using such compounds as therapeutic agents to treat a number of conditions associated with irregular HSF1 activity.
US09315448B2 Viral inhibitor composition for in vivo therapeutic use
The present invention concerns a pharmaceutical composition comprising a compound of formula A being (2,3(dihydroxy), 5[3(1,2)butadiene], 1(3hydroxy,3methyl,4pentene)benzene) and/or a compound of formula B being (2,3(dihydroxy), 5[3(1,2)butadiene], 2[2methylbutane]benzenal) and/or a compound of formula C being (2,3(dihydroxy), 5[3(1,2)butadiene], 2hydroxy,3butene benzoate) or a combination thereof for use as a medicament or for in vivo use in treatment and prevention of diseases caused by DNA enveloped viruses, DNA non-enveloped viruses, RNA enveloped viruses and RNA non-enveloped viruses.
US09315446B2 Fatty alcohol esters of hydroxycarboxylic acids
Described herein are compositions (e.g., a pharmaceutical composition) and compounds of formula I, methods of making compounds of formula (I) and their use in the treatment and/or prevention of diseases and disorders.
US09315444B2 Use of oligomers of lactic acid in the treatment of gynaecological disorders
The invention relates to the use of one or more oligomers of lactic acid or a lactic acid oligomeric product for the prophylaxis and/or treatment of a disease or condition that benefits from an acidic environment, especially a gynaecological infection including a bacterial infection such as bacterial vaginosis, unspecific colpitis, senile colpitis, cervicitis, and urethritis, a fungal infection, such as candidosis (Candida albicans), cryptococcosis, actinomycosis, or a viral infection, such as Human Immunodefiency Virus (HIV), Herpes Simplex Virus (HSV), Human Papilloma Virus (HPV).
US09315442B2 Method for manufacturing optically active carboxylic acid ester
A method that manufacturers an optically active carboxylic acid ester at high yield and high enantioselectivity is provided. An optically active carboxylic acid ester is manufactured at high yield and high enantioselectivity by reacting a racemic carboxylic acid and a specific alcohol or phenol derivatives in a polar solvent having a dipole moment of 3.0 or higher in the presence of an acid anhydride and an asymmetric catalyst, esterifying one enantiomer of the racemic carboxylic acid at high selectivity, and increasing the amount of esterified carboxylic acid by racemizing the optically active carboxylic acid which is the other enantiomer not used in esterification.
US09315438B2 Optically pure benzyl-4-chlorophenyl-C-glucoside derivative
The present invention belongs to the field of pharmaceutical technology, more specifically relates to optically pure benzyl-4-chlorophenyl-C-glucoside derivatives represented by formulae (II) and (III), a process for preparing these compounds and intermediates thereof, a pharmaceutical formulation and a pharmaceutical composition containing these compounds, and the use of the optically pure benzyl-4-chlorophenyl-C-glucoside derivative as a sodium glucose co-transporter (SGLT) inhibitor in manufacture of a medicament for treating and/or preventing diabetes mellitus (including insulin-dependent diabetes mellitus and non-insulin-dependent diabetes mellitus) or diabetes-associated diseases (including insulin resistance disease and obesity)
US09315436B2 Nonyl alcohols with a low degree of branching and their derivatives
The invention relates to nonyl alcohols with a low degree of branching and derivatives produced using them. In particular the present invention relates to mixture of primary nonyl alcohols in which at least 80% of the alkyl chains are linear and at least 15% of the alkyl chains are branched at the 2-carbon position and its derivatives. The low degree of branching produces derivatives that are more elongated and less bulky that similar derivatives produced with more highly branched alcohols.
US09315435B2 Method for producing hydroxyphenylcyclohexanol compound
A method comprising a step of stirring a composition containing a biphenol compound represented by the formula (1): wherein, R1 and R2 represent each independently an alkyl group having 1 to 3 carbon atoms, and m and n represent each independently an integer of 0 to 2, a secondary alcohol and a nickel catalyst, for producing a hydroxyphenylcyclohexanol compound represented by the formula (2): wherein, R1, R2, m and n represent the same meaning as described above, with the proviso that the above-described secondary alcohol has a different structure from that of the hydroxyphenylcyclohexanol compound represented by the above-described formula (2).
US09315431B2 Process of fluorination in liquid phase
The present invention provides a process of fluorination in liquid phase in a solvent medium of a compound of formula (II) CX1X2=CZCX3X4X5, in which Z represents H, Cl or F, and each X1 represents independently hydrogen or chlorine, given that at least one of the X1 represents a chlorine.
US09315430B2 Reactor components
The present disclosure relates to reactor components and their use, e.g., in regenerative reactors. A process and apparatus for utilizing different wetted areas along the flow path of a fluid in a pyrolysis reactor, e.g., a thermally regenerating reactor, such as a regenerative, reverse-flow reactor, is described.
US09315428B2 Method of treating soil and a method of sequestering heavy metals in soil
The present disclosure describes a method of treating soil and a method of sequestering heavy metals in soil. The method of treating soil includes applying a blend to the soil to form treated soil, the blend including a slag by-product having a soluble compound. The soluble compound includes silicon. The method of sequestering heavy metals includes applying a blend to soil to form treated soil, the blend including a slag by-product having a soluble compound, and forming a substantially inert particle in the treated soil, the substantially inert particle including the blend and the heavy metals.
US09315426B2 Coatings for refractory substrates
A temperature-specific compound applied to refractory substrates having molten metal-contacting surfaces creates a chemically active and viscous surface that dramatically increases the ability of the treated substrate to remove slag, dross and other inclusions from a base metal alloy as it passes through or contacts the substrate. The refractory substrates include molten metal filters used by foundries and metal casters such as reticulated ceramic foam, cellular/honeycomb, silica mesh, and others that rely on their physical or sieving ability to remove particulate impurities from the base alloy being cast. The chemically active surfaces significantly increase filtration efficiency through a treatment process tailored to the specific chemistry of the alloy being filtered, such as ferrous metals that include iron, steel and more. Other refractory substrates such as aluminum oxide, magnesium oxide, zirconium oxide, aluminum silicate, silicon carbide (as common with reticulated ceramic foam filters) and the like may also include the coatings.
US09315425B2 Macroporous ceramic body, method of manufacture and uses thereof
The present embodiments disclosed herein are related to methods of preparing a macroporous ceramic body. According to some embodiments, a first mixture of ceramic-forming components is combined with a polymer network structure to form a second intermediate mixture comprising a polymer network. The polymer network is then removed in the drying and/or sintering step leaving an interconnected open pore network within the ceramic body. In some embodiments, the macroporous ceramic body comprises a three-dimensional, porous network comprising pores of about 3 mm to 11 mm.
US09315424B2 Multi-layer plate device
A method for the joining of ceramic pieces with a hermetically sealed joint comprising brazing a continuous layer of joining material between the two pieces. The wetting and flow of the joining material is controlled by the selection of the joining material, the joining temperature, the time at temperature, the joining atmosphere, and other factors. The ceramic pieces may be aluminum nitride and the pieces may be brazed with an aluminum alloy under controlled atmosphere. The joint material is adapted to later withstand both the environments within a process chamber during substrate processing, and the oxygenated atmosphere which may be seen within the shaft of a heater or electrostatic chuck.
US09315422B2 Manufacture of perfume stones
Perfumed stones adapted to store perfume so as to release the smell over an extended period, and a method of manufacture of perfumed stones, is disclosed. The stones find particular suitability in perfumed jewelry.
US09315420B2 UV-shielding material based on Mg—Al layered double hydroxide and its application in anti-ageing asphalt
The present invention relates to a preparation method for a UV-shielding material based on Mg—Al Layered Double Hydroxide. The material with multi-layered overlay structure is made from Mg—Al double hydroxide layers and interlayer carbonate, its molecular composition is: Mg1-xAlx(OH)2(CO3)x/2.mH2O. The inorganic layers of this material can play a physical shielding role against UV, and the metal elements dispersed on the layer as well as the interlayer anion can play a great role in the chemical absorbing. In addition, by controlling the particle size and the amount of the layers, UV light can be effectively shielded by multi-level reflection and absorption of the multi-level layered structure. Therefore, the material with multi-level chemical and physical shielding properties has a good UV barrier effect for the anti-ageing asphalt, and could significantly increase its UV resistance properties.
US09315417B2 Attachment of a cap to a substrate-based device with in situ monitoring of bond quality
Embodiments generally relate to methods for bonding a cap to a substrate. In one embodiment, the method comprises first providing a ring-cap assembly, comprising a cap and an interposer ring comprising a ring material transparent at an illumination wavelength. A peripheral portion of the ring projects outwards beyond the overlying cap. The portion of the ring bottom surface underlying the projecting peripheral portion of the ring comprises a plurality of downwardly extending fingers. The method further comprises positioning the ring-cap assembly so that the plurality of fingers directly overlies predetermined portions of the substrate top substrate, creating a first bond between a first one of the plurality of fingers and a corresponding first predetermined portion of the substrate top surface, while illuminating and observing the first predetermined portion at the illumination wavelength through the projecting peripheral portion of the ring to determine a quality measure of that first bond.
US09315416B2 Method of manufacturing light-emitting device
A method of manufacturing a light-emitting device including a light-emitting element mounted on a substrate and sealed with a glass. The method includes heating the glass by a first mold that is heated to a temperature higher than a yield point of the glass, the glass contacting the first mold, and pressing the glass against the light-emitting element mounted on the substrate supported by a second mold to seal the light-emitting element with the glass.
US09315414B2 Low-e panels with ternary metal oxide dielectric layer and method for forming the same
Embodiments provided herein describe a low-e panel and a method for forming a low-e panel. A transparent substrate is provided. A metal oxide layer is formed over the transparent substrate. The metal oxide layer includes a first element, a second element, and a third element. A reflective layer is formed over the transparent substrate. The first element may include tin or zinc. The second element and the third element may each include tin, zinc, antimony, silicon, strontium, titanium, niobium, zirconium, magnesium, aluminum, yttrium, lanthanum, hafnium, or bismuth. The metal oxide layer may also include nitrogen.
US09315412B2 Surface flaw modification for strengthening of glass articles
Disclosed are controlled chemical etching processes used to modify the geometry of surface flaws in thin glass substrates and glass substrate assemblies formed therefrom, and in particular glass substrates suitable for the manufacture of active matrix displays that are essentially free of alkali metal oxides such as Na2O, K2O and Li2O.
US09315411B2 Method of manufacturing an optical fibre glass preform
A method of manufacturing an optical fiber preform includes: producing a core rod having a core rod diameter; inserting the core rod into a glass fluorine-doped intermediate cladding tube so as to form a core assembly, the intermediate cladding tube having an inner diameter and an outer diameter, wherein the inner diameter is larger than the core rod diameter, the radial difference between the inner diameter and the core rod diameter defining an annular gap; and applying a negative pressure inside the annular gap; and forming a core preform by heating the core assembly to collapse the intermediate cladding tube around the core rod while maintaining the negative pressure, wherein heating includes moving a heater outside the intermediate cladding tube and along an axial direction of the same, and forming an overcladding region surrounding the core preform so as to form an optical fiber preform.
US09315410B2 Apparatuses for manufacturing glass and methods of managing pulling forces applied to glass ribbon
Methods and apparatuses for managing pulling forces applied to a glass ribbon in a draw apparatus are disclosed. The method includes applying a front-side and a rear-side drive torque to a glass. The method further includes calculating automatically with the at least one electronic controller a front-side and a rear-side average pulling force applied to the glass ribbon and corresponding to a first time period of at least one rotation of the front-side or rear-side stub roller, respectively. The front-side average pulling force and the rear-side average pulling force are compared to establish a pulling force differential between the front-side average pulling force and the rear-side average pulling force. One or more of the front-side drive torque or the rear-side drive torque are modified to decrease the pulling force differential between the front-side average pulling force and the rear-side average pulling force.
US09315409B2 Glass manufacturing apparatus and methods
A glass manufacturing apparatus comprises a forming device configured to produce a glass ribbon and a control device configured to independently operate a first pull roll apparatus and a second pull roll apparatus such that at least one of a first upstream pair of draw rolls rotates with a substantially constant torque and at least one of a first downstream pair of draw rolls rotates with a substantially constant angular velocity. In further examples, methods of manufacturing a glass ribbon are provided.
US09315407B2 Non-transitory computer writeable medium incorporating a processor control associated with a system for producing and supplying a coolant to at least one filtration sub-system, as well as reconditioning and recombining a return flow of used coolant
A system for producing and supplying a coolant to a filtration sub-system, and for reconditioning and recombining a return flow of used coolant. A main reservoir is in two way communication with the filtration sub-system via a clean coolant outlet and a dirty coolant return. An inlet feeds an untreated water supply to a de-ionization canister. A mixing valve in communication with the inlet recombines a remaining untreated portion of the water supply with the de-ionized portion. A mixing pump intermixes the water supply with a chemical concentrate to produce a coolant delivered to a main reservoir. A volume of coolant is drawn through an outlet from the reservoir and communicates the coolant to a particle filter, a chiller, and prior to outputting to the filtration sub-systems. The used return coolant is filtered and reintroduced to the main reservoir.
US09315404B2 Process for reducing inorganics from anionic surfactant solutions
A process comprising contacting deionized water with one or more Strecker sulfonation reaction products of one or more halogenated alkyl ethers in the presence of sulfite, wherein the one or more Strecker sulfonation reaction products each comprise one or more inorganic salts on a dry basis and one or more surfactant components, form a filtration mixture; loading the filtration mixture into a high pressure filtration system containing a membrane having a membrane molecular weight cutoff allowing preferential passage of the inorganic salts, for example, of greater than or equal to 200 Daltons; wherein the high pressure filtration system is operated at a pressure greater than ambient pressure and is configured to cause crossflow of the filtration mixture along a surface of the membrane resulting in a permeate solution which substantially passes through the membrane and a retentate solution which substantially does not pass through the membrane; wherein the permeate comprises less than or equal to 15 weight percent surfactant component, based on the weight of the filtration mixture is provided.
US09315403B1 System for algae-based treatment of water
The inventive technology relates to methods for the algae-based treatment of challenged water. Embodiments of the inventive technology include methods for commercially scalable algal-growth in challenged water. Such methods include, for example a step-wise conditioning process to select and condition algae strains for high growth yields in the presence of challenged water generated from the production of oil and gas or other waste water sources. Such algae-based treatment, in addition to removing harmful chemical compounds from this water may also capture and sequester heavy metal contaminants as well as other compounds for later extraction and processing. The invention also may include embodiments for an algae based desalination system of challenged water, resulting in the production of brine salts and the like. The inventive technology also encompasses an algae-based system to capture and sequester carbon-dioxide from gas and other emissions generated from industrial sources.
US09315397B2 Blue power generation system
The blue power generation system includes an electrolytic system to obtain hydrogen and oxygen from sea water. It also includes a power generating system to supply electrical energy to the electrolytic system and an installation to recombine hydrogen and oxygen to produce clean fresh water. More specifically, the deep-sea electrolytic reaction generate gases rising into reservoirs at sea level. As water is depleted in the electrolytic chamber, a low pressure is created in the electrolytic chamber. The pressure of makeup water required for the electrolytic reaction is used to drive a turbine and generate electrical power. A portion of the electrical power generated is used to drive the electrolytic reaction. The amount of electrical energy created is a direct relation with the depth at which the system is operated.
US09315391B2 Ammonia gas generator and method for producing ammonia in order to reduce nitrogen oxides in exhaust gases
The invention relates to an ammonia gas generator for producing ammonia from an ammonia precursor substance as well as the use thereof in exhaust after treatment systems. The invention further relates to a method for producing ammonia gas to reduce nitrogen oxides in exhaust gases, in particular combustion gases from internal combustion engines such as diesel engines.
US09315388B2 Production of graphene materials in a cavitating fluid
The invention provides a method of producing a graphene material from a starting graphitic material. In an embodiment, the method comprises: (a) dispersing the starting graphitic material in a liquid medium to form a graphite suspension; and (b) introducing the graphite suspension into a hydrodynamic cavitation reactor that generates and collapses cavitation or bubbles in the liquid medium to exfoliate and separate graphene planes from the starting graphitic material for producing the graphene material. The process is fast (minutes as opposed to hours or days of conventional processes), environmentally benign, and highly scalable. The reactor can concurrently perform the functions of graphene production, chemical functionalization, dispersion, and mixing with a polymer to make a composite.
US09315387B2 Graphene base and method of preparing the same
A graphene base, including: graphene; and a substrate, wherein the graphene is formed directly on at least one surface of the substrate, and at least about 90 percent of an area of the surface of the substrate does not have a graphene wrinkle.
US09315382B2 Metal chlorides and metals obtained from metal oxide containing materials
Method and apparatus for preparing at least one metal chloride from metal oxide containing material comprising calcining the metal oxide containing material under temperature conditions sufficient to obtain a calcined product comprising at least one metal oxide; and selectively chlorinating the calcined product to form at least one metal chloride.
US09315380B2 Use of atomic quantum cluster (AQC) as antimicrobial agents and biocides
The invention relates to the use of stable atomic quantum clusters (AQC) with antimicrobial activity. The stable AQCs include at least 500 metal atoms (Mn, n<500), the metals being selected from among Au, Ag, Co, Cu, Pt, Fe, Cr, Pd, Ni, Rh, Pb or bi- or multi-metallic combinations thereof. Said AQCs are used as antimicrobial agents, antifungal agents and biocides at concentrations of the order of between 1 nM and 100 nM or more in relation to atoms of the corresponding metal. The antimicrobial activity is specific to both the type of metal and size of cluster used.
US09315376B2 Planar structure for a triaxial gyrometer
An inertial sensor for measuring information relating to rotation in three orthogonal axes, comprising a support and a vibrating sensitive element secured to the support; the sensitive element having a deformable frame and at least two deformable projections which extend in a plane (X-Y); wherein the inertial sensor extends in the same plane; the deformable frame and the at least two deformable projections have a plane of symmetry parallel to the plane; the at least two projections are rectilinear beams which have an approximately square cross section, are not collinear and are preferably approximately orthogonal to one another; each of the deformable beams being connected by only one end to the deformable frame at a location at which the amplitude of the primary vibration mode is at a maximum; and in that the sensor has a device for detecting each of the secondary vibration modes.
US09315375B2 Method using glass substrate anodic bonding
A bonding technology is disclosed that can form an anodic, conductive bond between two optically transparent substrates. The anodic bond may be accompanied by a metal alloy, solder, eutectic and polymer bond. The first anodic bond may provide one attribute such as hermeticity, whereas the second bond may provide another attribute, such as electrical conductivity.
US09315373B2 Module with nozzle boot for a fuel dispensing unit
A nozzle module for a fuel dispensing unit is described. The nozzle module has a top section attachable to a column module of the fuel dispensing unit, a bottom section attachable to a base module of the fuel dispensing unit, at least one nozzle boot for holding a nozzle, which nozzle boot is arranged between the top section and the bottom section. The nozzle module has an internal channel enabling fluid communication through the nozzle module. A fuel dispensing unit is also described.
US09315370B2 Multi-single serve beverage dispensing apparatus, method and system
A multi-single serve beverage dispensing apparatus, method and system is disclosed. Storage, management and delivery of a desired liquid enhancement cartridge to a beverage preparation positioned in a refrigerator or other liquid dispensing appliance is provided. A liquid dispensing cartridge is inserted and retrieved through a cartridge loading/unloading interface associated with a cabinet body of a liquid dispensing appliance. A storage system having multiple cartridge holding positions for storing and staging a variety of liquid enhancement cartridges is included. An indexing system has a means for moving one or more of the cartridges into a beverage preparation position for preparing and dispensing a beverage.
US09315357B2 Cable bundling assembly
A cable bundling assembly and a method of operation is provided for bundling cables. The assembly has a vertical conveyor which is mounted to a frame for advancing cables. The conveyor is driven by a drive unit and has an entrance side and an exit side. At least one fastener is provided on the conveyor. When an end of a set of cables are releasably secured to the fastener, the cables advance upwardly on an entrance side of the conveyor and downwardly on an exit side of the conveyor as the conveyor is driven by the drive unit. An operator control configured to activate the drive unit is provided. When the operator control activates the drive unit to advance the conveyor, the cables are advanced along the vertical conveyor on a substantially vertical axis and the cables advance from the entrance side of the vertical conveyor to the exit side of the vertical conveyor.
US09315356B2 Sheet processing apparatus having binding unit and image forming system thereof
According to an aspect of an embodiment, a sheet processing apparatus includes: a conveying unit configured to convey sheets; a stacking unit configured to stack the conveyed sheets to form a sheet stack; and a binding unit configured to include a pair of toothed jaw and bind the sheet stack by pressing the sheet stack between the pair of toothed jaw, wherein at least one portion of edges of the toothed jaw is rounded.
US09315352B2 Brake to facilitate dispensing of material from a roll
A rolled material dispenser includes a brake mechanism designed to govern the rolling of a roll of packing material during dispensing of the packing material to reduce unintended tearing of the packing material and improve the user experience of handling such material dispensing. In one example, the brake mechanism includes a first portion configured to engage the roll during normal unloading of material from the roll and a second portion configured to engage the roll to impede rotation of the roll when unloading of material is uneven. An idler roller engages the material being dispensed, which idler roller may be resiliently supported to absorb forces on the material.
US09315350B2 Initiating alignment correction of printed media sheets
Sheet length data is received for printed media sheets passed through a printing device. A length difference between the printed media sheets is calculated, and in response to the length difference exceeding a specified threshold, an alignment correction in a finishing device is initiated to align the printed media sheets.
US09315349B2 Feed apparatus and image recording apparatus
There is provided a feed apparatus including: a fixed support unit having a first support surface configured to support a sheet; a movable support unit having a second support surface configured to support the sheet and configured to move to a first position where the first support surface and the second support surface form one flat surface substantially and to a second position where the second support surface intersects with the first support surface with respect to the fixed support unit; a feed roller configured to feed the sheet supported by the second support surface of the movable support unit positioned at the first position and the first support surface in a feed direction; an arm having one end portion configured to rotatably support the feed roller and the other end portion configured to be swingable with respect to a shaft provided in the fixed support unit; and a separating pad provided at a position, being a position, of the first support surface, including the end on the second support surface side, opposed to the feed roller. The end of a surface of the separating pad on the second support surface side is curved downward rather than the second support surface positioned at the first position.
US09315348B2 Sheet conveyor device and image recording device
A sheet conveyor device includes a first housing having a sheet conveyance path. A second housing is pivotably disposed above the first housing and movable between a first position at which the second housing is adjacent to an upper side of the first housing and a second position at which the second housing is angled relative to the upper side of the first housing. A sheet support member is connected to the first housing and has a sheet inlet communicating with the conveyance path. An interlock mechanism is pivotable about a second rotational axis that is parallel to the first rotational axis in response to movement of the second housing between the first position and the second position to move a cover between a first state and a second state.
US09315346B2 Rotating platform acceleration system and method
A method of accelerating an item with a rotating platform. The rotating platform has a center point, a perimeter, and a radius from the center point to the perimeter. The method delivers the item to a center area of the rotating platform by delivering the item to a first radial distance on the rotating platform; the item has a first speed at the center area and tangential to the first radial distance. Also, while the rotating platform is rotating, the method moves the item, in an apparatus-controlled orderly path, from the center area to a point relative to the rotating platform that is adjacent a perimeter of the rotating platform and that is located at a second radial distance greater than the first radial distance; the item has a second speed tangential to the second radial distance and the second speed is greater than the first speed. Finally, while the rotating platform is rotating, the method moves the item, from the point, to a location beyond the perimeter of the rotating platform.
US09315343B1 Robotic lifting apparatus
An apparatus for separating and moving a selected number of items, such as a sheets, boards or blanks is provided in which a robotic arm is constructed with forks capable of securely compressing a desired number of items therebetween for displacement from a stack of the items. The items to be grasped by the arm are initially separated from the remainder of the stack by a separation mechanism that can be mounted directly to the arm or to a support structure for the stack of items. The separation mechanism engages and lifts the desired number of items from the stack to enable the forks on the arm to engage each side of the items. The apparatus can be quickly reconfigured to engage and remove any desired number of items from the stack and/or to accommodate changes I the shape, size and/or thickness of the items.
US09315342B1 System and method for transporting wire components through pneumatic tubes between wire component processing stations
In accordance with one or more aspects of the disclosed embodiment, a system for transporting wire components during the assembly of wire bundles includes an air-operated tube network connecting a transport source station to a plurality of transport destination stations, the air-operated tube network comprising a junction coupled between the transport source station and the plurality of transport destination stations, and a system controller that includes a wire bundle assembly program, the system controller programmed to automatically transmit wire components from the source station to at least one of the transport destination stations based on the wire bundle assembly program.
US09315340B2 Method for rejecting an article
A method for rejecting an article from a sequence of transported articles, wherein the establishment of a first contact between a pusher and the article to be rejected is detected by at least one measurement signal, and wherein a desired stroke is carried out for diverting the article, starting from the detected contact. Errors regarding a different lateral offset of the articles to be rejected and blind strokes caused thereby can thus be reduced.
US09315335B2 Conveyance system
A conveyance system includes a storage case, a lifting/lowering apparatus, a handover apparatus, and a conveying apparatus. The lifting/lowering apparatus lifts and lowers the storage case to position each substrate stored in the storage case to a receiving position sequentially. The handover apparatus receives the substrate at the receiving position, and hand over the substrate to the conveying apparatus at a handover position. The conveying apparatus includes a pair of belts. The pair of belts is provided such that the belts are spaced apart from each other in a left-right direction. A plurality of profiles associated with each other are provided on the pair of belts, respectively. The profiles associated with each other are configured to move together in a conveying direction, support outer edges of the substrate handed over at the handover position, and position the substrate to a prescribed position.
US09315332B2 Introduction or withdrawal of an elongate member to or from a free body
A method of moving an elongate member (12) along a predetermined axis (A-A) for the introduction or withdrawal thereof to or from a free body (11). The method includes providing an elongate guide surface (18) extending parallel to the predetermined axis, and also providing a plurality of support elements (26) which are slidable on the support surface in a direction parallel to the predetermined axis. The elongate member is supported on the support elements so that at least a major portion of the mass is supported. The elongate member and the support elements are moved along the predetermined axis. Apparatus for moving an elongate member in this manner is also provided.
US09315329B2 Material transfer device
A material transfer device is configured for transferring a number of molded products. The material transfer device includes a control box and a transfer mechanism. The transfer mechanism includes a receiving chamber, a driving device, and a supporting structure. The receiving chamber is located on the control box. The driving device is located on a side surface of the receiving chamber and extends into the receiving chamber. The supporting structure includes a holder, a rotating portion, and a number of supporting plates. The holder is located on the driving device to be driven thereby to move along the receiving chamber. The rotating portion is fixed on the holder. The supporting plates are fixed on the rotating portion. The rotating portion drives the supporting plates to rotate.
US09315326B2 Accumulation pallet conveyor
In an accumulation pallet conveyor (1) with an upper horizontal conveying run (1A) and a lower horizontal return run (1B) the pallets are carried by respective pallet-carrying members (P1) drawn by an endless chain (2). Each pallet-carrying member (P1) has at least one sprocket wheel (3) that engages without turning the chain (2) along the horizontal runs of the conveyor for drawing the respective pallet-carrying member (P1) together with the chain. In the case where a pallet-carrying member is stopped in position along a horizontal run of the conveyor (1) the aforesaid sprocket wheel carried by the pallet-carrying member (P1) starts to turn, enabling movement of the chain with respect to the pallet-carrying member (P1). In the curved stretches of the chain, at each end of the conveyor, the movement of the pallet-carrying member (P1) is caused by an engagement finger (F) that engages the chain and couples therewith only in said curved stretches of the chain. The engagement finger (F) is biassed against the chain by spring means (7) in such a way that in the case where the pallet-carrying member (P1) is stopped in position along the curved stretch of the chain, the chain can continue to move, causing a movement with multiple consecutive jumps of the engagement finger (F).
US09315321B2 Support system for magnetically supporting an object on a support
A support system includes a support, a root magnet, an object, and a cover magnet. The root magnet is fixedly attached to the support. The cover magnet is fixedly attached to the object. The root magnet and the cover magnet are configured to be magnetically attracted to one another such that the object is magnetically attached to the support when the root magnet and the cover magnet are aligned with one another in an attachment arrangement. The root magnet and the cover magnet are configured to magnetically repel one another such that the object is detached from the support when the root magnet and the cover magnet are unaligned with one another in a detachment arrangement.
US09315317B2 Container for eggs
A container for eggs which uniformly orients eggs so that a substantial amount of surface area of the egg is uniformly presented for marking and viewing. The container has receptacles that may include one or more guidance features configured to automatically guide eggs to settle into a preferred resting orientation with the eggs uniformly centered and tilted slightly backward within their receptacles. The receptacles are designed to resist movement of the eggs from their resting orientation during marking, shipping or handling. Optionally, guidance and stabilizing features may cooperate to maintain eggs in a desired resting orientation.
US09315316B2 Water-resistant clamshell carton
A carton suitable for packaging a coil of wire with a payout tube has a cover for selectably closing the open side of a five-sided clamshell. The carton can be loaded by placing the coil and payout tube on the cover and then closing the clamshell over the coil. The clamshell has a payout tube aperture and an entryway that permits the clamshell to fit down over the payout tube with the tube extending through the clamshell. Doors open to permit initial access of the tube to the aperture during closure of the clamshell. The doors then close to prevent the tube from becoming dislodged from the aperture. Guide flaps constrain the coil during closure of the clamshell. The final panel of the carton to be closed is secured on all of its free edges to prevent inadvertent opening of the carton. Fold lines are reinforced with reinforcing tape. The carton blank is laid out to have a waste percentage of less than 20%.
US09315313B2 Dispensing container
An object of the present invention is to facilitate discharge of the content in a dispensing container having a delamination structure so as to minimize the amount of remaining content. In order to achieve this object, a gas is housed in the internal container 11 to thereby form a gas space S therein and the volume of the gas is 4% or more of the volume of the internal container 11. The gas preferably moves rapidly in the internal container 11 when the dispensing container is tilted to a discharge posture in order to discharge the content M from the discharge port 14. The gas may be encapsulated in a gas bag or the gas may be encapsulated in a gas chamber formed in the internal container 11.
US09315312B2 Domed multilayer cushioning article
A cushioning article comprises a flap-cut sheet with a plurality of discrete sets of flaps, with each discrete set of flaps having a plurality of flaps extending outward from the sheet. A plurality of the outwardly extending flaps of each discrete set of flaps are affixed to a discrete cap member, resulting in a composite dome sheet having a plurality of composite domes extending from the flap-cut sheet. A cushioning and thermal protection packaging article for packaging a thermally-sensitive product utilizes a plurality of the layers of the composite dome sheet with each layer separated by a separating sheet. Both the composite dome sheet and the separating sheet can be made of paper.
US09315309B2 Container carrier
A flexible carrier for carrying a plurality of containers within a plurality of corresponding container receiving apertures that includes at least two rows of generally triangular shaped container receiving apertures each having an outer band including a pair of outwardly extending protrusions. The carrier further includes a separation aperture formed between each transverse rank of container receiving apertures whereby a width of the separation aperture is approximately equal to a width between each separation aperture.
US09315301B1 Snack bottle with distensible dispensing cap
A snack bottle with distensible dispensing cap that includes a deformable container portion attachable to a rubberlike dispensing cap, said dispensing cap having a slit opening rendered linearly therein, wherein deformation of the container portion by application of manual pressure thereto distends the slit opening in the dispensing cap, and snacks additional to the container portion are transmissible through the dispensing cap when the slit opening is distended, whereby snacks storable within the container portion are dispensable singlehandedly from said container portion.
US09315299B2 Package having recloseable pour spout
A package having a reclosable pour spout is disclosed, with the package including front and rear package panels which may be joined at respective side edges thereof by inwardly extending side gussets. An upper edge portion of the package is removable, including one of the side gussets, to form a pour spout for dispensing the contents of the package. A fastener strip, which can be detachably connected to itself, extends between confronting inside surfaces of the front and rear package panels, adjacent to the pour spout, whereby the pour spout can be conveniently closed after the package is initially opened. A method of forming the present package is also disclosed.
US09315293B2 Combination dosing chaser device
The present invention is a device for placing two separate liquids in separate compartments and when the device is tipped the two liquids are delivered in succession. First liquid compartment is positioned inside or next to the second liquid compartment with lips positioned to achieve proper delivery.
US09315288B2 Carton having a container and a carrier
A carton for holding a first product and a second product. The carton comprises a container comprising a plurality of panels that extend at least partially around an interior of the container. The plurality of panels comprises a front panel, a first side panel, a second side panel, and at least one back panel. The interior is for holding the first product. The plurality of panels are foldably connected at a bottom edge of the container. A carrier is attached to at least one of the plurality of panels for holding the second product. An attachment flap is foldably connected at the bottom edge of the container. The attachment flap is foldably connected to at least one of the plurality of panels and attaches the carrier to the container.
US09315286B2 Test tube labeling assembly
A portable test tube labeling device provides labeling and tracking of test tubes used in patient care. The device includes a chute extending through a housing. A barrel extending across the chute is rotatable within the housing. Spacers are coupled to the barrel defining a plurality of channels extending along the barrel and receiving one of the test tubes as the barrel is rotated. A printing head and spool assembly are positioned in the housing. A tape is coupled to the spool assembly passing adjacent to the printing head wherein indicia is printable on labels on the tape. As the barrel is rotated, each label is extended from the tape and delivered onto the test tube in each channel. A collar is coupled to the barrel for retaining each of the test tubes in one of the channels between the collar and a base end of the barrel.
US09315283B2 Strapping device with an energy storage means
A mobile strapping device for strapping packaged goods with wrap-around strap, comprising a tensioner for applying a strap tension to a loop of a wrapping strap, and a connector for producing a connection in two areas of the loop of the wrapping strap disposed one on top of the other, and a chargeable energy storage means for storing energy that can be released as drive energy for motorized drive motions at least for the friction welder for producing a friction welded connection and/or for the tensioner, is intended to have high functional reliability and ease of handling despite the possibility of automated production of wrapped straps, at least to a large extent. To this end, it is proposed that the energy storage means of the strapping device comprise a lithium ion battery for providing energy for driving a connector designed as a friction welder.
US09315267B2 Integration of high-efficiency, lightweight solar sheets onto unmanned aerial vehicle for increased endurance
Some embodiments include a kit for increasing endurance of a battery-powered unmanned aerial vehicle (UAV) by incorporating flexible solar cells or applying flexible solar cells on a surface of a UAV or on a surface of a component of a UAV. The kit further include a power conditioning system configured to operate the solar cells within a desired power range and configured to provide power having a voltage compatible with an electrical system of the UAV.
US09315263B2 Method of automatically triggering an emergency buoyancy system for a hybrid helicopter
A method of automatically triggering an emergency buoyancy system (10) for a hybrid helicopter (20) having a fuselage (21), two half-wings (23, 23′), and two propulsive propellers (24, 24′). During the method, said emergency buoyancy system (10) is primed, and then if a risk of said hybrid helicopter (20) ditching is detected, two retractable wing undercarriages (28, 28′) are deployed, each wing undercarriage (28, 28′) being fastened under a respective half-wing (23, 23′) and being provided with at least one immersion sensor (16). Finally, if the beginning of said hybrid helicopter (20) ditching is detected, at least one main inflatable bag (11, 11′) 7B suitable for being arranged under such fuselage (21) and at least one secondary inflatable bag (12, 12′) suitable for being arranged under each half-wing (23, 23′) are inflated so as to ensure that said hybrid helicopter (20) floats in stable manner.
US09315262B2 Skid landing gear having at least one cross-member with rockers, and an aircraft
The present invention relates to landing gear having a first skid, a second skid, a front cross-member, and a rear cross-member. The landing gear includes at least one stiffener arranged on a cross-member, said stiffener having two rockers each extending from an outer end secured to the cross-member, two hinge means for hinging each rocker to a carrier structure, and an elongate link member extending between a first link end hinged to the first rocker to a second link end hinged to the second rocker.
US09315261B2 Keyed brake disk assembly
Friction disks, such as rotors and stators, including keyed wear liners are disclosed. The friction disks may include a core and a replaceable wear liner coupled to each side of the core. The wear liners may include a plurality of keys which engage key notches in the core. The key notches may prevent the wear liners from rotating with respect to the core in response to a shear force, such as a force applied during braking.
US09315259B1 Morphing surfaces for the control of boundary layer transition
A structure configured to modify its surface morphology between a smooth state and a rough state in response to an applied stress. In demonstrated examples, a soft (PDMS) substrate is produced, and is pre-strained. A relatively stiff overlayer of a metal, such as chromium and gold, is applied to the substrate. When the pre-strained substrate is allowed to relax, the free surface of the stiff overlayer is forced to become distorted, yielding a free surface having a roughness of less than 1 millimeter. Repeated application and removal of the applied stress has been shown to yield reproducible changes in the morphology of the free surface. An application of such morphing free surface is to control a boundary layer transition of an aerodynamic fluid flowing over the surface.
US09315255B2 Aircraft comprising a device for influencing the directional stability of the aircraft, and a method for influencing the directional stability of the aircraft
An aircraft including a device for influencing the directional stability of the aircraft is provided. The device includes a control-input device; a flight control device; a sensor device for acquiring the rotation rates, including the yaw rates, of the aircraft; and at least one actuator, which is coupled with ailerons, spoilers, an elevator and a rudder. The flight control device includes a control function generating adjusting commands for the actuators for controlling the aircraft according to control commands. The aircraft includes two tail-mounted flaps, each including an actuator connected with the flight control device, situated symmetrically to each other and on opposite sides of the fuselage, and movable between retracted and extended positions. The control function is designed such that the adjusting commands that are generated on the basis of the control commands depending on the acquired rotation rates include adjusting commands to the actuators of the tail-mounted flaps.
US09315250B1 Systems and methods to generate post-swirl propulsor side forces
Systems and methods for maneuvering an underwater vehicle by generating vehicle maneuvering forces from a propulsor of the vehicle are provided. A post-swirl propulsor is configured such that pitch angles of downstream stator blades can be individually varied. The variation in pitch results in the generation of multiple forces and moments for vehicle control.
US09315244B2 Hold crane as well as pipefeeder vessel with such hold crane
A hold crane (6) for elongate elements (4), such as a pipe hold crane for a pipefeeder vessel (1), includes a main frame (7) and support elements (9-12) supporting the main frame above a hold which is carried out for containing the elongate elements. The support elements allow displacement of the main frame in a longitudinal direction of the hold. Hoisting members are provided which are carried by the main frame for lifting an elongate element from the hold vice versa, the hoisting members including at least two hoisting elements spaced apart in the longitudinal direction of the hold. The hoisting elements are suspended from the main frame and are provided coupling elements for coupling onto an elongate element. Stabilizing elements, which cooperate with the hoisting elements, prevent movement of the coupling elements in transverse direction with respect to the main frame while allowing vertical movement of the coupling elements.
US09315243B2 Buoy for automated data collection and transmittal
A buoy for automated collection and transmittal of data. Select embodiments allow calculation of mass balance using data collected from an ice floe. The buoy is adapted to be inserted into the water through an opening in ice so that the buoy floats with the ice floe, the top of the buoy protruding above the surface of the ice floe. The buoy walls are constructed of white PVC. One section of the buoy incorporates closed cell foam for maintaining buoyancy and a bottom section houses a counterweight for maintaining proper orientation of the buoy in the water, the buoy requiring no support from its surrounds while minimally impacting response of the surrounding ice to it. Multiple sensors are incorporated for gathering data and a satellite transmitter transmits the data to a remote user.
US09315242B2 Releasable mooring systems and methods for drilling vessels
Releasable mooring systems and methods for drilling vessels that may be implemented with dockable and releasable mooring buoys to provide for both a quick disconnect of the mooring system from a drilling vessel and for re-connection of the drilling vessel when the vessel returns to the well site.
US09315240B2 Magnetic drag vessel slowing method and apparatus
The present invention of MagDrag relates to methods and apparatus of a magnetic hull attaching sea anchors to slow down and impair the forward motion of sea vessels. The basic MagDrag device includes four major components, a large magnet, a pump, a sea anchor bag and a buoy.
US09315232B2 Transmission
Disclosed is a transmission comprising: a first driving source configured to provide a rotational force and having a first input shaft; a second driving source configured to provide the rotational force and having a second input shaft; a planetary gear unit including a sun gear, a planetary gear and a ring gear, two of the sun gear, the planetary gear and the ring gear being connected to each of the first input shaft and the second input shaft, and the remaining one being connected to an output shaft; a first one-way clutch disposed between the first driving source and the planetary gear unit; and a second one-way clutch disposed between the second driving source and the planetary gear unit, wherein the first direction and the second direction are set such that the output shaft of the planetary gear unit is rotated in the same direction.
US09315230B2 Hand propelled and steered bicycle
A bicycle. A front bicycle wheel and rear bicycle wheel are connected to a bicycle frame. A drive sprocket drives the rear bicycle wheel. Two hand grippable pivotally connected handles are each connected via a handle drive linkage to the drive sprocket. The pivoting of the handles in an approximately vertical plane controls the rotation of the drive sprocket and spins the rear bicycle wheel. In one preferred embodiment, the bicycle is a stationary bicycle. In another preferred embodiment the bicycle can be steered and taken on the street.
US09315229B2 Bicycle assembly with bottom bracket area
A bicycle assembly can include a main frame having a bottom bracket area to receive a bottom bracket. The bottom bracket area can be made of carbon fiber with one or more embedded seat blanks to serve as bearing surfaces within the bottom bracket area. The disks may be machined to a high tolerance to receive a bottom bracket.
US09315225B2 Segmented track and track segment therefor
A segmented track made of a plurality of elastomeric track segments is disclosed. Each track segment is made of reinforced elastomeric material and is provided, at each end thereof, with a joint element adapted to be connected to the joint element of adjacent track segments. Each track segment generally comprises alternating series of substantially rigid sections and substantially flexible sections. The joint elements of the track segments are substantially located within rigid sections located at the extremities of the track segments. The segment track also comprises inner and outer plates configured to secure the joint elements of adjacent track segments together.
US09315223B2 Light weight integrated tailgate spoiler
A lightweight metal spoiler is integrated with a tailgate of an automotive vehicle. The integrated tailgate spoiler is formed from the same material as the frame or rear portion of the tailgate body, preferably aluminum, in one arrangement and from different materials in another arrangement. First and second spoiler portions are joined together along overlapping, mating, abutting edges. The first and second portions of the tailgate are brazed together at an acute angle and the unitary spoiler is fused to the rear portion of the tailgate body.
US09315220B2 Cab for construction machine
Provided is a cab for construction machine, having an excellent operator protection effect against a lateral load. Provided is a cab disposed on an upper frame of a construction machine, including a pair of rear pillars and a rear panel disposed therebetween. The rear panel includes an outer panel and an inner panel including a plurality of panel portions vertically arranged and a bridge portion partly bridging the panel portions vertically adjacent to each other at a position offset from a lateral center position of the rear panel. The bridge portion forms a low-strength portion having lower strength than that of the panel portions so as to make the low-strength portion include a bending point at which the rear panel is bent when a lateral load acts thereon through an outer rear pillar.
US09315219B2 Tractor
A tractor comprises a seat, a safety frame, a vehicle body frame, right and left attachment brackets, a front frame and a roof frame. The safety frame has two struts standing from right and left side portions rearward from the seat. The right and left attachment brackets are fixed on both right and left outer surfaces of the vehicle body frame. The front frame is formed in a gate shape in front view so as to have right and left lower portions detachably attached to the right and left attachment brackets. The roof frame is detachably attached so as to connect a right or left upper portion of the front frame to a right or left upper portion of the safety frame.
US09315214B2 Support structure for a motor vehicle
A support structure for a motor vehicle includes at least two A pillars, a front wall and a front wall cross beam which is designed as a hollow profile and whose ends are connected to the respectively assigned A pillar. The connection of the front wall cross beam end is established by a torsionally rigid rooting in the A pillar.
US09315213B2 Planar space frame for vehicle structure and housing of components
A planar space frame for a unibody panel of a vehicle comprises a core mounted onto the bottom side of a load bearing panel. The core is a 3-D truss including a series of triangular prisms. The triangular prisms have a specific pattern of alternating triangular openings on each of their three lateral faces. For each triangular prism, triangular openings located on the lateral face which is part of a planar layer are alternating right triangles placed two by two to form rectangular units. The right triangles are arranged to have the edges on each side of the right angles aligned with the edges of the planar layer. The triangular openings located on the two inclined lateral faces of each triangular prism, are alternating isosceles triangles placed two by two to form rhomboid units. This combination of triangles provides structural strength and housing functionality.
US09315206B2 Security arrangement in a multi-function passenger carrier
A multi-function passenger carrier includes a carrier frame and a passenger compartment within the carrier frame, the passenger carrier including first and second means for attaching a first and a second accessory to the carrier frame. The carrier frame includes a security arrangement having a first blocking arrangement for blocking attachment of the first accessory to the carrier frame, a second blocking arrangement for blocking attachment of the second accessory to the carrier frame, first control means for controlling activation and deactivation of the first blocking arrangement, second control means for controlling activation and deactivation of the second blocking arrangement, a connecting member connecting the first control means with the second control means. The first and second control means are arranged to interact through the connecting member to cause the first blocking arrangement to be activated when the second blocking arrangement is inactivated.
US09315203B2 Leveling railway vehicle and related systems and methods
Leveling railway vehicles, leveling secondary suspension systems, lift-systems for suspension systems, and other related systems and methods are shown and described. In one example, a railway vehicle includes a superstructure, a bogey, and a leveling secondary suspension system. The leveling suspension system includes at least one spring positioned between the superstructure and the bogey, and a secondary suspension-mounting lift system (SMLS) interfaced with coil spring. The SMLS includes a spring-mount (SM) and a piston assembly. In operation, pressurized hydraulic fluid acts on the piston and lifts the superstructure, thereby allowing the superstructure's access to be raised to a desired height, e.g. a platform height.
US09315200B1 Wind turbine blade railroad transportation with two axis translation
Airfoil transportation using two railcars. A radius arm connects a deck pivot and a bolster pivot, where the deck pivot is coupled to the first railcar to enable arcuate transverse movement of the bolster pivot. A pair of deck stops on either side of the radius arm limit lateral movement of the first bolster pivot. A bolster supports the airfoil and is coupled to the radius arm by the bolster pivot. A wheel assembly under the radius arm carries the weight of the airfoil as it moves laterally. A bolster lock, lock release, and latch operate to hold the bolster in a fixed angular relationship with the radius until the lock release enables rotation at the deck stops positions. The latch holds the radius arm against the deck stop until the bolster returns to the fixed angular position, where the latch releases the radius arm to further translate laterally.
US09315199B2 Driver's cab and railcar including driver's cab
A driver's cab of a railcar includes: side bodyshells; a roof bodyshell; and an interior panel unit including a pair of side panels located at an inner side of the side bodyshells, a ceiling panel located at an inner side of the roof bodyshell, and a back-surface panel that separates the driver's cab from a passenger room. At least one of the panels includes an opening portion through which an adjusting member can be inserted, the adjusting member being configured to adjust positions of the one panel and the side bodyshell or positions of the one panel and the roof bodyshell. An interior space of the driver's cab is defined by coupling the adjacent panels to one another. The adjusting member adjusts a position of the driver's cab relative to the side bodyshell or the roof bodyshell.
US09315198B2 Cable transportation system bogie, and cable transportation system comprising such a bogie
A cable transportation system bogie extends along a longitudinal axis and has a main frame defining a supporting surface; a platform configured to support at least one car; and an articulated mechanism connected to the main frame and the platform, and configured to transmit pulling force between the main frame and the platform, and to permit movement of the platform with respect to the main frame in any direction.
US09315197B1 Hands accelerating control system
A touch vehicle control system having a gesture interface device with one or more touchless sensors that detect a position of a driver's appendage within a range of movement detected by the sensors. The touchless sensors send a signal to the controller that is indicative of the position of the driver's appendage within the range of movement which is then interpreted to be a vehicle command signal for a vehicle's mechanical system. Command signals include, but are not limited to acceleration, braking, parking brake, turn signals, etc.
US09315195B2 Driver, vehicle, and operational analysis
Disclosed are methods, systems, and software for operation a driver analysis system which includes receiving vehicle operation data corresponding to operation of vehicles by drivers from vehicle monitoring system, processing at least a portion of the vehicle operation data to determine driving performance of at least one driver, generating a driving report which identifies the driving performance of at least one driver, and presenting the driving report, where the driving report includes a driving score and/or eye movement index.
US09315193B2 Speed change control system for vehicles
A speed change control system for reducing shift shocks of clutch-to-clutch shifting is provided. The control system is applied to a vehicle in which a transmission having a plurality of engagement devices is connected to an output side of a prime mover, and in which a gear stage of the transmission is shifted among a plurality of stages by changing engagement states of the engagement devices. The speed change control system is configured to carry out a clutch-to-clutch shifting of the gear stage from a predetermined gear stage to another gear stage by gradually reducing a torque capacity of the predetermined engagement device to be disengaged while gradually increasing a torque capacity of another engagement device to be engaged.
US09315186B1 Apparatus and method for controlling creep torque of hybrid electric vehicle
An apparatus and a method for controlling a creep torque of a hybrid electric vehicle that outputs the creep torque to improve shift feel and fuel consumption of the hybrid electric vehicle, may include the method for controlling a creep torque of a hybrid electric vehicle that may include detecting data of the hybrid electric vehicle for controlling the creep torque, determining whether a vehicle speed is greater than or equal to a predetermined speed and the hybrid electric vehicle is shifting from a current shift stage to 1 stage when the current shift stage is 3 stage or 2 stage, applying a creep torque factor depending on a shift stage and a brake amount when the hybrid electric vehicle is shifting from 3 stage or 2 stage to 1 stage, and controlling a motor to output the creep torque to which the creep torque factor is applied.
US09315182B2 Braking system
A vehicle braking system having a master cylinder and first and second hydraulic braking circuits including respective first and second wheel cylinders for braking first and second wheels. The master cylinder has first and second outlets, first and second pistons associated with the first and second outlets, a fluid reservoir and a master cylinder input member provided with a mechanical coupling to drive the first piston and configured to drive the second piston only through movement of hydraulic fluid. The second hydraulic braking circuit is selectively disengageable from the master cylinder via a separation valve. The second hydraulic braking circuit includes a line coupling a suction side of a pump with the master cylinder reservoir. A pressure control valve is configured to modulate the amount of fluid drawn from the reservoir by the pump. The second hydraulic braking circuit is coupled to the first outlet of the master cylinder.
US09315181B2 Brake control system and method for vehicle
A brake control system and method that include a master cylinder that transmits braking hydraulic pressure to a wheel and a hydraulic power unit that supplies hydraulic pressure to the master cylinder to produce the braking hydraulic pressure transmitted to the wheel. A push rod is operated according to a brake pedal operation and a push rod cylinder is formed for the push rod to perform reciprocal motion in the push rod cylinder. A reaction force producer supplies hydraulic pressure to the push rod cylinder to produce reaction force against the push rod operation. A solenoid within the reaction force producer is operated by electric power to produce the reaction force. A pedal stroke sensor detects a brake pedal stroke and a brake control unit connected to the hydraulic power unit, the reaction force producer, and the pedal stroke sensor, operates the hydraulic power unit and the reaction force producer.
US09315180B2 Braking system for motor vehicles and method for operating the same
A brake system for motor vehicles, which brake system can be actuated both by the vehicle driver and also independently of the vehicle driver in a “brake by wire” operating mode, is preferentially operated in the “brake by wire” operating mode, and can be operated in at least one fall-back operating mode in which only operation by the vehicle driver is possible. The brake system has inter alia an electrohydraulic pressure generating device (5) which outputs a brake system pressure, and a pressure modulation unit which has one inlet valve (6a-6d) and one outlet valve (7a-7d) per wheel brake (8, 9, 10, 11) for setting wheel-specific brake pressures derived from the brake system pressure, wherein the inlet and outlet valves (6a-6d, 7a-7d) output or transmit the brake system pressure when in the non-actuated state.
US09315173B1 Towed vehicle brake controls
A towed vehicle braking system and method for applying brakes to a towed vehicle. The towed vehicle braking system may include a master controller, a brake pedal activation device, and a breakaway cable. The master controller may be mountable in a towing vehicle and may be selectively placed in a trailer mode or a powered vehicle mode. A brake signal wire used to apply braking power to trailer brakes may be used for communication between the master controller and the brake pedal activation device. The brake pedal activation device may use a force sensor to determine that a force applied to a brake pedal of the towed vehicle corresponds to a desired amount of braking force as indicated by the master controller. The breakaway cable may be a combination of a traditional breakaway switch and an electrical cord between the towed and towing vehicles.
US09315171B2 Wiper device
A wiper device includes: a pivot shaft that rotates back and forth within a predetermined angular range; an arm head that is fixed to the pivot shaft; a cover that is mounted to the arm head; and a wiper arm that is pivotally supported on the arm head to come into and out of contact with a surface to be wiped. The wiper arm includes an engagement concave portion that extends in a longitudinal direction of the wiper arm at a side portion in a pivot direction of the wiper arm. The cover includes an engagement convex portion that extends in the longitudinal direction of the wiper arm. Relative movement of the wiper arm and the cover is restricted by engagement between an engagement wall portion of the engagement concave portion and the engagement convex portion.
US09315165B2 Vehicle interior device
A vehicle interior device, in particular to an aircraft interior device, includes at least one power supply interface and at least one power supply unit.The power supply unit is implemented by an energy harvesting unit.
US09315159B2 Vehicle door with a loudspeaker
A vehicle door, comprising an inner door panel and an outer door panel with an inner surface facing the inner door panel, is provided. A loudspeaker which is arranged on the inner door panel, is spaced apart from the outer door panel and is intended for generating acoustic sound waves. A sound-guiding element which is designed to deflect sound waves radiated in the direction of the outer door panel by the loudspeaker and to guide said sound waves into a wet chamber of the vehicle door, which wet chamber is formed between the inner door panel and the outer door panel, and/or into a dry chamber of the vehicle door, which dry chamber is formed on a side of the inner door panel that faces away from the outer door panel.
US09315152B1 Vehicle security system and method
A security system and method for monitoring the inside a vehicle includes a cabin module positioned inside the vehicle having a camera to record video and a microphone to record audio therein. A GPS is in data communication with the cabin processor and configured to generate real time global position data. A cabin transmitter is configured to transmit collected video, audio, and GPS data. A remote monitoring module is displaced from the cabin module and includes a remote receiver and display so that authorities can review the data transmitted from the cabin module. The remote monitoring module can transmit security action instructions back to the cabin module that can control aspects of the vehicle, sound alarms, and emit sound. A trunk module is configured to collect video, audio, and carbon dioxide data from the vehicle trunk so as to monitor if a person has been placed in the trunk.
US09315148B2 Light emissive plastic glazing
A window assembly having a first transparent area and a light emissive area. The panel includes a first transparent layer with an ultraviolet blocking layer and an abrasion layer. The light emissive area includes a light emissive layer that may be an organic light emitting display, an electroluminescent display, a polymer light emitting display or a light pipe configured to receive light from a light source.
US09315143B2 Logistic slider post
The present invention provides vertical mounting posts that include a plurality of spaced openings (either A or E slots) and a slider track with obliquely angled guide channels. Decking beams are selectively adjustable in height along the posts by engaging the openings with end assemblies slideably disposed within the ends of the beams. The posts can accommodate alternative beam end configurations. One configuration includes a foot with angled guide edges slideably captured within the guide channels. An alternate configuration comprises coupled plates that fit directly into the openings and a swivel latched to provide a retaining force. By using industry standard A or E slots, the mounting posts are also compatible with off-the-shelf beams and straps configured for A and E slots.
US09315141B1 Load support carrier and methods of use
A load bearing carrier system for carrying additional cargo in the vehicle or on the carrier itself. The support system increases the wheelbase of the vehicle to stabilize the added weight and extended weight out the back of the vehicle at high speeds. The load bearing structure attaches to the tow vehicle at trailer hitches or directly to the frame of the vehicle. The system includes a receiver hitch or a multiple receiver hitch beam attached across the rear of the tow vehicle attached to the tow vehicle frame. The carrier mounting beam has trailer tongues pinned into said receivers and the attached mounting beam of the carrier has vertical beams near each end to mount the springs, air bags, air shocks, load bearing air cylinders or spring enhanced shocks type of suspension, the cargo platform and attached trailer hitch. The mounting beam has pivot beams to mount the spindles, hubs, brakes, wheels and tires. The suspension forces the pivot beams, spindles or axles, hubs, wheels, and tires to the ground lifting the carrier, cargo, cargo deck, truck, and trailer hitch attached to the cargo deck upward in a load bearing manner.
US09315140B2 Water dispenser
A water dispenser includes a drawer having a rear side provided in the lower portion of a casing and is guided by guiding portions fixed to the casing. Before the casing which stands on a floor surface topples down and before the drawer comes into contact with a floor surface, casters support the front side of the drawer. Normally, axles of the casters are supported on respective front side support portions such that the casters roll on a floor surface. The casters collide against a step, so that the axles are moved to rear side support portions which are located higher than the front side support portions.
US09315136B2 Dump trailer
A dump trailer comprising a U-shaped trailer body having a bottom wall and opposing side walls. The trailer includes a curved front wall and a pivotable tailgate. The front wall is U-shaped when viewed from the top and angles upwardly and forwardly from the bottom wall. A support structure provided adjacent the front wall operatively engages hitch and lift assemblies. The support structure includes spaced-apart supports secured to the front wall; and spaced-apart horizontal beams secured to the supports. The beams extend through apertures in the front wall and into the compartment. This enables the trailer body to be lowered relative to the ground, thus lowering the center of gravity of the trailer. A wheel assembly mounts to the rear end of the trailer via a mounting plate curved complementary to the bottom wall. Cut-outs in the plate reduce the overall weight of the trailer.
US09315135B2 Vehicle seat
A vehicle seat includes: a seat cushion; a seatback; and a headrest. The seatback includes an upper frame and side frames. The side frame includes a side face portion, a first flange portion formed by bending a front side of the side face portion toward a seat inward side, and a second flange portion formed by bending a rear side of the side face portion toward the seat inward side. The upper frame is placed between the first flange portion and the second flange portion so as to be fixed to the flange portions, and the upper frame is connected to the side face portion, so that a relative movement between the upper frame and the side face portion is regulated.
US09315133B2 Heater for an automotive vehicle and method of forming same
There is disclosed a heater for an automotive vehicle or other article of manufacture. The heater typically includes a first conductive medium and a second conductive medium disposed upon a carrier. In a preferred embodiment, the first conductive medium includes a first section and a second section that are electrically connected by a second conductive medium. The second conductive medium preferably exhibits a positive thermal coefficient.
US09315130B2 Articulating head restraint
A head restraint includes a base bracket with support posts that are configured to easily engage a seatback during vehicle assembly and to provide an electrical connection for adjustment actuation of the head restraint. A front link and a rear link pivotally couple with an upper portion of the seatback. A head support member is pivotally coupled with the front and rear links to define a four-bar linkage. The head support member is moveable between fore and aft positions via the front and rear links. A cushion is slidably coupled with a base portion of the head support member and is thereby moveable between upper and lower positions. Separate actuators are contained within a trim enclosure of the head restraint to effectuate adjustments of the cushion between fore and aft positions and upper and lower positions.
US09315127B2 Damper and vehicle seat equipped with the damper
A damper includes a vessel for accommodating a viscous fluid in its interior; hampering walls for hampering the flow of the viscous fluid; a partitioning member which partitions each of interior portions into two chambers and is provided rotatably; a communicating hole formed in the partitioning member so as to allow the two chambers to communicate with each other via a variable passage whose passage cross-sectional area changes; a flow limiter to limit the flow of the viscous fluid in the chamber into the chamber through the communicating hole, when the internal pressure of the viscous fluid accommodated in the chamber has exceeded a fixed value on the basis of the rotation of the partitioning member; and a resilient structure to resiliently urge the partitioning member in a direction with respect to the vessel.
US09315121B2 Vehicle seat recliner
A recliner that connects a seatback to a base in a manner in which a backrest angle is adjustable includes one disk-shaped connecting member and another disk-shaped connecting member, a locking mechanism that locks the relative rotation of the two connecting members, and an outer peripheral ring. The one connecting member has a smaller outer diameter than the other connecting member does. The outer peripheral ring has a joining portion joined to the outer peripheral portion of the other connecting member, an abutting portion bent radially inward so as to abut against the outer peripheral portion of the one connecting member from an outside in the axial direction, and a connecting portion that connects the joining portion to the abutting portion. The connecting portion has a shape in which at least a portion in a circumferential direction thereof extends inclined radially inward from the joining portion toward the abutting portion.
US09315120B2 Comfort recline seat for a vehicle
A comfort recline seat including a seat back, a seat base, a pivotable connection point, a pivotable base structure, linkages, knuckle connectors may enable a seat base cushion and a seat back cushion to be manipulated to create a range of comfortable seating and bed-like surfaces. The seat may be configured such that the seat base cushion and the seat back cushion may be simultaneously adjusted together to reduce gaps or steps between the seat base cushion and the seat back cushion.
US09315111B1 Determining vehicle position using RFID
A method of charging an electric vehicle at a charging station may include driving the vehicle towards the charging station, and using a plurality of RFID tags and one or more RFID readers to determine a relative position of the charging interface of the vehicle with respect to the charge head assembly of the charging station. The method may also include engaging the charge head assembly with the charging head, and charging the vehicle.
US09315105B2 Electrically-driven vehicle and method for controlling the same
A bidirectional charger subjects power supplied from an external power supply to voltage conversion and charges a main power storage device and an auxiliary power storage device. Furthermore, the bidirectional charger is configured to be able to convert power in a bidirectional manner so as to be able to subject power stored in the main power storage device or power stored in the auxiliary power storage device to voltage conversion and to output power to electrical outlet. The electrical outlet is configured to be able to output power to an electrical appliance including a home appliance. When a travel driving force increases during use of the electrical outlet, a PM-ECU controls the bidirectional charger in such a way that power stored in the auxiliary power storage device is subjected to voltage conversion and output power to the electrical outlet.
US09315103B2 Multifunction operation tool and armrest operation device
A multifunction operation tool includes a swing body swingably supported in a front/back direction of a vehicle body and implementing acceleration control on a transmission by swinging in a forward direction and implementing deceleration control on the transmission by swinging in a rearward direction. A grip body arranged on a free end portion of the swing body. A grip part arranged on a first lateral area of the grip body in a transverse direction of the vehicle body and having a convex surface. A vertical lateral surface arranged on a second lateral area of the grip body and which is a lateral surface of the grip part. An operator-facing surface arranged on the second lateral area of the grip body and extending in the transverse direction of the vehicle body from a bottom edge of the vertical lateral surface. Operation switch groups are arranged on the vertical lateral surface and the operator-facing surface.
US09315102B2 Power take-off unit (PTO) with integral shifter
Provided is a power transfer unit, such as a power take-off unit including an input shaft coupled to an input gear for common rotation and axially movable relative to the input gear for engaging a coupling at a first end of the shaft with a drive component, a chamber formed between the input shaft and input gear, and a piston axially movable in the chamber, whereby the piston rotates with the input shaft. Due to the rotation of the piston with the input shaft, a power take-off unit is provided without the need for components to separate the piston from the input shaft.
US09315098B2 Urea solution venting system for vehicle
An urea solution venting system for a vehicle which passes an ammonia component produced from an urea solution supplied for post-processing on an exhaust gas of the vehicle may include an urea solution tank, an urea solution injection pipe that communicates with the urea solution tank to replenish the urea solution tank, a first venting pipe to send an ammonia component produced in the urea solution tank to the urea solution injection pipe, a valve module that has a first outlet for sending the ammonia component in the first venting pipe to the urea solution injection pipe, and has a second outlet through which the ammonia component in the urea solution injection pipe is discharged to the outside, an urea solution injection port to receive an injection gun for injecting an urea solution into the urea solution injection pipe, and a flap that closes the urea solution injection port.
US09315094B2 Working vehicle
There is provided a working vehicle that can continuously drive a working machine by electric power to improve the silence. The hydraulic pump is driven by the power of the motor generator that is driven by the electric power of an external power supply supplied via the power cable. By this means, when a crane operation is performed by the crane apparatus in a workplace with an external power supply, it is possible to continuously drive the hydraulic pump by the power of the motor generator, and therefore to continuously perform the crane operation of the crane apparatus, improving the silence.
US09315091B1 System and method of assembling a vehicle body garnish
A vehicle assembly comprises a structural component that defines a portion of a vehicle body and a garnish member. The structural component is formed of a first metal. The garnish member is formed of the first metal and is fixedly attached via welding or hemming directly to the structural component in a same welding station of a vehicle assembly line as the assembly of the structural component. The garnish member includes a body having an outer surface which defines an exterior surface of the vehicle body.
US09315090B2 Ventilation arrangements for motor vehicles
A ventilation arrangement includes a console with a surface in which a receptacle is formed. An air outlet is moveably mounted on the console for movement between an opening and a closing position. In the opening position the air outlet protrudes from the receptacle and in the closing position is at least partially flush-mounted in the receptacle. Air guiding elements guide air flowing out of an airflow opening of the air outlet. The air guiding elements are at least partially displaceably mounted on a support structure of the air outlet between an opening and a closing position. The air guiding elements in the opening position are displaceable into working positions in which adjacent air guiding elements have a larger intermediate spacing, and in the closing position into rest positions wherein the elements have a smaller intermediate spacing than in the working positions or lie on one another.
US09315089B2 Vehicle air-conditioning control apparatus with idling stop function
An air-conditioning unit for a vehicle that has an idling stop function includes a blower fan; first and second air-outlet ports configured to permit air blown from the blower fan toward first and second portions of a vehicle cabin, respectively; and an air-conditioning controller. The air-conditioning controller is configured to set a target air-outlet port temperature of the air blown from the ports on a basis of a preset temperature and an environmental condition of the vehicle; and, if the blower fan is operating to blow air from both of the ports before the vehicle is brought into an idling stop state, and then the vehicle is brought into the idling stop state, cause a controlled reduction in an air volume blown from at least one of the ports during the idling stop state; and cancel the controlled reduction when the idling stop state is cancelled.
US09315087B2 Torsion profile for a twist beam axle and correspondingly equipped vehicle
A torsion profile for a twist beam axle of a vehicle is provided and includes a base body having an open hollow cross section. The body comprises first and second end portions adjacent a central portion and a cross section having first and second limbs connected by a central web portion, the cross section having a U-shape or a V-shape. At least one of the limbs varies in length along the longitudinal axis of at least one of the first and second end portions. At least one of the limbs has a flange arranged on a free end thereof, the variation in length of the at least one limb providing the first and second end portions with a continuously varying cross section along the length of the base body.
US09315084B2 Adjustable limit bar with sway control
An adjustable limit bar assembly for a suspension system includes an elongated member having a longitudinal axis and an attachment mechanism disposed on an end of the elongated member and configured for attachment to a vehicle frame component. First bumper and second bumpers are co-axially disposed on the elongated member and spaced from a plate connected to an axle by a distance, wherein the distance is adjustable.
US09315081B1 Trailer tow ski system
A trailer tow ski system for assisting in supporting the tongue weight of a trailer hitch during pulling of the trailer. The trailer tow ski system generally includes a ski member having a front lip extending upwardly, a support member extending upwardly from the ski member, a tongue member extending forwardly from the support member, a main coupler attached to the tongue member for removably connected to a ball of a vehicle hitch, a front support structure attached to a front portion of the ski member and to an upper portion of the support member, a rear support structure attached to a rear portion of the ski member and to the upper portion of the support member, and a hitch ball attached to the upper end of the support member. The hitch ball is removably coupled to a coupler of the trailer hitch to support the weight thereof.
US09315076B2 Assembly of pneumatic tire and rim
In an assembly of a pneumatic tire and a rim, in which a tire cavity is formed between the pneumatic tire and the rim by mounting the pneumatic tire on the rim, a noise suppressing body extending in a circumferential direction is disposed inside the tire cavity. The noise suppressing body includes a first sound absorbing material layer arranged apart from an inner surface of a tire tread part through a cavity and a second sound absorbing material layer disposed at the rim side of the first sound absorbing material layer and having lower air permeability than the first sound absorbing material layer.
US09315074B2 Pneumatic vehicle tyre
Vehicle pneumatic tire with belt and carcass. An inner working ply of the belt has first parallel steel strengtheners embedded in rubber oriented at an angle “α” relative to a circumferential direction and satisfy: 10°≦α≦45°. An outer working ply of the belt has second parallel steel strengtheners embedded in rubber oriented at an angle “γ” and satisfy: 10°≦γ≦45°. The inner working ply has a greater axial length. The angles “α” and “γ” have opposite inclination. Another belt ply is arranged between the inner and outer working plies and has third parallel strengtheners embedded in rubber oriented at an angle “β” and satisfy: 0°≦β≦5°. The first and second strengtheners have a breaking force F greater than 1800 N and at 10% of the breaking force F, an extension D satisfies 0.22%≦D≦0.4%.
US09315067B2 Combined writing utensil and light emitter assembly
A combined writing utensil and light emitter assembly ensures that various accessories are readily accessible for use during hunting. The assembly includes a tube having a first end, a second end and a hollow interior configured to receive objects therein. A writing implement is provided having a main body and a tip. The writing implement is positionable within the hollow interior of the tube through the first end of the tube wherein the tip is positioned proximate the second end of the tube when the writing implement is positioned within the hollow interior. An light emitter is coupled to the second end of the tube. A first end cap is coupled to a distal end of the main body with respect to the tip. The first end cap is removably couplable to the first end of the tube for securing the writing implement within the hollow interior.
US09315060B2 Recording apparatus
There is provided a recording apparatus including a movement unit that reciprocates while sliding along guide shafts and sound collection units that are disposed in the movement unit so as to collect a sound generated due to sliding of the guide shafts. According to the recording apparatus configured in this way, it is possible to perceive a change in a sliding state in the movement unit which reciprocates while sliding along the guide shafts.
US09315056B2 Method and inkjet printer for acquiring gap information
A method is provided that is implemented on a control device connected with an inkjet printer, which includes an inkjet head having an ink discharging surface, a head scanning unit reciprocating the inkjet head relative to a recording sheet along a scanning direction parallel to the ink discharging surface, and a wave shape generating mechanism deforming the recording sheet in a predetermined wave shape that has tops of portions protruding in a first direction toward the ink discharging surface and bottoms of portions recessed in a second direction opposite to the first direction alternately arranged along the scanning direction, the method including acquiring gap information related to a gap between the ink discharging surface and each individual one of the tops and the bottoms on the recording sheet, and determining whether the gap information acquired for each individual one of the tops and the bottoms is abnormal.
US09315054B2 Self-adjusting paper bucket for a printer and methods for providing a self-adjusting paper bucket
A self-adjusting paper bucket for a printer is provided, together with methods for providing such a self-adjusting paper bucket. The paper bucket may have a curved base portion for accepting paper rolls of varying widths. A guide may be movably mounted to each side of the base portion. The guides may be movable between a first position extending towards a center of the paper bucket and a second position folded against sides of the paper bucket. A biasing element may be provided for each of the guides for biasing the corresponding guide into the first position. In the first position, the guides may accept a first paper roll having a first width and may center the first paper roll in the base portion. In the second position, the guides may accept a second paper roll having a second width greater than the first width and may center the second paper roll in the base portion.
US09315052B1 Printer and method of controlling a printer
In one embodiment, a printer for printing on labels has a controller that controls how a mount paper is conveyed. The plurality of labels is attached to the mount paper. The controller controls a first conveyance unit and a second conveyance unit such that a feed amount of the mount paper conveyed in a forward direction by the second conveyance unit is smaller than a feed amount of the mount paper conveyed in the forward direction by the first conveyance unit.
US09315048B2 Liquid ejecting apparatus
A target supporting apparatus includes a first supporting member having a plurality of first suction holes open to the front surface of the member and the rear surface thereof; a second supporting member having a plurality of second suction holes formed therein and being stacked on and fixed to the first supporting member, the cross-sectional area of each of the plurality of second suction holes being smaller than the cross-sectional area of each of the plurality of first suction holes; and a sucking unit that sucks in the plurality of first suction holes and hence sucks in the plurality of second suction holes communicating with the plurality of first suction holes. Here, a target which is supported in order for a liquid to be adhered thereto is sucked and held onto a supporting face of the second supporting member due to the driving of the sucking unit.
US09315046B2 Recording apparatus
A recording apparatus includes a recording unit that performs recording on a recording surface of a recording medium, a discharge section that discharges the recording medium, and a first bending member that is in contact with the recording medium which passes through the recording unit in the transport path and is transported toward the discharge section to bend the recording medium, in which the first bending member bends the recording medium in such a manner that the recording surface is directed inside by displacing both side portions of the recording medium in a width direction with respect to a central portion of the recording medium in the width direction of the recording medium at a position on a further upstream side in a direction of the transport than a contact position of the discharge section where a feeding force is applied to the recording medium.
US09315044B2 Label printer
A label printer comprises input means operable by a user to input label data. The label printer also has display means and control means configured to receive said input label data from the input means. The control means is arranged to control the display to display an image of a label defined by said input label data in a label display area. The control means is configured to cause the display to display said image of the label such that a first dimension of the image of the label is decreased with respect to the corresponding dimension of said display area so that all of said image of the label is displayed in said display area.
US09315043B2 Automated devices, systems, and methods for the fabrication of tissue
Described herein are improvements to bioprinting technology that facilitate automation of tissue and organ fabrication processes.
US09315036B2 Ink cartridge
An ink cartridge comprises a main body comprising a first surface, a second surface, and a chamber, configured to store ink, disposed between the first surface and the second surface; an ink outlet portion disposed on the first surface of the main body configured to direct the ink from the chamber to an exterior of the main body; and an electronic circuit board disposed on the main body. The electronic circuit board comprises an electrical interface, a first portion facing a second direction that intersects a first plane that is perpendicular to the first direction, a second portion facing a third direction away from the ink outlet portion that intersects a second plane that is parallel to the first direction, and a connecting portion between the first portion and the second portion. The electrical interface is disposed on an area of the electronic circuit board including the connecting portion.
US09315033B2 Recording apparatus
A recording apparatus includes a housing; a recording head that is provided inside the housing and records an image on paper by ejecting ink on the paper; a case that is attached to the housing in such a manner that the case can be separated from a side wall of the housing; and a first supply tube that supplies ink in a liquid container body contained in the case to the recording head. A through hole is provided in the side wall of the housing so as to allow the first supply tube to pass therethrough, and a through hole is provided in the case so as to allow the first supply tube to pass therethrough. The through hole in the case expands to be larger than the through hole in the side wall.
US09315029B2 Printhead cleaning assembly
System and methods for cleaning printheads and printhead wipers. One embodiment is an apparatus that includes a belt configured to rotate in a loop, and a wiper attached to the belt configured to wipe ink from a printhead. The apparatus also includes a tank configured as a reservoir for a cleaning solution, and a controller configured to drive the belt so that an end of the wiper drags across the printhead when in an upper portion of the loop and submerges in the cleaning solution of the tank when in a lower portion of the loop.
US09315028B2 Method of wiping pagewidth printhead
A method of wiping a pagewidth inkjet printhead. The method includes the steps of: wiping a web transversely across the printhead, the web having a width corresponding substantially to a length of the printhead; and subsequently positioning the web either upstream only or downstream only of the printhead, relative to a media feed direction.
US09315026B2 Method for manufacturing liquid discharge head
A method for manufacturing a liquid discharge head. The method includes a first step of forming a telecentric measurement pattern A by exposure, the telecentric measurement pattern A being part of a measurement pattern that allows determination of inclination of a principal ray caused by an off-axis telecentric degree occurring in a projection exposing device, and a second step of forming a telecentric measurement pattern B by exposure under an exposure condition defocused from an exposure condition in the first step, the telecentric measurement pattern B being another part of the measurement pattern, which allows the determination of the inclination of the principal ray caused by the off-axis telecentric degree occurring in the projection exposing device. The off-axis telecentric degree is determined from an amount of misalignment between relative forming positions of the telecentric measurement patterns A and B and an amount of defocusing.
US09315024B2 Droplet discharging method and droplet discharging apparatus
A droplet discharging method includes: forming a plurality of dots on a first region of a medium, on a second region which is positioned in a −Y direction from the first region, and on a third region which is positioned in the −Y direction from the second region. The dots are formed on the first region by using a first head and a second head to cause a second head use ratio to be constant, the dots are formed on the second region by using the first head and the second head so as to cause the second head use ratio to be increased from a value less than a first set value to a value greater than a second set value greater than the first set value in the −Y direction, and the dots are formed on the third region by using the second head.
US09315023B2 Inkjet printer and printing method
It aims to provide an inkjet printer and a printing method that appropriately performs printing with high accuracy on print objects having various shapes. As a solution therefor, an inkjet printer is configured to perform printing using an inkjet scheme on a print object and includes an inkjet head that discharges ink droplets, a guide rail that retains the inkjet head by making the inkjet head face the print object and that is a Y direction extending member extending in a predeterminedly set Y direction, and an X direction driving section that moves the guide rail in an X direction and upon printing, the inkjet head moves along the guide rail and discharges ink droplets toward the print object, and the X direction driving section includes a ball screw and moves the guide rail in the X direction in accordance with a rotation amount of the ball screw.
US09315013B2 Screen printing apparatus
In a screen printing apparatus, a squeegee is slid on a mask contacting a board to print paste onto the board via pattern holes formed in the mask. The screen printing apparatus includes: a box-like member including a top-plate portion in which first suction hole is formed and which is allowed to contact a lower surface of the board; a blower suction pipe which communicates with an internal space of the box-like member, and which extends outside the box-like member; a motor which sucks air through the blower suction pipe to generate a blower suction force in the first suction hole; and an inverter which changes frequencies of the motor.
US09315012B2 Screen printing pallet assembly and method of using pallet assembly in a screen printing operation
A method of screen printing positionally synchronizes a plurality of pallet assemblies on a first screen printing machine with a plurality of pallet assemblies on a second screen printing machine. A screen printed garment having a properly aligned first image received from the first screen printing machine is transferred on a portion of one of the pallet assemblies on the first screen printing machine to one of the plurality of pallet assemblies on the second printing machine. The properly aligned first image on the garment is in proper positional alignment with a screen printing head on the second screen printing machine such that a second image complimentary to the first image is printed on the garment in proper position on the garment relative to the first image without user intervention to positionally locate the first image relative to the screen printing head on the second machine.
US09315009B2 Exposing printing plates using light emitting diodes
An apparatus comprises: (a) a rotatable drum configured to have a UV-curable printing plate with an ablatable layer thereon, placed thereon; (b) at least one laser beam to image the plate on the drum by ablating some of the ablatable layer according to image data to form an imaged plate; (c) an unloading area onto which a plate is movable when unloaded; and (d) a plurality of UV LEDs configured to cure UV-curable material on at least an imaged portion of the plate during the imaging process, such that imaging of one part of the plate and curing of an imaged portion of the plate occur simultaneously. In another embodiment, the plurality of LEDs are to apply UV radiation to the back of the UV-curable plate or to both the front and back of the UV-curable plate during or after the unloading of the imaged plate.
US09315006B2 Film peeling apparatus
A film peeling apparatus that peels a film attached to a substrate includes a chamber, a transfer unit, and first peeling rollers. The transfer unit is disposed in the chamber to transfer the substrate. The first peeling rollers are disposed in the chamber, each of the first peeling rollers includes a first electrostatic chuck to adsorb a first film attached to the substrate. The first peeling rollers roll the adsorbed first film to peel the first film from the substrate.
US09315003B2 Apparatus for sticking film on display panel
A film sticking device includes a pressing part configured to press a film by contacting a surface of the film and pressing the film. A supporting part is coupled to the pressing part and supports the pressing part. A guiding part is configured to guide the supporting part and move the supporting part between a first position and a second position. The second position is separated from the first position. A body has one end coupled to the guiding part. The supporting part is positioned at the first position when a center part of the pressing part contacts the surface of the film.
US09315002B2 Process and machine for membrane lamination and article produced with same
Embodiments provide a lamination machine for laminating a membrane to a fabric of an article, such as to an inside surface of a backpack. The lamination machine may include an enclosure with a rotating air connection coupled to a top surface of the enclosure. The membrane may be mated with the article, and then a plug may be inserted in a top opening of the article. The plug may be coupled with the rotating air connection. The rotating air connection may pump compressed air into an interior portion of the article, through an inlet in the plug. A heater may heat the area surrounding the article to activate an adhesive disposed between the membrane and the inside surface of the article. Additionally, the rotating air connection may rotate the plug, thereby rotating the article assembly to facilitate distribution of heat.
US09314997B2 Plated steel sheet having plated layer with excellent stability for hot press molding
The present invention relates to a plated steel sheet having a plated layer with excellent stability for hot press molding, and more specifically, to a plated steel sheet having a plated layer with excellent stability for hot press molding in which a LME (Liquid Metal Embrittlement) phenomenon caused by a zinc enrichment region included in the plated layer is suppressed during hot press molding.
US09314996B1 Metal foam containing hollow shells and methods of preparation
Syntactic foam composite comprising hollow metallic shells and a solid metal matrix. The foam composite shows high strength and a favorable strength to density ratio. The composite metal foams can be prepared by various techniques, such as powder metallurgy and casting including aspiration casting.
US09314992B2 Sandwich panels
A structural panel comprising an internal core material having first and second opposing faces, first and second face sheets bonded to the first and second opposing faces respectively, wherein the panel comprises an open-structured sheet, interposed between a first face of the core material and its respective face sheet and the panel comprises less than 200 gsm adhesive.
US09314986B2 Method and system for applying an adaptive perforation cut to a substrate
A method and system automatically and dynamically updates the design of perforation lines in a package design file. It identifies an edge between two facets to which a perforation line is to be applied, determines a length of the edge, and uses the length of the edge and a default cut segment length to determine a number of cut segments that will be included in the perforation line. The method and system also may determine a phasing for the perforation line to ensure that the ends of the line are either a cut or spacer, depending on the desired function or placement of the line.
US09314983B2 Automated door assembly, press, and adhesive therefor
Provided is a system and method of making a door having first and second door skins and an internal frame. The top and bottom surfaces of the frame are coated with an adhesive and the frame is placed on a first door skin. The second door skin is then placed on the opposite surface of the frame. The assembled components are then pressed to bond the first and second door skins to the frame with a press having upper and lower dies configured to impart a larger compression force toward a central area of the door skins. Wear resistant belts or membranes are provided to protect the door skins from being marred by the upper and lower dies during the pressing process.
US09314982B2 Process and apparatus for manufacturing a reinforcing structure for tyres of vehicles
In tire manufacture, a belt structure is made by means of strip-like segments each including parallel cords incorporated into an elastomeric layer, which strip-like segments are sequentially laid down in mutual circumferential side by side relationship on a toroidal support. The apparatus for manufacturing such a reinforcing structure for vehicle tires includes: a feeding unit to supply strip-like elements, each including threadlike elements disposed parallel to each other and at least partly coated with at least one layer of elastomeric material; a laying unit including at least one laying assembly to apply each of said strip-like elements onto a toroidal support according to a predetermined laying angle relative to a circumferential extension direction of the toroidal support itself, the laying unit including at least one presser element movable in contrast relationship against the outer surface of the toroidal support and at least one guide element to keep the strip-like element centered and guide it during laying of same, wherein the guide element includes at least one cavity in which the presser element is at least partly housed during laying of said strip-like element.
US09314978B2 Multi-stage debulk and compaction of thick composite repair laminates
A method for fabricating a repair laminate for a composite part having an exposed surface includes applying a release film to the exposed surface and forming an uncured ply stack assembly on the release film. The uncured ply stack assembly is formed by forming and compacting a series of uncured ply stacks. The release film and ply stack assembly is then removed from the exposed surface. A bonding material is then applied to the exposed surface, and the uncured ply stack assembly is applied to the bonding material. The ply stack assembly and bonding material are then cured.
US09314974B2 Method and apparatus for fabricating contoured laminate structures
A plurality of identical fabrication modules are linked together and configurable to fabricate any of a plurality of differing laminate structures in a family of structures having common features. Each of the fabrication modules is locally adapted to fabricate a section of the laminate structure on a corresponding tool. A controller controls and coordinates automated operation of the fabrication modules.
US09314973B2 Shipping structure and methods of making and using same
A shipping structure is formed from a mixture of small pieces of tumbled glass. The shipping structure can incorporate a wick element to allow the shipping structure to function as a candle. The glass and wax may be from post-consumer materials. The shipping structure can be chilled for use in shipping of materials where cooling of shipped materials will be beneficial. Multiple shipping structures can be combined to house or shield shipped items within a container.
US09314972B2 Apparatus for additive layer manufacturing of an article
Apparatus is for additive layer manufacturing of an article from a material which can be rendered solid locally by application of a focused beam of laser radiation at a planar focal plane. The apparatus includes at least two laser beams, respective scanners for each laser beam for scanning the respective laser beams over a planar field, and a support movable stepwise to allow successive manufacturing layer cycles and for supporting material within the field. The entire planar field is common to each scanner and at least one scanner is tilted with respect to the planar field, and the at least one scanner is provided with a lens arranged to generate a focal plane tilted with respect to that scanner.
US09314970B2 Fluid-dispensing head for a 3D printer
A head assembly for an extrusion-based 3D printer includes: a fluid-dispensing head having a manifold and at least two fluid-dispensing nozzles, of different sizes, which are mounted in communication with a melt chamber in a manifold. Outlets of each nozzle are closed by respective valve members. A rocker serves both to pivot the nozzles to their lowermost nozzle-operating position and to actuate the valve members, for ready switching between the valves, such that the smaller nozzle can be used for high resolution work, and the larger nozzle can be used for bulk infill.
US09314969B1 Three-dimensional printer having an expandable envelope
One embodiment of the present invention provides a method of three-dimensional printing. The method includes a three-dimensional printer printing a first layer of an object onto a surface that is not part of the three-dimensional printer, wherein the first layer is printed while a printing platform of the three dimensional printer is in a first position. The printer is autonomously repositioned in a second position elevated above the first position by being supported either on the three-dimensional object itself or on a scaffold printed separate from the object. The printer prints a second layer of the three-dimensional object onto the first layer of the three-dimensional object while the printing platform is in the second position. The printer may have a plurality of legs for controllably repositioning the printing platform.
US09314967B2 Clamping device for clamping a workpiece, and installation comprising such a clamping device
A clamping device for clamping a workpiece having a constant section includes a base; a head; jaws including a jaw fixed to the base and a jaw facing the other jaw and fixed to the head to clamp the workpiece; a guide to link the head to the base and to allow the displacement of the head in an action direction between a clamping position and an opening position. The guide includes at least two plates parallel one with the other with each plate being linked at a first end to a heel of the base and to the head at a second end opposed to the first end, the first ends and second ends being flexible to allow the plates to pivot in relation to the heel and the head, respectively; the clamping device being in one block of monolithic material such as metal.
US09314962B2 Method of separating strands on a stretching surface
A method of separating strands of a slit web is disclosed. The method includes providing a slit web having a length in a machine direction and running the slit web in the machine direction onto a stretchable surface. The slit web includes multiple strands provided by a plurality of slits extending in a first direction not parallel to a cross-machine direction. The slit web is in contact with the stretchable surface for a path length in the machine direction, and for at least a portion of the path length, the stretchable surface is stretching in the cross-machine direction. The traction between the slit web and the stretchable surface during the stretching at least partially separates at least some of the multiple strands of the slit web in a second direction transverse to the first direction. A method of increasing a width of a polymeric netting is also disclosed.
US09314958B2 Buffer assembly of vacuum molding and cutting machine
Disclosed is a buffer assembly of a vacuum molding and cutting machine, and the buffer assembly includes a lower mold base, at least four hydraulic elements and a movable plate. The lower mold base has at least four installing holes for installing the hydraulic elements respectively, and each hydraulic element includes a piston plunger for propping the movable plate to a predetermined distance. When the cutting thickness is 0.1 mm-0.5 mm of a sheet, the impact force can be absorbed effectively to maintain the parallelism for the cutting, so as to improve the cutting quality and extend the service life of a die cutting tool.
US09314957B2 Blow-molding machine with pressure cylinder with force equalization means for piston compressor
Blow-molding machine for blow-molding plastic containers with at least one blow-molding unit for stretch blow-molding preforms by means of compressed air, wherein the blow-molding unit has a force equalization means, such that at least part of the compression force which occurs is compensated for, wherein the blow-molding unit comprises a pressure piston and pressure cylinder.
US09314947B2 Adhesives, reaction systems, and processes for production of lignocellulosic composites
Adhesives, reaction systems, and processes for the production of lignocellulosic composites. The reaction system comprises a multi-component adhesive and a lignocellulosic substrate. The lignocellulosic substrate comprises a plurality of lignocellulosic adherends and is preferably a mass of wood particles. The multi-component adhesive comprises a multi-functional isocyanate, a hydrophilic polyahl, and an organotransition metal catalyst. The multi-component adhesive is characterized by being formulated into at least two mutually reactive chemical component streams. The process comprises the separate application of the mutually reactive chemical component streams of the multi-component adhesive to the lignocellulosic substrate, followed by forming and pressing the adhesive treated substrate under conditions appropriate for curing the adhesive and forming a lignocellulosic composite article. The adhesives, reaction systems, and processes are particularly well suited for the production of oriented strand board (OSB).
US09314945B2 Method for producing artificial stone using used ground coffee
The present invention discloses the method for producing artificial stone using used ground coffee including the steps of drying the used ground coffee; mixing and stirring resin, color and metal salt initiator thoroughly; then mixing used ground coffee, calcium carbonate or aluminum trihydrate (ATH) or mixtures of both calcium carbonate and aluminum trihydrate and peroxide with mixtures of resin, color and metal salt initiator; then stirring whole mixtures and leaving the mixtures to form a gel; next filling the mold with gelated mixtures and leaving them for setting at room temperature; removing and drying artificial stone in an oven to complete the reaction and to achieve the excellent product; then coating products with waterproof agents (Water Repellant; Water Repellant Preservative) or coated with resin as lacquer.
US09314940B2 Automated concrete structural member fabrication method
A method of fabrication for precast concrete structural members, including providing an automated concrete structural member fabrication system, including at least one casting machine having a self-releasing mold which includes side walls and end dams which are pivotally movable from an open position to a closed position, and a bottom casting surface, where the bottom casting surface, the side walls, and the end dams surround a cavity when the side walls and the end dams are in closed position, and a removable mold core subsystem which is removably positionable within the cavity; moving the mold sides, the mold end dams and the bottom casting surfaces to a closed position; positioning the mold core subsystem within the cavity; filling the cavity with wet concrete; idling the casting machine until the wet concrete has achieved initial set to form an initial set concrete block; automatically releasing the self-releasing mold from the initial set concrete block; and removing the initial set concrete block from the casting machine.
US09314935B2 Floor groover
A floor groover used to facilitate specialized heat welding of floor covering materials. The groover cuts a groove for receiving a welding rod at the edges or seam of abutting pieces of flooring materials. The groover can provide for a groove not only up to the wall, but also up the wall and in the radius of the coved-sticked area. Some embodiments of the groover can provide enhanced freedom of movement, which can be helpful when creating grooves of certain shapes in the flooring.
US09314934B2 Gravity-counterbalanced robot arm
An arm assembly for use in a robot to provide gravity counterbalancing of the robot arms. The arm assembly includes an arm and a drive assembly. The arm assembly includes a differential interconnecting the drive assembly with the arm link. The differential is attached to a torso-side or upper end of the arm link, and the differential is adapted to provide gravity counterbalancing for the predefined mass of the arm link. A pair of half counterweights are provided and arranged to each move in one degree of freedom and to provide two equal counterweights to the differential's two inputs such as input gears, pulleys, or the like. The drive assembly includes two motors that are grounded. In some embodiments, both the motors and the counterweights are spaced apart from the robot's shoulder, i.e., spaced apart from the differential near the robot's pelvis or low in the torso.
US09314932B2 Kinetic and dimensional optimization for a tendon-driven gripper
A tendon-driven robotic gripper is disclosed for performing fingertip and enveloping grasps. One embodiment comprises two fingers, each with two links, and is actuated using a single active tendon. During unobstructed closing, the distal links remain parallel, creating exact fingertip grasps. Conversely, if the proximal links are stopped by contact with an object, the distal links start flexing, creating a stable enveloping grasp. The route of the active tendon and the parameters of the springs providing passive extension forces are optimized in order to achieve this behavior. An additional passive tendon is disclosed that may be used as a constraint preventing the gripper from entering undesirable parts of the joint workspace. A method for optimizing the dimensions of the links in order to achieve enveloping grasps of a large range of objects is disclosed and applied to a set of common household objects.
US09314928B2 Systems, devices, and methods including a wheelchair-assist robot
Systems, devices, and methods are described for providing, among other things, a wheelchair-assist robot for assisting a wheelchair user with everyday tasks or activities at work, at home, and other locations. In an embodiment, the mobile wheelchair-assist robot includes a wheelchair interface component configured to exchange control information with a wheelchair controller. In an embodiment, a wheelchair-assist robot mount assembly is provided for, among other things, electrically and physically coupling a wheelchair-assist robot to an associated wheelchair.
US09314925B2 Mobile robot system and method of controlling the same
A method of controlling a mobile robot system is provided. The method includes at a mobile robot, transmitting a signal while traveling in a traveling region, at a beacon, receiving the signal transmitted from the mobile robot over 360 degrees and determining whether the mobile robot has approached the beacon, at the beacon, transmitting a response signal to the mobile robot if the mobile robot has approached the beacon, and at the mobile robot, performing avoidance navigation to prevent collision with the beacon when the mobile robot receives the response signal of the beacon.
US09314924B1 Predictive robotic controller apparatus and methods
Robotic devices may be trained by a user guiding the robot along target action trajectory using an input signal. A robotic device may comprise an adaptive controller configured to generate control signal based on one or more of the user guidance, sensory input, performance measure, and/or other information. Training may comprise a plurality of trials, wherein for a given context the user and the robot's controller may collaborate to develop an association between the context and the target action. Upon developing the association, the adaptive controller may be capable of generating the control signal and/or an action indication prior and/or in lieu of user input. The predictive control functionality attained by the controller may enable autonomous operation of robotic devices obviating a need for continuing user guidance.
US09314920B1 Illuminated hook for retrieving fallen items
An illuminated hook for retrieving fallen items including a telescoping rod having a top end, a crook disposed proximal the top end, a hinge disposed on the top end, a transparent hook having a cavity, the hook disposed on the hinge, and a plurality of illuminable light fixtures disposed within the cavity. Thus, the illuminated hook provides a flexible light source that shines directly through the transparent hook making it possible to illuminate items directly with the hook, allowing for illumination of areas impossible to illuminate without the pivotable transparent hook, greatly improving the retrievability of the illuminated hook for retrieving fallen items.
US09314919B2 Truck box with reinforced lid
A truck box is provided having a reinforced lid which resists bending, crimping, torqueing and misalignment when being opened and closed, and which avoids the appearance or a wave or roll along the surface of the lid.
US09314912B2 Hand-held power tool with a three-point mounting
A hand-held power tool is disclosed. The power tool has a linear motor with a rotor, an exciter piston that is coupled mechanically to the rotor, and a bearing device with a rotor mounting to support the longitudinal movement of the rotor and an exciter piston mounting to support the exciter piston. The rotor mounting and the exciter piston mounting form a three-point mounting, which is the sole bearing for the rotor and the exciter piston.
US09314908B2 Impact tool
According to an aspect of the present invention, there is provided an impact tool including: a motor drivable in an intermittent driving mode; a hammer connected to the motor; an anvil to be struck by the hammer to thereby rotate/strike a tip tool; and a control unit that controls a rotation of the motor by switching a driving pulse supplied to the motor in accordance with a load applied onto the tip tool.
US09314905B2 Locking pin clamp
A pin clamp is provided, comprising a housing having a bore extending therethrough, therein defining an axis. A shaft in sliding engagement with at least a first portion of the bore comprises an axial hole. A piston coupled to the shaft is in sliding engagement with a second portion of the bore. A clevis has a clevis base and two clevis prongs extending along the axis. The clevis base an axial hole and first and second radial clevis holes, wherein the first and second radial clevis holes are opposed to one another by 90-degrees. The axial hole accepts the shaft, and the clevis base is coupled to the shaft in one of four 90-degree-opposed positions by a screw passing through one of the first and second radial clevis holes and the axial hole. Each clevis prong has a radial prong hole. A locating pin has a mounting portion configured to be coupled to the housing in one of the four 90-degree-opposed positions. A clevis pin selectively couples a tang end of a clamping arm to the clevis through radial prong holes of the clevis prongs. The clamping arm extends and retracts based on a position of the shaft and an engagement between an actuator pin coupled to the housing and a slot in the clamping arm.
US09314903B2 Abrasive article
An abrasive article useful for finishing painted or clear coated surfaces is disclosed. The abrasive article included a structured abrasive layer disposed on a backing that is adhesively attached to nonwoven layer useful for providing conformability and attachment to a hook layer. The structured abrasive layer includes a central aperture and a plurality of surrounding apertures.
US09314901B2 CMP pad conditioner, and method for producing the CMP pad conditioner
This invention relates to a conditioner for a CMP (Chemical Mechanical Polishing) pad, which is used in a CMP process which is part of the fabrication of a semiconductor device, and more particularly, to a CMP pad conditioner in which the structure of the cutting tips is such that the change in the wear of the polishing pad is not great even when different kinds of slurry are used and when there are changes in pressure of the conditioner, and to a method of manufacturing the same.
US09314897B2 Chemical mechanical polishing pad with endpoint detection window
A chemical mechanical polishing pad is provided containing a polishing layer having a polishing surface; and, an endpoint detection window; wherein the endpoint detection window comprises a reaction product of ingredients, comprising: an isocyanate terminated urethane prepolymer having 5.5 to 9.5 wt % unreacted NCO groups, wherein the isocyanate terminated urethane prepolymer is a reaction product of ingredients comprising: an aromatic polyfunctional isocyanate; and, a prepolymer polyol; and, a curative system, comprising: 0 to 90 wt % of a difunctional curative; and, 10 to 100 wt % of an amine initiated polyol curative having at least one nitrogen atom per molecule and an average of at least three hydroxyl groups per molecule. Also provide are methods of making and using the chemical mechanical polishing pad.
US09314893B2 Sharpening fixture, portable sharpening tool and kit
The present invention is a blade sharpening fixture, tool and kit for use with logging equipment with a rotary drum that has dozens of staggered blades mounted thereupon. The sharpening tool clamps onto a single blade of the logging equipment while the blade is still mounted on the rotary drum, so that the blade may be sharpened in the field. The sharpening tool includes a sharpening fixture and a grinder. The sharpening fixture includes a blade clamp for clamping onto the blade; a track attached to a sloped surface that can be positioned parallel or perpendicular to the blade; and a grinder connector assembly for securing the grinder securely and slidably to the track.
US09314890B2 Composite processing machine
A composite processing machine with an automatic swiveling composite turret device. Transmitting and releasing of rotational force to a rotating tool is automatically switched between indexing and locked securing. Included is a clutch-action-coupled rotational force transmission/release switching mechanism (10). A common motor (9) is the drive source for a rotation drive mechanism (7) for transmitting rotational force to a rotating tool (5) and a swivel drive mechanism (8) for swiveling a turret (3). Transmission of rotational force of common motor (9) to rotation drive mechanism (7) is released when turret (3) is slid along swivel shaft part (2) to unlock clutch device (4) and enable turret (3) to swivel, and rotational force of common motor (9) is transmitted to rotating tool (5) when turret (3) is slid back to lock and secure clutch device (4) in an indexed position of turret (3).
US09314887B2 Automatic removing machine, automatic corner lift-off apparatus for polarizer of LCD panel
An automatic corner lift-off apparatus for a polarizer of a liquid crystal display (LCD) panel is disclosed, which is suitable for use in a process of removing a polarizer during manufacturing of an LCD panel and comprises: a front clip, comprising a long arm and a short arm which intersect with each other to substantially form an “L” shape; a back clip, spaced apart from the front clip and being capable of cooperating with the front clip to perform a clipping action; and at least one sensor disposed on the front clip or the back clip, being configured to sense whether the polarizer has been successfully lifted off. Thereby, the present disclosure allows for fully automatic polarizer removing operations and can reduce work-related injuries and improve the success ratio of and efficiency of removing the polarizer.
US09314885B2 Shape memory alloy composite flexible substrates
A programmable shape device is described. The device comprises a wire grid made from a shape memory material. The grid is embedded in a transparent polymer. Under normal conditions, the device can be folded into any shape. Upon actuation, the device reverts back to a programmed parent shape. Such a device can be made into one shape during its desired use and another shape during storage or transportation. Methods of making and using a programmable shape device are described.
US09314879B2 Lead-free solder flux and lead-free solder paste
A principal object of the present invention is to provide a flux which can be used to produce a lead-free solder paste which is excellent in viscosity stability and exhibits excellent wettability at the time of soldering even in atmospheric air. The flux is a lead-free solder flux having a bromine atom concentration of 400 to 20000 ppm based on 0.1 g of the flux and comprising 0.01 to 0.7% by weight of an amine compound (a) represented by the general formula (1): H2N—(CH2)n—X—(CH2)n—NH2 (wherein n represents an integer of 1 to 6 and X represents —NH—CH2CH2—NH— or a piperazine residue).
US09314876B2 Laser welding device
A laser welding device may include: a frame including a lower die supporting at least two sheets of welding objects and an upper die mounted over the lower die to be spaced apart from the lower die; a pressing plate movably mounted on the upper die in a vertical direction and pressing the welding objects; a rotating member mounted on the pressing plate and rotating based on a pressing central shaft of the pressing plate; a tilting member disposed in a direction intersecting the pressing central shaft and connected to the rotating member to be tilted in a vertical direction; and a scanner head reciprocally mounted on the tilting member along a length direction, scanning the laser beam in an X axis and a Y axis, and irradiating the laser beam to the welding object.
US09314871B2 Method for laser engraved reflective surface structures
Techniques or processes for providing markings on products are disclosed. In one embodiment, the products have housings and the markings are to be provided on the housings. For example, a housing for a particular product can include an outer housing surface and the markings can be provided on the outer housing surface so as to be visible from the outside of the housing. The markings may be precisely formed using a laser. Processing may be used to increase reflectivity of the markings.
US09314869B2 Method of recovering a bonding apparatus from a bonding failure
A method of recovering a bonding apparatus from a bonding failure to resume a normal operating state for semiconductor chip fabrication is disclosed. The bonding apparatus comprises: i) a bonding tool for bonding a wire between a semiconductor chip and a substrate; and ii) a position sensor. Specifically, the method comprises the steps of: a) the position sensor determining a position of the bonding tool when the bonding tool contacts a surface to bond the wire to the substrate; b) the bonding apparatus detecting a bonding failure caused by detachment of the semiconductor from the substrate based on the position of the bonding tool; and c) the bonding apparatus detaching the semiconductor chip from the wire.
US09314868B2 Wire inlet nozzle
The invention relates to a wire inlet nozzle (27) for fastening in a coupling (29) of a hose package (21), comprising a wire inlet element (32) and a fastening means (31) for a wire core (26) for guiding a welding wire (9), wherein a main body is formed between the wire inlet element (32) and the fastening means (31) and a cavity (56) is formed in the wire inlet element (32), in which cavity at least one sealing element (57) having an axial opening (59) for guiding the welding wire (9) is arranged. In order to prevent an escape of the protective gas in the wire inlet nozzle (27) in a direction opposite to the main conveying direction of the welding wire (9), the main body forms a first part (54) of the wire inlet element (32), and a second part (55) of the wire inlet element (32) can be detachably connected to the first part (54), and the main body is designed as a separating plane for independently fastening the wire core (26) and the sealing element (57).
US09314867B2 Replaceable machine-mounted male input power connections
A system and method for replaceable machine-mounted male input power connections includes a power connection unit that is at least partially arranged within a housing and configured to transfer power received from a power source to drive a welding process. The power connection unit includes an input configured to receive power from the power source, an output configured to deliver the power received at the input to drive the welding process, and a bus system, configured to connect the input and the output. The power connection unit also includes a male connector having a conductive post extending to a threaded cylindrical shaft. The male conductor forms at least a portion of the input or the output and extends from the housing through a coupling assembly. The coupling assembly includes a correspondingly threaded portion configured to engage the threaded cylindrical shaft of the male connector to the bus system.
US09314866B2 Modification of control parameters based on output power
A system and method is provided for calculating a power output and coordinating the reduction of voltage and wire speed. Specifically, provided is a power circuit for generating welding output power, and a control circuit in communication with the power circuit to modify voltage and wire feed speed based on the calculated welding output power.
US09314862B2 Process for flux coating braze preforms and discrete parts
Systems and methods for evenly applying a flux coating to any number of different shaped parts with a single machine are described. The systems and methods provide advantages in that the flux coating may be applied accurately within 2% to 4% of desired thickness with 85% to 95% of the total yield of flux being applied, this minimizing waste. Thousands of parts may be batch treated with a single machine without operator input.
US09314860B1 Electrical discharge machining automated electrode changer
An electrical discharge machining (EDM) system including an automated electrode changer storing a plurality of electrodes for dispensing one at a time for insertion into the spindle of the system. The automated changer includes an electrode storage unit, an electrode insertion unit, and an electrode removal unit. The specification further discloses a method of electrical discharge machining utilizing, for example, the automated electrode changer.
US09314855B2 Electric boring tool
An electric boring tool comprises an electric motor, a switch trigger, a tip tool driven by driving force of the electric motor, a power transmission mechanism for transmitting the driving force of the electric motor to the tip tool as rotational force and/or hammer force, and a motor control unit for controlling speed of the electric motor in response to an extent of pulling of the switch trigger. The motor control unit subjects the electric motor to low speed control after the electric motor is started up, and controls the speed of the electric motor in response to the extent of pulling of the switch trigger when the load current of the electric motor is set value or greater during the low speed control.
US09314854B2 Ductile mode drilling methods for brittle components of plasma processing apparatuses
A method of drilling holes comprises ductile mode drilling the holes in a component of a plasma processing apparatus with a cutting tool wherein the component is made of a nonmetallic hard and brittle material. The method comprises drilling each hole in the component by controlling a depth of cut while drilling such that a portion of the brittle material undergoes high pressure phase transformation and forms amorphous portions of the brittle material during chip formation. The amorphous portions of the brittle material are removed from each hole such that a wall of each hole formed in the component has an as drilled surface roughness (Ra) of about 0.2 to 0.8 μm.
US09314852B2 Right angle attachment for power tools
A right angle attachment for use with a power tool that includes a housing having a handle portion and a gear case attached to the handle portion and supporting first and second right angle gears wherein the first right angle gear is driven by an input shaft that is connected to the drill and the second right angle gear has an opening therein for receiving a hex bit directly therein. A floating magnet head can surround the hex bit to aid in fastener retention and can be movable out of proximity of the hex bit to facilitate easy removal of the hex bit for replacement. An additional magnet can be disposed within the gear case at the base of the hex bit in order to magnetize the hex bit and further enhance the retention of the fastener therein.
US09314850B2 Clamping and locking devices and support structures for cutting tubes
Systems and devices for cutting annular objects comprising a structure built from t-slot profiles and clamping devices where an vertically adjustable t-slot profile is connected with a cutting assembly comprising a worm gear that turns a cutting blade that cuts into an annular object, and drive wheels that turn the annular object at a much slower rate than the spinning rate of the cutting blade.
US09314847B2 Cemented carbide material
Cemented carbide material comprising tungsten carbide (WC) material in particulate form having a mean grain size D in terms of equivalent circle diameter of at least 0.5 microns and at most 10 microns, and a binder phase comprising cobalt (Co) of at least 5 weight per cent and at most 12 weight per cent, W being present in the binder at a content of at least 10 weight per cent of the binder material; the content of the WC material being at least 75 weight per cent and at most 95 weight per cent; and nanoparticles dispersed in the binder material, the nanoparticles comprising material according to the formula CoxWyCz, where X is a value in the range from 1 to 7, Y is a value in the range from 1 to 10 and Z is a value in the range from 0 to 4; the nanoparticles having a mean particle size at most 10 nm, at least 10 per cent of the nanoparticles having size of at most 5 nm; the cemented carbide material having a magnetic coercive force in the units kA/m of at least −2.1XD+14.
US09314843B2 Powder for magnet
The present invention provides a powder for a magnet which can form a rare earth magnet having excellent magnetic characteristics and which has excellent moldability, a method for producing the powder for a magnet, a powder compact, and a rare earth-iron-boron-based alloy material.
US09314840B2 Intermittent molten metal delivery
Automated processes that dynamically control rate of delivery of molten metal to a mold during a casting process. Such automated processes can use dynamic metal level variation, control pin pulses and/or oscillation during the mold fill and transient portion of the cast. It has been found that such pulses keep metal flowing in a manner that addresses problems, particularly at the beginning of an ingot cast, associated with metal meniscus contracting and pulling away from the mold on the short faces and corners.
US09314836B2 Wear crutches for linking members
A link member with wear crutch, the linking member including a pair of side arms and at least one integrally formed loop end portion, the inner surfaces of the side arms and loop end portion defining a friction surface, the inner surfaces of the respective side arms diverging from one another away from the loop end portion and the wear crutch including two curved surfaces arranged as an outer and an inner surface, the outer surface to abut a surface of the linking member in a loop end portion and the inner surface presenting a wear surface for the linking member, and whereby the outer and inner surfaces intersect one another at opposite ends of the wear crutch along common edge portions, and a pair of substantially parallel locating arms adapted to abut respective surfaces of the linking member such that said common edge portions each engage an adjacent arm in a substantially flush manner when the wear crutch is seated on the linking member.
US09314835B2 Power steering apparatus and method of manufacturing power steering apparatus
A nut is formed by a die forging process in which a die used for the die forging process is released in a direction along the direction of the axis of rotation of the nut.
US09314832B2 Sheet metal member shape forming system and method
A sheet metal member shape-forming system and method includes a mold consisting of a sealing die defining therein a sealing cavity and an air hole and a shape-forming die defining therein a shape-forming cavity, a compressed gas guided through the air hole into the sealing cavity, a sheet metal member placed on the shape-forming die that is pre-heated in an out-mold heating zone prior to deliver to the molding zone, a lift unit controlled to move the shape-forming die and the sheet metal member to the sealing die and to impart an upward pressure on the shape-forming die against the sheet metal member and the sealing die during continuous supply of the compressed gas into the sealing die cavity to compress the sheet metal member against the upward pressure, enabling the sheet metal member to be rapidly compression-molded into a shaped metal component.
US09314831B2 Manufacturing system and methods
In one aspect, a manufacturing system is provided having lobe clamps configured to secure lobes of a spider, drive assemblies configured to pivot the lobe clamps, sensors for detecting the position of the lobe clamps, and a control system operably coupled to the drive assemblies and configured to cause the drive assemblies to pivot the lobe clamps and impart a twist to lobes of the spider. In another aspect, a method is provided that includes twisting lobes of a spider in a first direction toward initial target positions using a machine, permitting the lobes to twist in a second direction toward free state positions, and twisting one or more of the lobes using the machine in response to the one or more lobes having free state positions different than final target positions of the lobes.
US09314829B2 Panel bending machine with swiveling blade
A panel bending machine (1) has a counter-blade (3) and a blank holder (5) shaped so as to clamp a sheet metal panel (4) to be bent. The panel bending machine (1) further comprises a “C” type blade holder (7), the terminals of which can be coupled to at least a first (9) and a second (11) bending blade. The machine (1) further has an actuating mechanism (100) of the blade holder structured to swivel the second blade (11) in two different working positions (P2, P3).
US09314819B2 Anhydride copolymer top coats for orientation control of thin film block copolymers
The use of self-assembled block copolymer structures to produce advanced lithographic patterns relies on control of the orientation of these structures in thin films. In particular, orientation of cylinders and lamellae perpendicular to the plane of the block copolymer film is required for most applications. The preferred method to achieve orientation is by heating. The present invention involves the use of polarity-switching top coats to control block copolymer thin film orientation by heating. The top coats can be spin coated onto block copolymer thin films from polar casting solvents and they change composition upon thermal annealing to become “neutral”. Top coats allow for the facile orientation control of block copolymers which would otherwise not be possible by heating alone.
US09314817B2 Three-dimensional vertically aligned functionalized multilayer graphene
In a method of making a thermal interface material, functionalized graphene sheets are dispersed in a liquid. The liquid is removed through a filter so as to form a filtration cake of aligned functionalized graphene sheets, substantially all of which are parallel to a common plane. At least one block of aligned functionalized graphene sheets is cut from the filtration cake. The block includes a first end face and an oppositely-disposed second end face that are parallel to each other and to which substantially all of the functionalized graphene sheets are transverse. The block also includes two oppositely-disposed sides to which substantially all of the functionalized graphene sheets are parallel. A first layer of a thermally conductive substance is applied to the first end face and a second layer of the thermally conductive substance is applied to the second end face of the block.
US09314816B2 Methods of material hydrophilization by siloxanes containing nitrilopoly (methylenephosphonic acid) or derivatives thereof
A method of imparting hydrophilicity to a surface of a material, which comprises providing a base material comprising a surface; applying and chemically fixing a siloxane oligomer represented by Chemical Formula 1 to the surface of the base material to form a siloxane-modified surface; and applying a phosphonic acid compound represented by Chemical Formula 2 to the siloxane-modified surface and carrying out a reaction therebetween to form an organosiloxane coating: wherein in Chemical Formula 1, R1, R2, and R3 are the same or different, and are each independently hydrogen or a C1 to C3 alkyl group, A is a single bond or a C1 to C5 alkylene group, and n ranges from 2 to 30; GN[CH2PO3H2]2  Chemical Formula 2 wherein in Chemical Formula 2, G is —CH2PO3H2, a group represented by Chemical Formula 3, or a group represented by Chemical Formula 4 as defined herein.
US09314813B2 Precision hand-held system for dispensing viscous materials from a flexible pouch and method of dispensing viscous materials
A precision dispensing system and method of use is disclosed. The system includes a hand-holdable dispensing gun and a flexible pouch for dispensing metered amounts of a flowable material. The pouch is formed of a pair of panels of a flexible sheet material that are sealed together to form a pair of nozzles in communication with the flowable material in the pouch. The panels are cut along lines to form finger grip portions enabling one to tear open the nozzles, while leaving the portion of the pouch that is torn still attached to the pouch. The dispensing gun includes a pair of hinged sections defining an interior chamber. A piston is located at one end of the chamber and an end wall is located at the other end thereof. The end wall has passageway in it and is formed by the hinged sections when they are closed. The pouch is arranged to be disposed within the chamber with its nozzles extending out of the passageway.
US09314803B2 Adjustable slurry spreader plate assembly
A spreader plate assembly for a pumped source of sand, water and rocks. Includes a generally horizontal plate spaced upstanding threaded rods affixed integrally with the plate, a splash guard affixed to the plate and located adjacent to a predetermined edge portion. An angled pipe receiving end attached to a pipe line containing slurry under pressure and an exiting end dispose above the plate located forward of the guard. Spaced arms extend horizontally from the exit end of the pipe and having collars slide on respective rods. Nuts are threaded below and above each collar, for adjusting distance between the exit end and plate to adjust the slurry output. Nuts adjust the collars to be equidistant from the plate, or the nuts on the forward rod can be adjusted to increase the distance of its collar from the plate to control the angle and control the direction of slurry.
US09314801B2 Shower head
The invention proposes a shower head, in particular for showers that are fixed in position, for example an overhead shower. The shower head has various options for the water to exit the jet disk. A switching device is provided to engage these different options individually or in combination. This may function in a way known as such with the use of sloping surfaces that slide along one another. The jet disk itself serves to actuate the switching device, and pressure is exerted by the user in the direction opposite that in which the water jets exit.
US09314800B2 Apparatus and process for high throughput powder production
Apparatuses and processes for forming powder are disclosed. The apparatus includes a chamber having a head plate and an array of aerosol and burner nozzles attached to the head plate for generating aerosols and flames respectively. Powder is produced by atomizing a liquid composition to project an aerosol of droplets into the chamber and heating the aerosol with flames projected by the burner nozzles.
US09314799B2 Apparatus for continual magnetisation of a slurry
An apparatus for inducing magnetism in a flowstream of an at least partially magnetisable particulate feed material suspended in a liquid, in use to condition the flowstream to enhance the subsequent separation process, the apparatus including: a treatment chamber having an inlet and an outlet through which the flowstream respectively enters and exits the chamber; and a magnetic source within the treatment chamber, said magnetic source substantially continuously immersed in and activated with respect to the flowstream.
US09314795B2 Unitary biochip providing sample-in to results-out processing and methods of manufacture
A biochip for the integration of all steps in a complex process from the insertion of a sample to the generation of a result, performed without operator intervention includes microfluidic and macrofluidic features that are acted on by instrument subsystems in a series of scripted processing steps. Methods for fabricating these complex biochips of high feature density by injection molding are also provided.
US09314794B2 Needle port
A liquid leakage between a needle and a needle port is prevented. To this end, a guide section, a passage section, and a tapered section are provided in an in-port path of a needle port. The guide section has an inside diameter larger than the outside diameter of a body of a needle. The passage section has an inside diameter smaller than the outside diameter of the body of the needle and larger than the tip diameter of a tapered portion of the needle. The tapered section connects the guide section and the passage section. The taper angle θ2 of the tapered section is set to be larger than the taper angle θ1 of the tapered portion of the needle, and the width w of the tapered section is set to be smaller than half the difference between the outside diameter of the body and the tip diameter of the needle.
US09314786B2 Reactor for continuous catalyst regeneration with a perforated box for mixing and distributing gases in the oxychlorination zone
A reactor allowing continuous regeneration of catalyst grains having a chamber with an oxychlorination zone superposed on a calcination zone equipped with a pipe for introducing calcination gas and at least one pipe for injecting oxychlorination gas emptying into the inner space. Each gas passage has a gas evacuation device that is permeable to gas and impermeable to catalyst grains.
US09314785B1 Ketonization process using oxidative catalyst regeneration
Processes for fatty acid ketonization and alcohol dehydration, wherein an alumina catalyst disposed in, or removed from, a reaction zone may be regenerated by contacting the catalyst with steam during or after a coke oxidizing step. In an embodiment, such processes may provide C2-C43 alkenes. In another embodiment, such processes may provide C11-C43 ketones, which can be deoxygenated to give saturated hydrocarbons, unsaturated hydrocarbons, and mixtures thereof. Base oils and transportation fuels may be produced via such processes.
US09314784B2 Olefin dimers and method for producing and washing olefin dimers
The process for producing an olefin dimer of the present invention includes a first step of carrying out a dimerization reaction of an olefin in the presence of a solid phosphoric acid catalyst in which phosphoric acid is supported on inorganic support particles at a reaction temperature of 55 to 300° C. by introducing into a reactor an olefin-containing raw material containing water in an amount of 10 ppm by mass or more and less than the saturated water content at the reaction temperature, thereby preparing a reaction product containing an olefin dimer, a second step of washing the reaction product prepared in the first step at a temperature of 50° C. or higher using an alkaline substance-containing water adjusted to pH 8 to 13 and a third step of washing the reaction product after the alkaline washing in the second step with water at a temperature of 0 to 110° C., thereby preparing an olefin dimer.
US09314780B2 Process for producing light olefins by using a ZSM-5-based catalyst
The present invention relates to a catalyst composition useful in a process for producing lower olefins from a oxygenate feedstream, a process for producing said catalyst composition and a process for producing lower olefins comprising contacting a oxygenate feedstream with the catalyst composition M1-M2-P/ZSM-5 with an oxygenate-comprising feedstream, wherein M1 is one or more basic species, M2 is one or more redox elements selected from Groups 6-8 of the Periodic Table of Elements and Sn and P is phosphorus, wherein said basic species is a molecular entity forming a weak Lewis base and/or a weak Bronsted base in the catalyst composition. In addition thereto, the present invention relates to an integrated process for producing lower olefins from a feedstream comprising hydrocarbons.
US09314777B2 High surface area graphene-supported metal chalcogenide assembly
A composition comprising at least one graphene-supported assembly, which comprises a three-dimensional network of graphene sheets crosslinked by covalent carbon bonds, and at least one metal chalcogenide compound disposed on said graphene sheets, wherein the chalcogen of said metal chalcogenide compound is selected from S, Se and Te. Also disclosed are methods for making and using the graphene-supported assembly, including graphene-supported MoS2. Monoliths with high surface area and conductivity can be achieved. Lower operating temperatures in some applications can be achieved. Pore size and volume can be tuned.
US09314776B2 Composite oxide, preparation method for same, and application thereof
This invention relates to a composite oxide, production and use thereof as a methane selective oxidizing catalyst. The composite oxide has a composition as illustrated by the formula RhRxMoyVzOδ-α, wherein the symbols are as defined in the specification. When used as a methane selective oxidizing catalyst, the present composite oxide provides a high methane conversion and a high selectivity to the aimed products.
US09314775B2 Exhaust gas purifying catalyst and method for producing same
Provided is a non-noble metal-based exhaust gas purifying catalyst which is capable of removing an unreacted material such as carbon monoxide in an exhaust gas at low temperatures. An exhaust gas purifying catalyst of the present invention contains a ceria-based carrier and a complex oxide of cobalt and an additional metal element, said complex oxide being supported by the ceria carrier. The additional metal element contains a metal element that is selected from the group consisting of copper, silver, magnesium, nickel, zinc and combinations of these elements.
US09314773B2 Palladium catalyst
Provided is a palladium catalyst in which palladium (Pd) is used as a catalyst active component, and particularly a novel palladium catalyst which can purify CO and THC with high efficiency even under a fuel-rich atmosphere having a high space velocity (SV). Proposed is a palladium catalyst having a substrate and a catalyst layer that contains palladium acting as a catalyst active component, an inorganic porous material acting as a catalyst support and ceria (CeO2) particles acting as a promoter component, in which a mass ratio (Pd/CeO2) of a content of the palladium in the catalyst layer to a content of the ceria particles in the catalyst layer is 0.0014 to 0.6000.
US09314768B2 Mixture of an adsorbent and a phase change material with an adapted density
Agglomerate comprising a first phase change material (PCM) and a constituent having a density greater than 800 kg/m3 and forming the core of said agglomerate.
US09314764B2 Apparatus for assay, synthesis and storage, and methods of manufacture, use, and manipulation thereof
The invention features methods of making devices, or “platens”, having a high-density array of through-holes, as well as methods of cleaning and refurbishing the surfaces of the platens. The invention further features methods of making high-density arrays of chemical, biochemical, and biological compounds, having many advantages over conventional, lower-density arrays. The invention includes methods by which many physical, chemical or biological transformations can be implemented in serial or in parallel within each addressable through-hole of the devices. Additionally, the invention includes methods of analyzing the contents of the array, including assaying of physical properties of the samples.
US09314760B2 Continuous fixed-bed catalytic reactor and catalytic reaction method using same
A continuous fixed-bed catalytic reactor includes an inflow path for raw material gas for a catalytic reaction and an outflow path for reformed gas, a catalytic reaction container that is connected to the inflow path and the outflow path and holds a clumpy catalyst, catalyst holders that have a ventilation property and hold the clumpy catalyst, and a driving mechanism that moves the clumpy catalyst up and down by moving the catalyst holders up and down.
US09314758B2 Device for neutralizing acid condensates
A device for neutralizing acid condensates includes a condensate collection tank and a cartridge containing a reactant for neutralizing the acids. The cartridge has a condensate inlet opening and a condensate outlet opening. The cartridge is placed at least partly in the tank so that the outlet opening is below a minimum level of liquid in the tank.
US09314757B2 Method and a device for generating a carburizing gas mixture
A method to generate a ternary carburizing gas mixture, using a reaction of selective hydrogenation of acetylene in a stream of hydrocarbons to the form of ethylene, comprising the following steps: heating of the inside of the reactor with an inert gas to an operating temperature for a period of 20 minutes at a temperature of 300° K, passing a mixture of hydrogen and acetylene by the regiospecific catalyst, and moving out the reaction products on the outside after passing the mixture through the regiospecific catalyst, but generation is effected in a continuous mode in the operating temperature range of the regiospecific catalyst between 293° K and 398° K, preferably at a temperature of 350° K.
US09314754B2 Electromagnetic stirring apparatus
The stirring apparatus is an electronic design that generates rotating magnetic fields to drive magnetic stir bars within vials placed above the cover of the stirring apparatus. Below the cover is a magnetics board containing multiple vial groups of four air core coils arranged in rectangular patterns. Each vial group has with two pairs of diagonal coils. The coils in each pair are wired in series and have opposite winding directions. Each pair is driven by a different phase of a stepper motor driver. The vial groups are spaced appropriately for placing one vial above each group. The adjacent coils of adjacent vial groups are driven by the same phase and have the same magnetic direction. The cover contains an array of pole standoffs that matches the coil pattern. The hollow center of each air core coil contains at least a portion of one pole standoff.
US09314752B2 Apparatus for dispersing nanocomposite material
Disclosed herein is an apparatus for dispersing a nanocomposite material. That apparatus includes an inner chamber in which a metal powder, a nanocomposite material and inner pellets are charged. The inner chamber also includes a plurality of apertures each having a smaller diameter than that of each inner pellet. Furthermore, the apparatus includes an outer chamber that surrounds the inner chamber and includes outer pellets in a space between a wall of the inner chamber and a wall of the outer chamber.
US09314743B2 Residential reverse osmosis system
A reverse osmosis system that includes a housing having an inlet port, a permeate port and a concentrate port. The reverse osmosis system further includes a membrane element within the housing and (i) a first connector that has an end which is connected to the inlet port; (ii) a second connector that has an end which is connected to the permeate port; and (iii) a third connector that has an end which is connected to the concentrate port. The end of the first connector fits the inlet port but does not fit the permeate port or the concentrate port. The end of the second connector fits the permeate port but does not fit the inlet port or the concentrate port. The end of the third connector fits the concentrate port but does not fit the inlet port or the permeate port.
US09314742B2 Method and system for reverse osmosis predictive maintenance using normalization data
The present invention can include a reverse osmosis unit, a control system, a display, and/or a memory. The reverse osmosis unit can include a filtration unit, a liquid utilization system, and/or an instrumentation system. The filtration unit includes a plurality of filter banks which each have a plurality of filter unit. The filtration unit receives a feed liquid and generates permeate and concentrate. The permeate is sent to the liquid utilization system, while the concentrate is removed. The instrumentation system can include a plurality of sensors to detect operational data of the feed liquid, permeate, and/or concentrate. Using the operational data and equations, the control unit can calculate the normalized permeate flow rate indicating whether the filters should be cleaned and/or replaced. The operational data and the equations can be used to determine whether the pressure and/or flow can be manipulated without damaging the filters.
US09314741B2 Carbon dioxide recovery apparatus and carbon dioxide recovery method
In one embodiment, a carbon dioxide recovery apparatus includes a heat exchanger which heats a first rich liquid, a flow divider which divides the first rich liquid heated by the heat exchanger into a second rich liquid and a third rich liquid, a first release device which heats the second rich liquid and discharges a first semi-lean liquid, a second release device which heats the third rich liquid and discharges a second semi-lean liquid, and a regeneration tower which heats the first and second semi-lean liquids to generate a lean liquid. The first release device heats the second rich liquid, using the lean liquid. The second release device heats the third rich liquid, using a carbon dioxide-containing steam discharged at the regeneration tower. The heat exchanger heats the first rich liquid, using the lean liquid which has passed through the first release device.
US09314740B2 Chemical looping removal of ventilation air methane
Methane is removed from ventilation air by cycling metal or metal oxide particles in a chemical looping process in one or more reactors where the metal particles are alternately reduced and oxidized, and passing ventilation air through one or more of reactors to convert the air plus methane into reduced air, water and carbon dioxide. In one variation, a hydrogen generator and a regenerator are used to alternatively reduce and oxidize the particles such that ventilation air methane introduced into a combustor provided with hydrogen from the hydrogen generator can be processed in the regenerator to produce air, water and carbon dioxide. Other variations involve using three reactors in the chemical looping process, or an array of parallel inclined plates forming lamellas between upper and lower reactors to keep lighter particles in the upper oxidizer reactor and heavier particles in the lower reducer reactor.
US09314739B2 Process and apparatus for denoxing of flue gases
A process and an apparatus denox flue gases containing carbon monoxide and/or gaseous organic substances with at least one catalyst for catalytic reduction of the nitrogen oxide NOx and a heat exchanger for heating the flue gases from recovery of the residual heat of the denoxed flue gases before the catalytic reduction to a reaction temperature of 160° C. to 500° C. For the best possible denoxing of the flue gases with simultaneous minimization of the externally supplied energy needed, it is envisaged that the losses associated with the heat movement in the heat exchanger will be compensated for by providing at least one stage for regenerative post combustion of the carbon monoxide and/or of the gaseous organic substances.
US09314737B2 Dehumidifier and method for producing dehumidifier
Provided is a dehumidifier including an adsorption column allowing a to-be-treated gas produced by electrolysis of water to circulate therethrough so as to allow moisture in the to-be-treated gas to be adsorbed therein, wherein the adsorption column includes an adsorbent capable of adsorbing moisture, a column body having a housing region containing the adsorbent, and a heating unit arranged within the column body and capable of heating the adsorbent so as to cause desorption of the adsorbed moisture from the adsorbent, and the column body is a tube having a bent portion.
US09314732B2 Systems and methods for reducing the energy requirements of a carbon dioxide capture plant
Systems and methods for reducing the energy requirements for carbon dioxide capture are described. Heat from system processes, such as steam condensation and hot flue gas, is utilized to heat reflux liquid utilized in release of carbon dioxide from absorbent solvent.
US09314724B2 Filter group
A filter cartridge (30) comprising a filter membrane (33) and at least a support element (31) fixed to the filter membrane (33), the support element being provided with at least a snap-engaging element (36) suitable for snap-engaging to a support body (20) following a reciprocal translation between the filter cartridge (30) and the support body (20) along a nearing axis (A), the support element (31) further comprising disengaging means (38) suitable for disengaging the snap-engaging element (36) from the support body (20) following a reciprocal rotation between the filter cartridge (30) and the support body about the axis (A).
US09314723B2 Inlet particle separator systems and methods
An inertial inlet particle separator system for a vehicle engine is provided. A separator assembly and collector assembly are coupled to the scavenge flow path and configured to receive the scavenge air. The collector inlet has a throat defining a cumulative throat area at each position along the throat length from the first throat end to the second throat end. The collector body defines a cross-sectional area associated with each position along the throat length between the first throat end and the second throat end. The collector outlet is coupled to the collector body such that scavenge air flows into the collector inlet, through the collector body, and out through the collector outlet. At a first position between the first throat end and the second throat end, the respective cross-sectional area of the collector body is greater than or equal to the respective cumulative throat area.
US09314721B2 Filter system with seal
A filter system has a housing with a housing wall and at least one cover. An inlet is arranged on the housing and feeds a liquid to be filtered into the housing. An outlet is arranged on the housing and discharges the liquid that has been filtered from the housing. At least one filter element is arranged between the inlet and the outlet and separates a raw side of the filter system from a clean side of the filter system. A gasket is arranged between a sealing surface of the housing wall and a sealing surface of the cover. The gasket is held in position in a longitudinal direction of the housing by at least one retaining element that is arranged on the cover or on the housing wall.
US09314720B2 Filter device with releasably securable end cap and sealing arrangement
A filter device for fluids, especially for fuels such as diesel fuel, includes a filter housing (1) defining a longitudinal axis (19). The filter housing has a fluid inlet (14) and a fluid outlet (24) and can accommodate at least one filter element (9). The fluid can, during filtering, flow through a filter medium (11) surrounding an inner filter cavity. The filter element (9) is enclosed by an end cap (21) on its lower end facing the bottom part (5) of the filter housing (1). The end cap has a passage (29) forming a fluid connection to the inner filter cavity (17) and can be fixed to an element retainer (23) of the filter housing (1). The element retainer (23) includes retaining piece (35) on the bottom part (5) of the filter housing (1). The retaining piece is open towards the filter element (9) with a fluid channel (37) leading to a housing connection (24) running into it. The end cap (21) of the filter element (9) has a connecting piece (27) accommodated in the retaining piece (35) and secured in a supporting zone. The retaining piece (35) forms an opening (43) forming a fluid connection to the fluid channel (37) leading to the element retainer (23) and including a sealing arrangement (45, 47) sealing the opening from the open end of the retaining piece.
US09314719B2 Filter having spiral-shaped distributor channels
Fluid distribution filters having spiral filter media and associated systems and methods are disclosed herein. In one embodiment, for example, a filter assembly can include a canister having a body portion positioned between a first opening and a second opening. The filter assembly can further include a filter media positioned in the body portion of the canister. The filter media can include at least one channel in fluid communication with the first and second openings. The channel can have a spiral-like shape and be configured to distribute incoming fluid across the filter media and move the fluid at a substantially equal velocity across the filter media.
US09314718B2 Backwash arrangement for cleaning a cylindrical filter screen
A backwash arrangement for cleaning a cylindrical filter screen includes a cylindrical filter screen within which extends an axial central conduit. A number of radial branch conduits extend outwards from the central conduit towards the cylindrical filter screen, each provided with a spring-loaded nozzle arrangement. The spring-loaded nozzle arrangement is biased into contact with the cylindrical filter screen, and includes a nozzle opening for passing across the cylindrical filter screen, and a pair of wheels deployed on opposing sides of the nozzle opening for rolling engagement with the cylindrical filter screen.
US09314716B2 Customizable multi-stage water treatment assembly
A customizable multi-stage fluid treatment assembly typically includes a connector, a plurality of cartridges, and a cap. The plurality of cartridges have a treatment medium spaced within an interior volume of the individual cartridges, between the ends thereof. The ends of the plurality of cartridges are configured to receive a fluid, bring the fluid into operative contact with the treatment medium, and dispense the fluid from the opposing end of the cartridge. The connector is coupled with one end of the plurality of cartridges and has an inlet and an outlet for receiving and dispensing the fluid to and from an appliance. The cap is coupled with the other end of the plurality of cartridges, enclosing the fluid treatment assembly, which is configured to be received in a cavity of an appliance. The cartridges of the plurality of cartridges may be individually replaced with cartridges to meet customized needs.
US09314713B2 Apparatus and method for recovering a hydrocarbon diluent from tailings
An apparatus and a method for separating diluted tailings containing a hydrocarbon diluent into a recovered diluent component and a diluent recovered tailings component. The method includes introducing the diluted tailings into a diluent recovery vessel so that they form a tailings pool in the diluent recovery vessel, introducing an amount of stream directly into the tailings pool, mixing the diluted tailings which are contained in the tailings pool, and maintaining the diluted tailings in the diluent recovery vessel for a residence time. The apparatus includes a diluent recovery vessel having a tailings pool section, a steam distributor located in the tailings pool section, and a mixing device associated with the tailings pool section.
US09314712B2 Functionalized substrates with ion-exchange properties
The current invention provides compositions, which are useful as stationary phases for a variety of chromatographic applications, such as high performance liquid chromatography (HPLC) and solid-phase extraction (SPE). The compositions include a porous solid support (e.g., silica gels, silica monoliths or synthetic organic resins) having an exterior surface and pore openings defined by “interior walls”. To the solid support are covalently bound organic ion-exchange ligands (e.g., silyl ligands), which incorporate at least one ion-exchange group (e.g., ionic or ionizable group). The compositions further include micro-particles (e.g., latex particles) incorporating ion-exchange groups having a charge that is opposite to the charge found on the support. The micro-particles are bound to the exterior surface of the support (e.g., via electrostatic forces). The micro-particles have a size that is sufficient to minimize the number of particles that can enter the pores of the support thereby reducing or essentially preventing binding of the micro-particles to the interior walls of the pores. While the pores are essentially too small for the micro-particles, they can still be accessed by the analytes present in a chromatographic sample. The physical separation of ion-exchange groups located within the pores and the surface of the micro-particles, respectively, prevents reactions (e.g., formation of salt-bridges) between the oppositely charged groups and provides compositions with both anion-exchange and cation-exchange capabilities within the same stationary phase. The ligands bound to the solid support can optionally include additional (e.g., reverse-phase) functionalities creating multi-modal (e.g., trimodal) stationary phases.
US09314710B2 Device for the chromatographic separation of a substance mixture and use thereof
A multifunctional device for chromatographic separation, in particular for affinity chromatographic separation of a substance mixture, provides for a uniform fluid distribution on a separation medium and a uniform flow through a stationary phase. The fluid to be separated is passed through a radial inlet line in an upper partial region of the device, to the center of the upper partial region. The radial inlet line is enlarged in the form of a cupola at the center of the upper partial region.
US09314707B2 Magnetic building tiles
A building system includes a plurality of building tiles and/or connecters that are magnetically and releasably connectable to one another. The magnetic building tiles are comprised of a tile frame and a tile panel. The tile frame, by one approach, is comprised of two connectable frame portions or elements having magnets embedded therein. The first frame element and the second frame element are connectable to one another through a snap, clip, or another similar connection mechanism. The first and second frame elements are connectable around or into the tile panel, which is removable from the magnetic building tile. The tile panel or the tile frame has a channel into which the other of the tile panel or tile frame extends to secure the two pieces together.
US09314706B1 Partially bisected pole-attaching balloon
The invention includes methods and apparatus for bisected and/or partially bisected helium-free balloon that may be secured over an extended stationary structure such as an extended pole and/or lamp-post such that the secured balloon gives the appearance of being whole or un-bisected. Additional embodiments include improved methods for elevating and/or coupling a bisected and/or partially bisected helium-free balloon an extended stationary structure such as an extended pole and/or lamp-post.
US09314703B2 Expanding track set
A toy vehicle track set is provided including a track segment. The track set having: a movable character located proximate to the track segment, wherein the character includes a torso, a first appendage, and a second appendage, each of the appendages is positioned adjacent the track segment, at least one of the pair of appendages being movably secured thereto and configured to intermittently block portions of the track segment such that a toy vehicle travelling thereon is captured by the character depending on the location of the appendages.
US09314702B2 Apparatus and method pertaining to non-mesh, hair-securement elongated strips for use with a doll
A doll body (such as but not limited to a doll head) having an exterior surface (such as a scalp) and at least one non-mesh hair securement strip disposed on the exterior surface. By one approach at least two minor portions of the aforementioned non-mesh hair securement strip are constrained with respect to movement away from the exterior surface of the doll body such that at least one majority portion of the strip can be moved away from the exterior surface with less constraint than the two minor portions. The majority portion moves away from the exterior surface of the doll body to facilitate disposing and securing hair components therein.
US09314701B2 Method of and system for conducting multiple contests of skill with a single performance
A method of and system for conducting multiple competitions of skill for a single performance are described herein. User generated competition groups and system generated competition groups allow users to participate in multiple competitions at once based on answering the same questions or making the same selections related to a single event. The users are informed of each competition either via email, text message or when logging into the network via a website. The users select which competitions groups to join. After joining the desired groups, the users then make their selections related to the event which are transmitted to the network where results are tabulated and transmitted back to the users. The results are separated based on each competition group, so that users can continually know where they stand in each separate competition. With multiple competition groups, users are able to have varying success from the same performance in multiple competitions.
US09314689B2 Secured gaming cards and verification system
A gaming card verification system includes electronic gaming tables and a system server in communication with and located remotely from the tables. The system or table tracks playing cards at each table and facilitates alerts when improper conditions are detected. Gaming tables can include a physical surface for playing card games, an automated shoe or card handler, a smart discard rack, and a table controller. First sensors detect a first identifier on each card and separate second sensors detect a separate second identifier on the card. The first identifier can be a randomly assigned code unique to each card, while the second identifier indicates a game value of the card. A database can store and provide details regarding card identifiers, values and locations. The discard rack can detect discards and reconcile those with what issued from the shoe. Both counterfeit card insertions and missing cards can be detected thereby.
US09314688B2 Structure for a system with sliding surface elements
A system with at least one sliding surface element (1), preferably as run-in track systems for ski jump system/ski jumps, wherein the height and/or the course of the sliding surface elements (14) has to be adjusted to any profile by spacer elements (30).
US09314687B2 Suspension roller ski
The invention relates to a roller ski having a suspension system incorporated into the front and rear regions of the main roller ski body. The suspension system allows roller-skiers to undertake roller-skiing on rougher pavement, asphalt or the like by reducing stress and/or discomfort to the roller-skier. In addition, the suspension system provides a skiing experience that more closely resembles skiing on snow by returning energy back to the skier in a manner similar to the effect that the camber of a snow ski provides to the skier. In addition, in one embodiment, the roller ski also includes a pressure sensitive ratchet system that simulates skiing using classical technique.
US09314683B2 Virtual golf simulation apparatus and method capable of compensation ball flight distance decreasing rate
Disclosed herein are a virtual golf simulation apparatus and method that is capable of applying differences between golf shots based on kinds of a landform of a real golf course when a user performs a golf rounding in the real golf course to hitting environment based on a golf mat, on which the user hits a golf ball, and to a virtual golf course through virtual golf simulation, and that is capable of simultaneously and properly reflecting the hitting environment of the user and the environment of the virtual golf course in simulation results, thereby providing the same sense of reality that the user would feel in the real golf course.
US09314682B2 Running machine
A running machine including a hollow cylinder-shaped rotator having a diameter and including a wall having a constant thickness, a hollow cylinder-shaped display unit having a diameter greater than that of the rotator and encircling the rotator, and a support for supporting the rotator and the display unit in an upright state and for enabling rotation of the rotator about an axis of the rotator.
US09314680B2 Gaming system and related method
An exemplary gaming system, in one implementation, provides active interaction between one or more players and the gaming system. Such an exemplary gaming system includes a receptacle with one or more holes to receive first gaming objects thrown at it. Chambers attached to a rigid member on the receptacle receive and store second gaming objects that are later released into one or more different spatial directions. An intermediate surface operably connected to a mechanical or an electrical triggering mechanism is included in the receptacle. When the first gaming object falls into the receptacle and hits the intermediate surface, the intermediate surface causes activation of the triggering mechanism to directly or indirectly propel the second gaming objects, through the chambers, into one or more different spatial directions. A hand or foot lever allows players to reset the triggering mechanism for the next game.
US09314676B2 Golf club heads with ribs and related methods
A golf club head including a first rib protruding from a rib surface of the body. The first rib comprises a first and second rib end and a first, second, and third rib portion. The third rib portion is located between the first rib portion and the second rib portion. The first, second and third rib portions include a first, second and third rib portion dimension, where the first and second rib portion dimensions are greater than the third rib portion dimension.
US09314671B2 Golf ball polyurethane composition and golf ball
An object of the present invention is to provide a golf ball polyurethane composition excellent in resilience. Another object of the present invention is to provide a golf ball excellent in a shot feeling and resilience. The present invention provides a golf ball polyurethane composition comprising, as a resin component, a polyurethane elastomer including a polyisocyanate with at least two alicyclic hydrocarbon structures having 3 or more carbon atoms as a constituting component, and having a spin-lattice relaxation time (T1) of 13C nucleus of 7.3 seconds or less measured by a High resolution solid state nuclear magnetic resonance (NMR) method.
US09314667B2 Stationary training bicycle
Stationary training bicycle having a pedal crank mechanism coupled to a transmission by a flywheel. A magnetic braking device interacts with the flywheel and is variable in its braking action. A calibration table stored in a computing device contains a plurality of braking device settings with reference rundown times of the flywheel not loaded via the pedal crank mechanism and relating to the speed reduction from a first speed to a second speed. The actual rundown time of the flywheel is ascertained at least once by means of a measuring device or the computing device and compared to the reference rundown times. If actual setting and target setting do not correspond, information relating to the actual setting can be output on the display device.
US09314662B1 Cushioned exercise unit for hands and wrists
Disclosed is a hand-grasped exercise unit to assist in reducing wrist and hand pain during exercises such as yoga. The device, normally used in pairs, is constructed for a user to rest the heel of the palm, fingers, and base of the thumb while engaging in exercises normally done in direct contact with a floor or other hard surface. The device comprises a frame having an upper platform, and a support base with two orthogonally-oriented side walls and a rear wall. An opening allows a user to insert four fingers of the hand between the two side walls and grasp a rounded lip on the upper surface of the unit. A main foam layer and a secondary foam layer are affixed to the top surface of the upper platform. The two foam layers are enclosed by a fabric cover to provide additional comfort.
US09314657B2 Exercise assembly
An exercise assembly for allowing a user to practice the sport of arm wrestling includes a table that may be positioned on a support surface. A support arm is coupled to the table. The support arm extends upwardly from the table. A spring biasing member is coupled to the support arm. A handle is coupled to the spring biasing member. The handle is oriented at an angle with respect to the spring biasing member. The user's hand and forearm are positioned in the convention of arm wrestling when the user grips the handle. A piston is coupled to the table. A rod is coupled between the piston and the handle. The user urges the handle downwardly toward the table. The user simultaneously stretches the spring biasing member and compresses the piston so the user is trained in the sport of arm wrestling.
US09314647B2 Holding arm and arrangement for supporting diagnostic irradiation in radiation therapy applications
The present embodiments relate to a holding arm for a detector that may be positioned on a first arm end or a diagnostic beam source that may be positioned on the first arm end. The present embodiments also relate to a radiation therapy arrangement with the holding arm. The holding arm may be positioned in a region of a second arm end in an emitter head region of a radiation therapy system and is essentially curved.
US09314643B2 Heart therapy device for detecting ventricular tachycardia and fibrillation
A heart therapy device having a right-ventricular electrode and a left-ventricular electrode connected to a tachycardia identification unit. The tachycardia identification unit identifies ventricular tachycardia and simultaneously evaluates the heart rate at the right-ventricular and left-ventricular electrodes. The ventricular electrodes each include an electrode line having a corresponding sensing electrode pole that senses electric potential courses in the myocardium of the respective ventricle. The heart therapy device includes a dislocation identification unit that detects a possible dislocation of one of the ventricular electrodes, simultaneously evaluates the heart rate at both ventricular electrodes, and signals a right-ventricular or left-ventricular dislocation when a sudden rise in heart rate is sensed at the right-ventricular or left-ventricular electrode, without detecting a considerable change in rhythm at the respective electrode. In the event of the dislocation of one of the ventricular electrodes, the rhythm information of the electrode in question is ignored for tachycardia detection.
US09314641B2 Method of stimulating a hypoglossal nerve for controlling the position of a patient's tongue
A method for controlling a position of a patient's tongue includes attaching at least one electrode to the patient's Hypoglossal nerve and applying an electric signal through the electrode to at least one targeted motor efferent located within the Hypoglossal nerve to stimulate at least one muscle of the tongue. Methods may also include the use of more than one contact to target more than one motor efferent and stimulating more than one muscle. The stimulation load to maintain the position of the tongue may be shared by each muscle. The position of the patient's tongue may be controlled in order to prevent obstructive sleep apnea.
US09314640B2 Touch screen finger position indicator for a spinal cord stimulation programming device
A method of visualizing a user interaction with a clinician programmer is disclosed. A user engagement with respect to a screen of the clinician programmer is detected via one or more sensors associated with the screen of the clinician programmer. One or more locations on the screen of the clinician programmer corresponding to the user engagement is determined. An external monitor is communicatively coupled to the clinician programmer. The external monitor displays one or more cursors that graphically represent the one or more locations on the screen of the clinician programmer corresponding to the user engagement, respectively.
US09314639B2 Techniques for logging and using programming history in a neurostimulation system
An external control device, a neurostimulation system, and a method for providing therapy to a patient are provided. A plurality of stimulation parameter sets are defined, electrical stimulation energy is serially conveyed to tissue of the patient in accordance with the plurality of stimulation parameter sets, a historical log file is stored, and the plurality of stimulation parameter sets are logged in the historical log file.
US09314636B2 Implantable cardiac resynchronizer with biventricular pacing and detection of loss of capture and anodal stimulation
An medical device for stimulating the heart using biventricular stimulation. The device includes a sensor for detecting an endocardial acceleration parameter and a processing circuit configured to receive the endocardial acceleration parameter. The device further includes stimulation electronics coupled to the processing circuit. The processing circuit is configured to use the EA parameter to evaluate the biventricular stimulation. The evaluation includes comparing the value of the EA parameter in biventricular mode to the value of the EA parameter in left only mode or right only mode, and using the comparison and an assessment of the variability of the EA parameter as a function of the AVD in the left or right mode to distinguish between cases comprising: (a) normal operation, (b) a loss of RV or LV capture, (c) possible anodal stimulation. The processing circuit is further configured to conduct at least one update to operational parameters of the device based on the determined case.
US09314635B2 Automatic baroreflex modulation responsive to adverse event
An aspect of the present subject matter relates to a system for providing baroreflex stimulation. An embodiment of the system comprises an adverse event detector to sense an adverse event and provide a signal indicative of the adverse event, and a baroreflex stimulator. The stimulator includes a pulse generator to provide a baroreflex stimulation signal adapted to provide a baroreflex therapy, and a modulator to receive the signal indicative of the adverse event and modulate the baroreflex stimulation signal based on the signal indicative of the adverse event to change the baroreflex therapy from a first baroreflex therapy to a second baroreflex therapy. Other aspects are provided herein.
US09314632B2 Pulse-by-pulse compliance voltage generation for an implantable stimulator
Circuitry for generating a compliance voltage (V+) for the current sources and/or sinks in an implantable stimulator device in disclosed. The circuitry assesses whether V+ is optimal for a given pulse, and if not, adjusts V+ for the next pulse. The circuitry uses amplifiers to measure the voltage drop across active PDACs (current sources) and NDAC (current sinks) at an appropriate time during the pulse. The measured voltages are assessed to determine whether they are high or low relative to optimal values. If low, a V+ regulator is controlled to increase V+ for the next pulse; if not, the V+ regulator is controlled to decrease V+ for the next pulse. Through this approach, gradual changes that may be occurring in the implant environment can be accounted for, with V+ adjusted on a pulse-by-pulse basis to keep the voltage drops at or near optimal levels for efficient DAC operation.
US09314627B2 Systems and methods to account for neck movement during nerve stimulation
Some embodiments provide a method, comprising performing a neural stimulation test routine for stimulating a neural target in a cervical region of a patient, wherein for each of a plurality of head positions, performing the neural stimulation test routine includes testing a plurality of electrode configurations. The method further comprises recording threshold data for each of the tested electrode configurations for the plurality of head positions, and recommending an electrode configuration based on the recorded threshold data.
US09314622B2 Functional electrical stimulation (FES) method and system to improve walking and other locomotion functions
A method and system which provides wireless, noninvasive electrical stimulation to different muscle groups to allow the user to conduct physical activities, such as walking, by stimulating various muscle groups in the body at the correct times of activation or by stimulating muscle groups in a simulation mode when standing, sitting or lying down, whereby walking is not required to stimulate the various muscle groups. The system provides a small portable wearable system which utilizes available software, including Bluetooth technology, to provide electrical nerve stimulating pulses with low current, minimal phase charge which is controlled remotely and induce desired muscle contraction with increased comfort for the user. The present method and system applies electrical stimulation with accurate timing, based on a three-dimensional motion sensor, as a trigger to initiate stimulation and which is adapted to turn itself on and off when not walking.
US09314621B2 Method for controlling an electroporation device
A method for controlling an electroporation device configured for supplying an electrical power signal to a plurality of pairs of electrodes coupled to a portion of the human body, wherein the following steps are performed: detecting, in the course of an electroporation treatment, a condition of malfunctioning or fail for the pairs of electrodes for which at least one electrical parameter of the power signal supplied to the electrodes themselves has an anomalous value; storing an indicator of the pairs of electrodes in the fail condition; and selecting the pairs of electrodes in the fail condition and re-computing new parameters in order to implement a subsequent electroporation process.
US09314619B2 Connector apparatus for a medical device
In various examples, a connector apparatus includes at least one connector including an integral conductor and an encapsulation housing. The at least one connector includes a contact portion and a tail portion, wherein the contact portion is configured to selectively accept and electrically couple to a therapy delivery element. The tail portion extends outwardly from the contact portion. The encapsulation housing at least partially surrounds at least some of the contact portion of the conductor. The encapsulation housing includes an inner surface, wherein at least some of the contact portion of the conductor extends from the inner surface of the encapsulation housing. With a contact of the therapy delivery element disposed within the encapsulation housing, the conductor is configured to contact and electrically couple with the contact of the therapy delivery element.
US09314618B2 Implantable flexible circuit leads and methods of use
Devices, systems and methods are provided for stimulation of tissues and structures within a body of a patient. In particular, implantable leads are provided which are comprised of a flexible circuit. Typically, the flexible circuit includes an array of conductors bonded to a thin dielectric film. Example dielectric films include polyimide, polyvinylidene fluoride (PVDF) or other biocompatible materials to name a few. Such leads are particularly suitable for stimulation of the spinal anatomy, more particularly suitable for stimulation of specific nerve anatomies, such as the dorsal root (optionally including the dorsal root ganglion).
US09314616B2 Temporary implantable medical electrical leads
A temporary implantable medical electrical lead includes a conductor extending along a proximal, extracorporeal length and a distal, subcutaneous length of the lead. Electrically isolated first and second wire filars of the conductor are wound to form an elongate lumen of the lead. First and second electrodes are mounted directly onto the conductor, along the subcutaneous length, and each is directly coupled to the corresponding filar. A fixation member is attached to a tubular member, which is conformed to an outer surface of the conductor so as to only cover the conductor along the subcutaneous length, leaving the outer surface exposed along a portion thereof, adjacent to the extracorporeal length. When the lead is implanted, the fixation member holds the subcutaneous length in a relatively fixed location, and fluid communication exists between the outer surface of the conductor and the lumen of the lead.
US09314610B2 Defibrillation electrodes
A reusable component of a hands-free defibrillation electrode, the reusable component having a flexible nonconductive element, and a flexible metallic element supported by the flexible nonconductive element, wherein the flexible metallic element has an exposed surface on one side of the reusable component and the exposed surface is configured to be adhered to a disposable coupling portion, and wherein the reusable component is configured to accept an electrical defibrillation pulse and spread the electrical pulse across the exposed surface area, from which it is delivered to the patient's chest through the disposable coupling portion.
US09314609B2 Device for providing electrical stimulation of a human knee
A device for providing electrical stimulation of a human knee. One example device includes first, second, third, and fourth surface electrodes, a wrap configured to be wrapped around the human knee, and an electrical device. The wrap includes a wrap positioning indicator configured to be positioned over a specified portion of the human knee. The wrap also includes first, second, third, and fourth electrode attachment locations corresponding to acupuncture points Stomach 34, Stomach 36, Spleen 9, and Spleen 10. The electrical device is configured to automatically send, to the first, second, third, and fourth surface electrodes, during a single treatment, a first current at a first frequency for a first time period followed by a second current at a second frequency for a second time period, with the first frequency being different from the second frequency.
US09314606B2 Luer connectors
Luer connector including a primary Luer male connector, having a secondary female section extending from a top distal part of the primary Luer male connector back towards a proximal part thereof, the primary Luer male connector including a first inner fluid flow channel extending from a proximal end thereof to the secondary female section, the first inner fluid flow channel having a diameter of approximately d1 increasing at a connection point between the first inner fluid flow channel and the secondary female section to form a neck N the secondary female section having an internal diameter of d2 at a top distal part of the primary Luer male connector, where d1 is smaller than d2, the primary Luer male connector being configured to mate with a primary Luer female connector having a secondary male section including a second inner fluid flow channel ex having an internal diameter of approximately d1.
US09314604B2 Apparatus for selectively establishing a needleless injection port on IV tubing, and associated methods
Apparatus enables one or more needleless injection ports to be established on IV tubing as needed. An IV tubing-engaging portion secures the apparatus about the tubing. A puncturing member establishes fluid communication between the IV line and a sealing member on the apparatus. Connecting a syringe to the sealing member establishes fluid communication between the IV line and the syringe, enabling an injection to be made. When the syringe is withdrawn, the sealing member reseals to prevent fluid leakage from the IV line.
US09314603B2 Device for disinfecting wound treatment
A device (10) for disinfecting wound treatment is described, with a housing (18), with a plasma generator (54) arranged in housing (18) for generating a disinfecting plasma, with a flow module (52) arranged in housing (18) for generating a gas stream, which forms a free jet (32) transporting the disinfecting plasma from housing (18), and with a jet control unit (50) for affecting the free jet (32) in a planned manner by controlling the gas stream generated by flow module (52). Means (10) has, furthermore, a guide apparatus (56) controllable via the jet control unit (50) for guiding the free jet (32).
US09314597B2 Clip for catheter management
A catheter management clip is provided which provides at least one curved clip on the handle of a device requiring a catheter. The placement of the curved clip on the handle allows the looping of the catheter from either the top opening or bottom opening of the clip and therefore the catheter can be used by both left and right handed users. In one preferred embodiment, a clip is located on either side of the handle and oriented so that the two clips are pointed in the same direction. In another embodiment, two clips are located on the same side of the handle and are connected so that the openings of the two clips are pointing in opposite directions.
US09314594B2 Robotic catheter manipulator assembly
A robotic catheter manipulator assembly may include a support member including a catheter manipulation base and a sheath manipulation base movable relative to each other and to the support member. Each respective manipulation base may be releasably connectable to a catheter cartridge and a sheath cartridge. A drive mechanism may be provided for moving the catheter and sheath manipulation bases relative to each other and to the support member. The manipulation base or the cartridge may include a first element engageable with a complementary second element slidably engaged with the other one of the manipulation base or the cartridge for controlling movement of a component connected to the cartridge. The cartridge, for example, may be a transseptal cartridge, a catheter cartridge or a sheath cartridge, and the component may respectively be a surgically insertable device such as a transseptal needle, a catheter or a sheath.
US09314593B2 Medical devices for the identification and treatment of bodily passages
Medical devices are described. More particularly, medical devices and methods for the identification and treatment of bodily passages, such as sinus cavities, are described herein. An exemplary medical device comprises an elongate member, a handle, and a wire member. The elongate member is moveable between a first straight, or substantially straight, configuration to a second curved configuration.
US09314587B2 Retrograde cardioplegia delivery catheter and method for inducing cardioplegic arrest
A retrograde delivery catheter includes at its distal end an expandable member configured to at least partially occlude the coronary sinus of a patient's heart, and has a length and variable stiffness that allows the distal end to be selectively articulated so as to be positioned in the coronary sinus. The delivery catheter has a triple lumen construction with a primary lumen extending between the proximal and distal ends and configured to allow a cardioplegic fluid to be delivered to the coronary sinus. A second lumen provides for balloon inflation while a third lumen allows monitoring of a pressure within the coronary sinus. A torque may be applied and a reinforcement member within the delivery catheter provides improved torque transmission along the length of the catheter.
US09314582B2 Humidification system
The present invention provides a method for reducing condensed humidifying agent in a humidification system by pulsing a delivery of humidifying agent into a respiratory circuit. During a non-pulsed interval, gas flowing through the respiratory circuit will evaporate the condensed humidifying agent present in the respiratory circuit. The present invention also provides a method and apparatus for delivering humidified gas to a patient, wherein the delivery avoids the problems associated with a stationary water humidifier. In the method, the delivery of humidifying agent is precisely controlled to deliver a flow of humidifying agent to a volume of gas.
US09314581B2 Laryngeal mask with a bite absorbing connector
A laryngeal mask insertable into a patient, an airway tube of the laryngeal mask having a bore extending from a proximal to a distal end of the airway tube, a connector provided at the proximal end of the airway tube, the connector comprising a connector body with a longitudinal bore, at least two wall portions extending longitudinally from a first continuous wall to a second continuous wall, and two parallel and opposite longitudinal wall cut-away portions intermediate the at least two wall portions, the length of the longitudinal wall cut-away portions being greater than the length of the first continuous wall.
US09314572B2 Controlling drug delivery transitions
Devices, systems, and techniques for transitioning between different drug delivery sources or different drug concentrations may account for diffusion and mixing of drug within the fluid. In one example, a method may include determining a flow rate for a fluid to be delivered to a patient via a drug pump and a catheter in fluid communication with a reservoir of the drug pump. The fluid includes a drug. The method also includes determining a concentration profile of the drug delivered via the catheter, wherein the concentration profile identifies a volume of delivered fluid needed to achieve a target transition dose of the drug. The method further includes determining, by a processor and based on the flow rate and the concentration profile, an initial delivery period required to achieve the target transition dose by delivering the fluid at the flow rate.
US09314570B2 Filter needle
A filter needle for a syringe including a syringe needle having a needle, a fixing member for fixing the needle and an inner space formed in the fixing member, and a syringe body having a cylinder, a piston and a front end separably installed in the inner space of the fixing member of the syringe needle, is provided. The filter needle includes a filter structure installed in the inner space of the fixing member of the syringe needle and including an one-way inlet path having an inlet and an one-way outlet path having an outlet, each of which has a check valve function, and a filter installed in the outlet path at a rear end of the outlet to filter a foreign substance, which is input through the inlet together with a medicament liquid, from the medicament liquid such that the medicament liquid is only injected into a patient through the outlet when injecting the medicament liquid into the patient.
US09314567B2 Electro-osmotic pumps, systems, methods, and compositions
The present disclosure relates, according to some embodiments, to compositions, methods, devices, and systems for delivering a composition (e.g., a fluid composition) to a subject. For example, the present disclosure relates to non-gassing, direct current (DC), electro-osmotic pumps in some embodiments. A pump may comprise an anode (e.g., a porous silver/silver oxide anode), a cathode (e.g., a porous silver/silver oxide cathode), and a membrane (e.g., a porous ceramic membrane) positioned at least partially between the anode and the cathode in some embodiments. A pump system may comprise an electro-osmotic pump, a reservoir comprising a pump fluid chamber in fluid communication with the electro-osmotic pump and a delivery fluid chamber in fluid communication with the electro-osmotic pump; a controller assembly in electrical communication with the anode and the cathode; and a cannula and/or a needle in fluid communication with the delivery fluid chamber. A pump fluid may comprise water and/or a delivery fluid may comprise a drug, in some embodiments.
US09314566B2 Portable infusion pump and media player
Some embodiments of a portable infusion pump system can be configured to deliver medicine (e.g., insulin or the like) to a user and to deliver media content to a user. The media content can include, for example, MP3 music and other audio/video data stored in a memory device in the portable system. Thus, in particular embodiments, the portable infusion pump system can serve a dual purpose of providing medication and entertainment for the user from a compact and unobtrusive device.
US09314564B2 Pump controller that checks operational state of insulin pump for controlling the insulin pump
A computer-implemented method of operating a diabetes treatment system that includes an insulin pump and a pump controlling device is disclosed. The method includes receiving, by the device, a request for the pump to perform an operation that is dependent on a specified state of the pump. The method also includes requesting, by the device, a current state of the pump from the pump. Moreover, the method includes receiving, by the device, the current state of the pump. Also, the method includes determining, by the device, whether the current state of the pump matches to the specified state of the pump. Additionally, the method includes sending, by the device to the pump, a command to perform the operation in response to a determination that the current state of the pump matches the specified state of the pump.
US09314562B2 Control of interface between separated blood components under lipemic and hemolytic conditions
Blood separation systems and methods are provided for controlling the interface between separated blood components. The system includes a blood separation chamber configured to separate blood into first and second blood components and an outlet line for removing at least a portion of the first blood component from the blood separation chamber. A primary optical sensor assembly is associated with the blood separation chamber to directly monitor the interior of the blood separation chamber. A secondary optical sensor assembly is associated with the outlet line to monitor the first blood component in the outlet line. The system also includes a controller programmed to select between the primary optical sensor assembly and the secondary optical sensor assembly for monitoring contamination of the first blood component. The system is particularly advantageous for preventing contamination of separated plasma which is lipemic or hemolytic.
US09314557B2 Magnetically-levitated blood pump with optimization method enabling miniaturization
A magnetically-levitated blood pump with an optimization method that enables miniaturization and supercritical operation. The blood pump includes an optimized annular blood gap that increases blood flow and also provides a reduction in bearing stiffness among the permanent magnet bearings. Sensors are configured and placed optimally to provide space savings for the motor and magnet sections of the blood pump. Rotor mass is increased by providing permanent magnet placement deep within the rotor enabled by a draw rod configuration.
US09314556B2 Percutaneous system, devices and methods
A percutaneous system, method and related devices are provided. More particularly, a percutaneous system comprises one or more of an intracorporeal connector for fluid communication between two anatomical compartments, through an anatomical wall, an intracorporeal device for regulating the flow of fluid between the two anatomical compartments, and a percutaneous insertion device.
US09314554B2 Irrigation and suction system, in particular for laparoscopic surgery
The present invention concerns an irrigation and suction system, in particular for laparoscopic surgery, comprising an active control apparatus (100), provided with a reusable motor (101′) capable to be attached to and to operate a disposable pump (102), and a disposable handpiece (104) provided with two valves (1603, 1604) capable to be connected respectively to an output duct (813) from the pump (102) and to a suction line, the two valves being operatable (1603, 1604) for making respectively the pump (102) and the suction line communicate with an output nozzle (1607) of the handpiece (104), the nozzle (1607) being capable to support a probe (110), the apparatus (100) comprising controlling electronics means (20) for controlling electronics means (1501) for driving the motor (101′), the system being characterised in that it comprises interface means (1505, 16, 17, 112, 113) connected to said controlling electronics means (20) capable to select an operation mode of the motor (101′) between continuous mode, wherein the pump (102) delivers fluid in a continuous and uniform way, and pulse mode, wherein the pump flow rate switches between a minimum flow rate and a maximum flow rate with a switching period.
US09314544B2 Durable hydrophilic coating compositions
A durable hydrophilic coating composition is provided comprising a film forming polymer, a wetting agent and from about 0.001% to about 40%, by weight of the composition, of nanoparticles. The nanoparticles are selected from the group consisting of alumina, silica and combinations thereof and have a particle size of from about 1 to about 750 nanometers. The weight ratio of the film forming polymer to the nanoparticles is from about 1:1 to about 1:30. A disposable absorbent article is also disclosed.
US09314536B2 Compounds and methods for the treatment of EGFR positive diseases
Disclosed herein are anti-EGFR antibodies conjugated with maytansinoid drugs for targeted delivery to disease tissues. Methods related to the preparation and uses of such antibody drug conjugates to treat EGFR positive cells in cancers are provided.
US09314534B2 Polymer conjugates of interferon beta-1A and uses
An interferon beta polypeptide comprising interferon-beta 1a coupled to a polymer containing a polyalkylene glycol moiety wherein the interferon-beta-1a and the polyalkylene glycol moiety are arranged such that the interferon-beta-1a has an enhanced activity relative to another therapeutic form of interferon beta (interferon-beta-1b) and exhibits no decrease in activity as compared to non-conjugated interferon-beta-1a. The conjugates of the invention are usefully employed in therapeutic as well as non-therapeutic, e.g., diagnostic, applications.
US09314532B2 Drug delivery vehicle
The present disclosure provides targeted drug delivery vehicle compositions comprising a drug composition and targeted poly-amino-acid subunits, methods of manufacture, and methods of treatment for numerous diseases.
US09314530B2 Composition, in aqueous medium, that comprises at least a hyaluronic acid and at least an hydrosoluble salt of sucrose octasulfate
A composition including at least one crosslinked or non-crosslinked hyaluronic acid, or one of its salts, and at least one water-soluble salt of sucrose octasulphate, to processes for the manufacture of said composition and to the use of said composition for the formulation of a viscosupplementation composition or for the formulation of a composition as a dermal filler or for the formulation of a cosmetic composition.
US09314529B2 Nucleic acid delivery composition and carrier composition, pharmaceutical composition using the same, and method for nucleic acid delivery
An excellent nucleic acid delivery composition is provided which has reduced cytotoxicity and improved nucleic acid introduction efficiency and gene expression efficiency. The composition comprises: a block copolymer having an uncharged hydrophilic polymer segment and a cationic polymer segment; a cationic polymer; and a nucleic acid, wherein the mol percentage (B/H ratio) of the cationic groups of the block copolymer to the total cationic groups of the block copolymer and the cationic polymer is between 25% and 90%.
US09314525B2 Picropodophyllin polymorph C and its use in cancer therapy
The invention relates to novel polymorphs of picropodophyllin, methods for preparing said polymorphs and pharmaceutical compositions comprising said polymorphs, as well as the use of said polymorphs in therapy such as cancer therapy.
US09314522B2 Antitumors combinations containing antibodies recognizing specifically CD38 and bortezomib
Pharmaceutical composition comprising an antibody specifically recognizing CD38 and bortezomib.
US09314521B2 Adjuvant compound
The invention is directed to a compound according to the formula [1] wherein R1 and R2 are branched or straight groups having up to 17 atoms selected from carbon, nitrogen, oxygen and sulphur, n is 0 to and including 18, Y is sulphur or selene, X is S or 0 and R is —OH or an organic group comprising one or more peptides, one or more nucleic acids, one or more antibodies or combinations thereof. The invention is also directed to process for preparing said compound and the use of said compound as an adjuvant. The invention is also directed to a composition comprising said compound and the use of said composition, for example as a vaccine composition.
US09314518B2 Treatment of streptococcal infections
Methods of treating a Streptococcus pneumoniae infection are described herein.
US09314517B2 Parasite vaccine
Compositions and methods for the development and use of a vaccine that includes one or more FusM antigens in a carrier adapted to trigger a FusM-specific immune response in the human blood stream are disclosed herein.
US09314516B2 Conditional superagonist CTL ligands for the promotion of tumor-specific CTL responses
What is described is a novel genetic screen, involving recombinant technology and class I antigen cross-presentation, to search for supraoptimal superagonists of the 27L MART-1 mutant selecting for single amino acid substitution mutants of 27L that activate human antigen-specific CTL clones recognizing the wild-type MART-126-35 epitope. Three novel mutant epitopes are identified with superagonist properties that are functionally superior to 27L. The ability of a given analog to act as superagonist varies among patients. Also described is the use of methods to establish panels of potential superagonist APLs to individualize tumor peptide vaccines among patients. The methodology is replicated to identify APL to NY-ESO-1157-165 and NY-ESO-1157-170 tumor epitopes. A general method is described that is useful to produce a tumor vaccine to any tumor epitope.
US09314512B2 Treatment of synucleinopathies
This invention relates generally to treating synucleinopathies in subjects that are not clinically diagnosed with a lysosomal storage disease, as well as associated methods of making medicaments and screening methods.
US09314506B2 Methods for increasing insulin secretion by co-stimulation of corticotropin-releasing factor receptors
Methods and compositions are provided for stimulating insulin production, increasing beta cell mass, or decreasing beta cell loss in a subject. For example, methods of the embodiments can comprise administration of a corticotropin-releasing factor (CRF)1 receptor agonist and a CRF2 receptor agonist. Also provided are pharmaceutical compositions comprising a selective CRF1 receptor agonist and a selective CRF2 receptor agonist.
US09314502B2 Treatment of allodynia, hyperalgesia, spontaneous pain and phantom pain
The present invention relates to the use of Meteorin for the treatment of allodynia, hyperalgesia, spontaneous pain and phantom pain. In a preferred embodiment the disorder to be treated is allodynia, and hyperalgesia, more preferably allodynia including thermal and tactile allodynia.
US09314501B2 Method of regulating neuronal axon elongation
The present invention includes a treating step of treating neuronal growth cone with a regulatory factor to regulate macropinocytosis caused by a repulsive axon guidance molecule. The present invention can provide a new neuronal axon elongation regulating method etc.
US09314500B2 Non-N-glycosylated recombinant human annexin A2
Methods for the expression and purification of non-N-glycosylated human Annexin A2 in yeast, e.g., in Pichia pastoris, purified Annexin A2 produced by those methods, and methods of using the Annexin A2.
US09314499B2 Annexin A2 and tissue plasminogen activator for treating vascular disease
The use of tPA to treat hemorrhagic transformation, neurotoxicity has been limited to short treatment time windows because a high dose of tPA required to generate sufficient amounts of the enzyme plasmin for clot lysis. The present invention combines tPA with recombinant Annexin A2 resulting in thrombolysis without hemorrhagic transformation at delayed times after stroke. This embodiment allows the administration of a lower, non-neurotoxic, tPA dose. Our results suggest this novel combination for stroke therapy may greatly improve both efficacy and safety, and prolong tPA therapeutic time window.
US09314490B2 Biological effects of compositions of rosmarinic acid
The present invention relates to compositions of rosmarinic acid or its derivatives and to the use of a hydrolytic enzyme or of microorganism containing or producing hydrolytic enzymes in these compositions. The invention also pertains to methods for improving the biological effects of the rosemary extracts and for administering such compositions to a human or animal subject for improving the skin, coat, hair or health of the subject.
US09314488B2 Cellular extracts
The invention describes methods and agents for improving cosmetic appearance, for promoting, improving or restoring health of cells and tissues, preferably skin, and more preferably, for restoring aged or damaged skin to a healthy appearance. The agents include compositions of cells, eggs, cell extracts, egg extracts, and extract components such as purified nucleic acids, polypeptides, lipids, carbohydrates or other natural products.
US09314487B2 Methods for treating cartilage disorders, diseases, and injuries
The invention is directed to methods for treating cartilage disorders, diseases and injuries including, but not limited to, degenerative disc disease. The invention is also directed to methods for preventing cartilage disorders and diseases including, but not limited to, degenerative disc disease. The field of the invention is further directed to reducing inflammation associated with cartilage disorders, diseases and injuries including, but not limited to, degenerative disc disease.
US09314486B2 Preparative regimen for engraftment, growth and differentiation of non-hematopoeitic cells in vivo after transplantation
Disclosed are methods of obtaining an expanded population of mammalian ex vivo cells for treating a mammalian subject by (a) administering to a subject an effective amount of an agent that confers a growth disadvantage to at least a subset of endogenous cells at the site of engraftment; (b) administering to the subject an effective amount of a mitogenic stimulus for the ex vivo cells; and (c) administering the ex vivo cells to the subject, wherein the ex vivo cells engraft at the site and proliferate to a greater extent than the subset of endogenous cells, to repopulate at least a portion of the engraftment site with the ex vivo cells. The repopulated cells can be harvested or left at the engraftment site. Methods of treating brain injury in a subject by engrafting ex vivo cells at the site of injury are also described.
US09314485B2 Use of PI3K M-TOR and AKT inhibitors to induce FOXP3 expression and generate regulatory T cells
The invention relates to a method of inducing Foxp3 expression in a T cell comprising (i) stimulating a T cell (ii) inhibiting signalling via PI3K alpha or PI3K delta or m-TOR or Akt in said T cell, wherein said inhibition is commenced 10 to 22 hours after the stimulation of (i). The invention also relates to certain uses of PI3K inhibitors, PI3K inhibitors for particular uses, and kits.
US09314484B2 Methods and compositions for cancer immunotherapy using flagellin-tumor associated antigen fusion protein expressing tumor cells
Provided are methods for inducing an anti-tumor immune response by immunizing a mammal with a composition comprising a tumor cell which expresses a NLR ligand and/or TLR ligand-TAA fusion protein or with an activated DC which has internalized a tumor cell which expresses an NLR- and/or TLR ligand-TAA fusion protein.
US09314482B2 Methods and compositions for promoting wound healing
The present invention provides methods and compositions that use the combination of Tris and EDTA to inhibit the growth of microorganisms at the site of a wound or burn, and/or to promote the healing of a wound or burn, and/or to reduce the sensation of pain at the site of a wound or burn. The amount of Tris and EDTA applied to a wound or burn can be selected to achieve one or more of the foregoing effects.
US09314480B2 Dialysis precursor composition
A dialysis acid precursor assembly including: a dry dialysis acid precursor composition including sodium chloride, a dry acid and a magnesium chloride 4.5-hydrate (MgCl2.4.5H2O), a calcium salt and at least one of a potassium salt, calcium salt and an anhydrous glucose, and a moisture-resistant container having a water vapor transmission rate less than 0.2 g/m2/d at 38° C./90% RH, wherein the dry dialysis acid precursor composition is sealed in the container.
US09314478B2 Method of making an anhydrous, fat soluble, chewable drug delivery formulation
The present invention relates to a chewable formulation for delivering a nutritional or pharmaceutically active agent to an animal target. The chewable formulation comprises a nutritional ingredient or an effective amount of a pharmaceutically active agent, and a plasticizer. The chewable formulation is formed by extrusion and the formulation contains substantially no unbound water, nor is any water added in the manufacturing process. The present invention also relates to a method of manufacturing a shelf stable chewable formulation which comprises mixing the nutritional or pharmaceutically active agent with a fat, lipid or fat and lipid to obtain a first composition, adding one or more plasticizers to the first mixture to obtain a second composition, extruding the second composition at a temperature sufficient to melt the fat and lipid, and allowing the extruded second composition to cool to room temperature thereby providing the chewable formulation.
US09314475B2 Oral and injectable formulations of tetracycline compounds
Injectable and oral formulations of a tetracycline compound are described. In one embodiment, the invention pertains to an oral formulation of a 9-aminomethyl tetracycline compound, or a salt thereof, in tablet form or capsule. The formulations may be used, for example, to treat infections.
US09314474B2 Formulations of 14-epi-analogues of vitamin D
The present invention provides new formulations of 14-epi-analogues of vitamin D, such as inecalcitol, providing improved absorption profile.
US09314473B2 System and method for diagnosis and treatment
This invention relates the use of cortisol blockers (glucocorticoid receptor [GR] antagonists) for the treating or preventing treatment resistant prostate cancer, treating or preventing neoplasia, and treating or preventing infection related to acute or chronic injury or disease.
US09314471B2 Methods of preparing pharmaceutical solid state forms
The invention provides and describes solid state 17α-ethynyl-5α-androstane-3α,17β-diol including amorphous and crystalline forms and specific polymorphic forms thereof. Anhydrates and solvates of 17α-ethynyl-5α-androstane-3α,17β-diol include Form III anhydrate and Form I solvate. The invention further relates to solid and suspension formulations containing 17α-ethynyl-5α-androstane-3α,17β-diol in a described solid state form and use of the formulations to treat cancers or precancers such as prostate cancer or breast cancer in subjects or human patients. The invention also relates to methods to make liquid formulations from solid state forms of 17α-ethynyl-5α-androstane-3α,17β-diol and uses of such formulations in treating the described conditions.
US09314467B2 Styrenyl derivative compounds for treating ophthalmic diseases and disorders
The present invention relates generally to compositions and methods for treating neurodegenerative diseases and disorders, particularly ophthalmic diseases and disorders. Provided herein are styrenyl derivative compounds, including but not limited to stilbene derivative compounds, and compositions comprising these compounds, that are useful for treating and preventing ophthalmic diseases and disorders, including age-related macular degeneration (AMD) and Stargardt's Disease.
US09314466B2 Methods for treating cognitive disorders using 1-benzyl-1-hydroxy-2,3-diamino-propyl amines, 3-benzyl-3-hydroxy-2-amino-propionic acid amides and related compounds
Disclosed herein are methods of treating a patient suffering from a cognitive disorder using the following compounds:
US09314463B2 Oligomer-diarylpiperazine conjugates
The invention relates to (among other things) oligomer-diarylpiperazine conjugates and related compounds. A conjugate of the invention, when administered by any of a number of administration routes, exhibits advantages over previously administered un-conjugated diarylpiperazine compounds.
US09314462B2 Compositions and methods for increasing dextromethorphan plasma levels and related pharmacodynamic effects
This disclosure relates to methods of increasing dextromethorphan plasma levels comprising co-administering hydroxybupropion, or a prodrug thereof, and dextromethorphan to a human being in need of treatment with dextromethorphan. Dosage forms, drug delivery systems, and methods related to dextromethorphan and hydroxybupropion or a prodrug of bupropion are also disclosed.
US09314460B1 Method for cancer cell reprogramming
In one embodiment, the invention provides a method of inhibiting cAMP efflux and increasing intracellular cAMP in a subject who suffers from, or who is at risk of developing, a cancer by administering to the subject a therapeutically-effective amount of a cAMP efflux inhibitor. Novel compounds, pharmaceutical compositions, diagnostics and screening methods are also provided.
US09314458B2 Topical use of ingenol-3-angelate or a salt thereof to treat skin cancer
The present invention relates generally to chemical agents useful in the treatment and prophylaxis of inflammatory conditions or in the amelioration of symptoms resulting from or facilitated by an inflammatory condition in a mammalian animal including human and primate, non-mammalian animal and avian species. More particularly, the present invention provides a chemical agent of the macrocyclic diterpene family obtaining from a member of the Euphorbiaceae family of plants or botanical or horticultural relatives thereof or derivatives or chemical analogs or chemically synthetic forms of the agents for use in the treatment or prophylaxis of an inflammatory condition or in the amelioration of symptoms resulting from or facilitated by an inflammatory condition in a mammal, animal or avian species. The present invention further contemplates a method for the prophylaxis or treatment of mammalian, animal or avian subjects for inflammatory conditions including chronic or transitory inflammatory conditions or for ameliorating the symptoms of an inflammatory condition by the topical or systemic administration of a macrocyclic diterpene obtainable from a member of the Euphorbiaceae family or botanical or horticultural relatives thereof or a derivative, chemical analog or chemically synthetic form of the agent. The chemical agent of the present invention may be in the form of a purified compound, mixture of compounds, a precursor form of one or more of the compounds capable of chemical transformation into a therapeutically active agent or be in the form of a chemical fraction, sub-fraction or preparation or extract of the plant.
US09314456B2 Antibacterial compounds
Disclosed are compounds of formula (I): which are of use in the treatment of bacterial diseases and infections, to compositions containing those compounds and to methods of treating bacterial diseases and infections using the compounds. In particular, the compounds are useful for the treatment of infection with, and diseases caused by, Clostridium difficile.
US09314455B2 Solid forms of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid
The present invention relates to a substantially a solid form of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid (Compound 1, Solvate Form A and Compound 1, HCl Salt Form A), processes for making such forms, pharmaceutical compositions thereof, and methods of treatment therewith.
US09314450B2 Combination therapy
The invention relates to pharmaceutical compositions comprising: (a) at least one angiotensin receptor blocker or a pharmaceutically acceptable salt thereof, and (b) at least one chemokine receptor pathway inhibitor or a pharmaceutically acceptable salt thereof. The invention also relates to pharmaceutical compositions comprising: (a) at least one angiotensin receptor blocker or a pharmaceutically acceptable salt thereof; and (b) at least one chemokine receptor pathway inhibitor or a pharmaceutically acceptable salt thereof which inhibits a component of the chemokine receptor pathway other than the chemokine receptor. Oral sustained release pharmaceutical compositions comprising the pharmaceutical composition, as well as injectable sustained release pharmaceutical compositions comprising the pharmaceutical composition are described. The invention further relates to tablets, capsules, injectable suspensions, and compositions for pulmonary or nasal delivery comprising the pharmaceutical composition. Also described are: methods for assessing the efficacy of the pharmaceutical composition; methods for assessing the inhibition or partial inhibition activity of the pharmaceutical composition; methods for the treatment, amelioration or prevention of a condition or disease comprising administering to a subject a therapeutically effective amount of the pharmaceutical composition; and the use of the pharmaceutical composition for the manufacture of a dosage form for the treatment of a disease.
US09314446B2 Sustained releasing pharmaceutical composition
The present invention relates to a formulation made from a chitosan, a gelatin, and a phosphate salt can provide a sustained release/maintenance of a therapeutic agent, wherein the phosphate salt is selected from the group consisting of disodium phosphate and ammonium hydrogen phosphate.
US09314431B2 Solubilized benzoyl small molecule
The invention relates to a novel solubilized small molecule topical formulation for the transdermal delivery of small molecule agents comprising: a small molecule agent, one or more micelle forming compounds, one or more skin penetration enhancers, a surfactant, and one or more solvents, wherein the small molecule agent is solubilized in the solvent. The invention further relates to the use of the topical formulation as well as the process for making the topical formulation.
US09314430B2 Floating gastric retentive dosage form
An elongate dosage form of generally cylindrical shape having two opposing ends, the dosage form being buoyant in. gastric fluid, wherein the dosage form is weight biased such that. one end is heavier than the ether end. The dosage form is adapted to float on gastric fluid with its long axis substantially perpendicular to the surface of the: fluid with its heavier end pointing: generally; downwards and into the fluid.
US09314428B2 Oral composition comprising a cooling agent
The present invention relates to a formulation comprising an endothermic cooling agent selected from the group consisting of xylitol, sorbitol, mannitol and erythritol having a heat of enthalpy between −10 cal/g and −100 cal/g, and one or more active agents wherein the endothermic agent is present in the formulation at an amount less than 10% w/w.