| Document | Document Title |
|---|---|
| US08477189B2 |
Real-time solar observations
A system for real-time solar observation comprises an optical detector operable to detect sunlight and to produce image data from detected sunlight, a shadow detector operable to produce image data relating to a shadow cast by a reference object, and a controller operable to receive image data from the optical detector and from the shadow detector. The controller is operable to determine at least one of a sunrise period, a midday period and a sunset period in dependence upon received image data. |
| US08477188B2 |
Surveillance system for transcoding surveillance image files while retaining geospatial metadata and associated methods
A surveillance video system may include a surveillance image database storing a sequence of surveillance image files for a common area having geospatial metadata associated therewith. A processor may cooperate with the surveillance image database and configured to transcode the surveillance image files into a sequence of surveillance video frames retaining the geospatial metadata. The processor may also be configured to assemble a surveillance video transport stream from the sequence of surveillance video frames retaining the geospatial metadata, and to selectively deliver the surveillance video transport stream retaining the geospatial metadata to at least one surveillance video user. |
| US08477174B2 |
Automatic video switching for multimedia conferencing
After a video conference is established, a video conferencing system receives a video stream from the participants of the video conference. One of the received video streams is transmitted to the conference participants (e.g. the video stream of the person currently speaking). The video conferencing system monitors a second one (or typically all) of the received video streams to determine if a designated video event (e.g. someone raising his hand) has occurred. If the designated video event has occurred, the video conferencing system switches or supplements the currently transmitted video stream to or with the second one of the received video streams that contains the designated video event. The second video stream is then transmitted to participants in the video conference. The switching of the video stream and the switching of the audio stream may be independent. |
| US08477170B2 |
Image forming apparatus with shared line for horizontal synchronization signal
The image forming apparatus includes a video controller unit that receives image information to convert the image information into an image signal for image formation, an engine controller unit that controls image formation, a laser driver unit that emits a laser beam, and a plurality of signal lines that connect the video controller unit, the engine controller unit, and the laser driver unit to each other, wherein the laser driver unit detects the laser beam emitted from the illumination element and generates a horizontal synchronization signal which is electrically transmitted via any one of the plurality of signal lines and used as the reference of an image writing timing in response to the detection. Among the signal lines, a signal line for transmitting the image signal or a control signal electrically and a signal line for electrically transmitting the horizontal synchronization signal are used as a common signal line. |
| US08477159B2 |
Offset cancel output circuit of source driver for driving liquid crystal display
An offset cancel output circuit of source drivers for driving liquid crystal displays which is capable of appropriately cancelling out an offset voltage from an output amplifier to thereby prevent degradation in display quality. The offset cancel output circuit includes an operational amplifier with a non-inverted input port to which a reference voltage is applied, and an input capacitor and an output capacitor with each one end thereof connected to an inverted input port of the operational amplifier. The offset cancel output circuit further includes a switching element circuit which has a first field effect transistor connected between the inverted input port and an output port of the operational amplifier and controlled to turn on during a reset operation. During the reset operation and the normal output operation, a first potential equal to the reference voltage is applied to the substrate of the first field effect transistor. |
| US08477156B2 |
Method of driving a matrix display device having an electron source with reduced capacitive consumption
A method to drive a display device with electron sources displaying grey scales divided into two families. The display device includes one or more rows and one or more columns. An intermediate potential lies between a first potential and a second potential. To display a grey level of the first family, the column voltage is pulse width modulated between the intermediate potential and the second potential right at the start of the row selection period. To display a grey level of the second family, the column voltage is pulse width modulated between the intermediate potential and the first potential from a determined instant of the row selection period. |
| US08477155B2 |
Display method, display controller and display terminal
A display method and apparatus are disclosed. The method includes: when a video layer needs to scale a video image, judging whether a preset policy is met; if so, using the offline mode; otherwise using the online mode; processing the video image in online mode or offline mode, and outputting the processed video image, where the online mode is a mode in which the video image frame is scaled in real time, and the offline mode is a mode in which the video image frame is scaled asynchronously. With the display method and apparatus, the source video image can be scaled in any ratio by selecting the online mode or offline mode, thus reducing the display power consumption. |
| US08477154B2 |
Method and system for interactive virtual inspection of modeled objects
A method of using a Graphic User Interface (GUI) for interactive virtual inspection of modeled objects. The method includes acquiring a three-dimensional model of a modeled object and displaying a first view of the modeled object for a user to identify locations of interest on a surface of the modeled object visible within the first view. The user enters information to create a markup tag that annotates the location of interest, and the markup tag is automatically associated with the location of interest on the modeled object. A second view of the modeled object is displayed including the user identified location of interest and the markup tag. |
| US08477150B2 |
Display signal conversion apparatus
A display signal conversion apparatus converts a first signal having a first color format and color arrangement into a second signal having a second color format and color arrangement. The display signal conversion apparatus includes a color conversion unit configured to convert the first color format into the second color format, a pattern determination unit configured to determine a signal pattern of the first signal, a unit configured to determine a color arrangement of a pixel position of the second signal corresponding to a pixel position of the first signal, and a sub pixel signal generation unit configured to generate a sub pixel signal having the second color format and color arrangement based on a result of the signal pattern determination and a result of the color arrangement determination. |
| US08477149B2 |
Real-time chromakey matting using image statistics
A method, system and computer readable media for real-time chromakey matting using image statistics. To identify the chroma key spectrum, the system/method executes in three stages. In an off-line training stage, the system performs semi-automatic calibration of the chroma key parameterization. In the real-time classification stage, the system estimates the alpha matte on a GPU. Finally, an optional error minimization stage improves the estimated matte, accounting for misclassifications and signal noise. Given the resulting matte, standard alpha blending composites the virtual scene with the video feed to create the illusion that both worlds coexist. |
| US08477146B2 |
Processing rasterized data
Devices, methods, and other embodiments associated with processing rasterized data are described. In one embodiment, an apparatus includes translation logic for converting lines of rasterized pixel data of a compressed image to a plurality of two-dimensional data blocks. The lines of rasterized pixel data are stored in consecutive memory locations. Each data block is stored in a consecutive memory location. The apparatus includes decompression logic for at least partially decompressing the compressed image based, at least in part, on the two-dimensional data blocks. |
| US08477145B2 |
Memory address re-mapping of graphics data
A method and apparatus for creating, updating, and using guest physical address (GPA) to host physical address (HPA) shadow translation tables for translating GPAs of graphics data direct memory access (DMA) requests of a computing environment implementing a virtual machine monitor to support virtual machines. The requests may be sent through a render or display path of the computing environment from one or more virtual machines, transparently with respect to the virtual machine monitor. The creating, updating, and using may be performed by a memory controller detecting entries sent to existing global and page directory tables, forking off shadow table entries from the detected entries, and translating GPAs to HPAs for the shadow table entries. |
| US08477136B2 |
Functional presentation layer in a lightweight client architecture
A device generates an immutable display graph with leaves of the display graph representing low-level graphical operations such as drawings lines or a bitmap and nodes of the display graph representing translation and clipping. Because the display graph is immutable, it can be cached, shared, and rendered quickly. The structure of the display remains fixed, but elements such as rectangle fill, text position, clipping area, translation, and image location, remain time varying and can change without affecting the structure of the display. |
| US08477134B1 |
Conservative triage of polygon status using low precision edge evaluation and high precision edge evaluation
In a raster stage of a graphics processor, a method for using low precision evaluation and high precision evaluation for conservative triage of polygon status. The method includes receiving a graphics primitive for rasterization in a raster stage of a graphics processor and rasterizing the graphics primitive to generate a plurality of tiles of pixels related to the graphics primitive. The tiles are rasterized at a first level precision to generate a plurality of sub-tiles related to the graphics primitive, wherein the sub-tiles are evaluated against the graphics primitive at each of their respective corners. Each of the sub-tiles not related to the graphics primitive are discarded. The sub-tiles related to the graphics primitive are rasterized at a second level precision. |
| US08477132B2 |
Device and method for driving image display device
A device for driving an image display device that includes an image display panel, a plurality of drivers for driving the image display panel, a Low Voltage Differential Signaling (LVDS) transmission unit for converting external image data and a plurality of control signals including frame ratio setting signals into LVDS signals and transmitting the same, an LVDS reception unit for converting the image data and the plurality of control signals including frame ratio setting signals OP1, OP1 converted into the LVDS signals and transmitted thus into TTL signals and forwarding the same, and a timing controller for aligning the image data to fit to the display frame ratio according to the frame ratio setting signal and the plurality of control signals from the LVDS reception unit and supplying the same to the plurality of drivers, for displaying the image on the image display panel. |
| US08477131B2 |
Display device
A decoder circuit which outputs a voltage based on a 8-bit digital value includes: a first decoder circuit and a second decoder circuit which output one voltage respectively using upper-order 6 bits of the 8-bit digital value; a selection circuit which receives voltages outputted from the first decoder circuit and the second decoder circuit, and distributes the two voltages to three terminals; and an intermediate voltage output circuit which outputs an intermediate voltage which is a one of five kinds of values based on the three voltages. The first decoder circuit and the second decoder circuit respectively include a select-switch-type decoder circuit and a tournament-type decoder circuit. Due to such a constitution, it is possible to reduce a circuit scale of the decoder circuit which outputs the voltage corresponding to the 8-bit digital value. |
| US08477122B2 |
Display apparatus, displaying method and computer readable medium
The display apparatus is provided with: a display that displays a raw image and an identification image by which an electronic document is identifiable within a screen including at least two areas, the raw image representing a content of the electronic document, the identification image being smaller than the raw image; a detection unit that detects a moving operation of the raw image displayed in a first area to a second area that is different from the first area; and a controller that controls the display to display the identification image in the second area in response to the detection by the detection unit. |
| US08477116B2 |
Multiple touch location in a three dimensional touch screen sensor
A touch screen capable of correctly identifying multiple touches employs multiple active line arrays oriented to provide multi-dimensional data. Three arrays of capacitance based active lines are each distinctly oriented to form a plurality of intersections. A first and second array are generally oriented perpendicularly while a third array is oriented to bisect the resulting matrix such that the active lines of the third array also intersect the existing vertices. As a result of a touch each active line array identifies the location of the touch from three distinct directions. Ambiguity from dual touch scenarios existing in dual array systems is removed by providing an additional reference. |
| US08477107B2 |
Function selection systems and methods
Function selection system and method for use in an electronic device are provided. The system includes a display unit and a processing unit. The display unit has a display area, and displays a specific region within the display area. The processing unit selects one of a plurality of functions according to a position of the specific region in the display area. The specific region is removable, and used to display data generated by the selected function. |
| US08477101B2 |
Reading device for electronic document and operation method of reading electronic document
A reading device for an electronic document and an operation method of reading an electronic document are provided. The reading device for the electronic document includes an input module and a main body. When the user operates the input module to move in 3D space, the input module can detect a motion state of the input module in the 3D space and generate motion data. Additionally, the main body includes a screen used for displaying a picture of the electronic document. The main body may be connected with the input module via a wireless transmission path. As a result, the main body can receive the motion data generated by the input module and compute the motion data to generate an operation instruction, and then the main body may adjust the picture of the electronic document according to the operation instruction. |
| US08477097B2 |
Method and system for controlling a display device
Embodiments of the present invention are directed to a method and system for controlling a display device. In one embodiment, a start position is registered which defines the first position and orientation of a remote controller relative to the position of the display device. When movement of the remote controller is detected, a second position and orientation of the remote controller is determined. A point on the display device is determined where a mathematical line extending from the front edge of the remote controller along its longitudinal axis intersects the front plane of the display device. Finally, a message is sent for causing a cursor displayed on the display device to be moved to the point where the mathematical line intersects the front plane of the display device. |
| US08477093B2 |
Device for adjusting transmission signal level based on channel loading
A device for controlling the level of a transmission signal according to the channel loading is provided. The device may include a plurality of semiconductor devices and a controller to control the plurality of semiconductor devices. The controller may control the level of a signal to be transmitted to each of the plurality of semiconductor devices according to the channel loading on each semiconductor device. |
| US08477091B2 |
Information output unit and electronic apparatus
An information output unit according to the present invention includes a first-gamma-correction-information storing unit that stores gamma correction information suitable for display of an image by a first liquid crystal display unit, a gamma correction unit that applies gamma correction based on the gamma correction information stored in the first-gamma-correction-information storing unit to inputted image information and outputs obtained image information to the liquid crystal display unit, a second gamma-correction-information storing unit that stores, when gamma correction is applied to the image information outputted by the gamma correction unit, gamma correction information for obtaining image information suitable for display of an image by a second liquid crystal display unit, and a control unit that outputs the gamma correction information stored in the second-gamma-correction-information storing unit to the liquid crystal display unit. Therefore, it is possible to obtain an information output unit that can make it unnecessary to perform operation in replacing a liquid crystal display unit and can prevent an increase in size of an apparatus, an increase in power consumption, and the like. |
| US08477088B2 |
Display device and display driving method including a voltage controller and a signal amplitude reference voltage changer
A display device includes a display panel unit configured to include pixel circuits in each of which an organic electroluminescence device is used as a light emitting device and is driven to emit light with luminance dependent upon a voltage difference between a signal value voltage of an input display data signal and a signal amplitude reference voltage. The display device further includes: a voltage controller configured to carry out grayscale value detection for a display data signal to be supplied to the display panel unit in every predetermined period, and create voltage control information of the signal amplitude reference voltage by using a detected grayscale value; and a signal amplitude reference voltage changer configured to change a voltage value of the signal amplitude reference voltage to be supplied to the pixel circuits of the display panel unit, based on voltage control information created by the voltage controller. |
| US08477074B2 |
Card-type device
A slide antenna board is slidably provided between a state in which slide antenna board is accommodated in a card body and a state in which slide antenna board is pulled out from the card body. The slide antenna board includes a planar type antenna. A base end side of a rod antenna is fixed to the card body and an extended side of the rod antenna is slidably and stretchably disposed in a slide direction of the slide antenna board through a slide guide in the slide antenna board. A leading end surface of rod antenna is not projected ahead of a leading end surface of slide antenna board in a state in which rod antenna is accommodated. An engagement unit engaging the slide antenna board is provided with the leading end side of rod antenna. The rod antenna engaging slide antenna board is configured to be pulled out together with slide antenna board while slide antenna board is pulled out from card body. |
| US08477073B2 |
Internal wide band antenna using slow wave structure
Disclosed is a wide-band internal antenna that uses a slow-wave structure. The antenna includes an impedance matching/power feed part, which includes a first conductive element that extends from a power feed line and a second conductive element that is separated by a particular distance from the first conductive element and is electrically connected with a ground, and at least one radiator extending from the impedance matching/power feed part. Here, the first conductive element and the second conductive element of the impedance matching/power feed part form a slow-wave structure. By applying a slow-wave structure to coupling matching, the antenna provides the advantage of resolving the problem of narrow band characteristics found in inverted-F antennas while maintaining a low profile. |
| US08477072B2 |
Radio frequency (RF) particles
The present disclosure generally describes radio frequency (RF) particles and an RF powder-containing base including a plurality of such RF particles. The RF particles may include an antenna element and an integrated circuit element coupled together by at least one interconnection. The base may be formed from sheet-like subjects, such as various kinds of cards, bills, and documents. Methods of forming the RF powder-containing base are also generally disclosed. |
| US08477068B2 |
Systems and methods for alignment with a remote source
Systems and methods for monitoring, testing, and controlling alignment are provided, including an antenna assembly with an antenna and a receiver, the antenna configured to receive signals from a remote source, the receiver coupled to the antenna and configured to generate signal strength values associated with the signals from the remote source, and where the antenna assembly exhibits an azimuthal alignment relative to an axis determined by the antenna assembly and the remote source. Systems and methods provided herein further generate a first coarse-grained signal strength value from set of signal strength values generated by the receiver while the antenna assembly is at a first azimuthal alignment offset, and generate a measure that the first azimuthal alignment offset is at least one of: less than a predetermined azimuthal alignment offset, approximately equal to the predetermined azimuthal alignment offset, and greater than the predetermined azimuthal alignment magnitude. |
| US08477066B2 |
GPS pre-aquisition for geotagging digital photos
A handheld electronic device, such as a GPS-enabled wireless communications device with an embedded camera, a GPS-enabled camera-phone or a GPS-enabled digital camera, determines whether ephemeris data needs to be obtained for geotagging digital photos taken with the device. By monitoring user activity with respect to the camera, such as activation of the camera, the device can begin pre-acquisition of a GPS position fix by obtaining needed ephemeris data before the photograph is actually taken. This GPS pre-acquisition improves the likelihood that a position fix (GPS lock) is achieved by the time the photo is taken (to enable immediate geotagging). Alternatively, the photo can be geotagged retroactively by appending the current location to the metadata tag associated with the digital photo. An optional acquisition status indicator can be displayed on a user interface of the device to indicate that a position fix is being obtained. |
| US08477064B2 |
Loop-powered field device
A loop-powered field device for determining a process variable and providing a measurement signal indicative of the process variable to a remote location via a two-wire current loop, the loop-powered field device comprising: a measurement device for determining the process variable; and loop interface circuitry for providing the measurement signal to the two-wire current loop and for providing power from the two-wire current loop to the measurement device. The loop interface circuitry comprises: current control circuitry connected to the two-wire current loop and the measurement device, the current control circuitry being controllable by the measurement device to provide the measurement signal to the two-wire current loop; a first converter having inputs connected to the two-wire current loop in series with the current control circuitry, and an output for providing power to the measurement device; and voltage regulation circuitry for regulating a voltage across the current control circuitry towards a desired voltage, by controlling an input voltage across the inputs of the first converter. |
| US08477058B2 |
Successive approximation analog to digital converter with a direct switching technique for capacitor array through comparator output and method thereof
A method for a successive approximation register ADC which includes at least one capacitor array and a plurality of switches is provided, in which the capacitors of the capacitor array are one-to-one corresponding to the switches. The method includes the following steps: firstly, at least one multiplexer is configured. Then, a first comparison voltage is outputted based on the terminal voltages on the terminals of the capacitor array, and a comparison result is outputted according to the first comparison voltage and a second comparison voltage. Afterwards, a sequence of comparisons is controlled based on the comparison result to enter into a sequence of comparison phases. Finally, the switches are orderly selected, by the multiplexer based on the comparison phases, to switch directly according to the comparison result. |
| US08477053B2 |
ADC with resolution detector and variable dither
A resolution detector may be used in conjunction with an ADC to identify unresolved bits in a raw digital output of the ADC. Bits that have been properly resolved by the ADC may be distinguished from those that have not been successfully resolved, because of time limitations or other reasons. Each bit that has not been successfully resolved may be classified and referred to as an unresolved bit. If there are any unresolved bits detected in a sampling cycle, dither may then be incorporated in the raw digital output to compensate for the unresolved bits in that cycle. The dither may be added to the raw digital output of the ADC to eliminate any missing codes in the processed digital output codes or the dither may be substituted for the unresolved bits in raw digital output to generate the processed digital output. |
| US08477052B2 |
Method and apparatus for self-test of successive approximation register (SAR) A/D converter
A single-ended SAR ADC includes an additional capacitor, a self-test engine, and independent control of sample and hold conditions, which allows for quick and accurate testing of the ADC. |
| US08477050B1 |
Apparatus and method for encoding using signal fragments for redundant transmission of data
A system and method for redundant transmission is provided. In one embodiment, an input signal S is encoded as a list of fragments. Each fragment includes an index value and a projection value. The index points to an entry in a dictionary of signal elements. A repetition factor is assigned to each fragment based on its importance. After a fragment is added, a reconstructed signal is generated by decoding the list of fragments. Encoding terminates once the reconstructed signal is sufficiently close to the original signal S. |
| US08477048B2 |
Method and device for preventing an anti-collision system on board an airplane from emitting alarms, during an altitude capture maneuver
According to the invention, the device (1) comprises means (3) for detecting, during an altitude capture maneuver, the emission of a first type alarm by the anti-collision system (2) and means (4) for controlling the vertical speed of said airplane (AC), after the emission of such an alarm, until the triggering of the capture phase. |
| US08477047B1 |
Single audio control panel configuration
The present invention is a communication system for implementation on-board an aircraft. The communication system includes an Audio Control Panel (ACP) including a first input device associated with an installed component and a second input device associated with an uninstalled component. The communication system further includes a Radio Interface Unit (RIU) which is communicatively coupled to the ACP. The communication system further includes an Engine Indicating and Crew Alerting System (EICAS) which includes a Display Management Computer (DMC), the EICAS being communicatively coupled to the RIU and an Aircraft Personality Module (APM) of the communication system. The DMC may be configured for evaluating an input device status (generated based upon an input received via the second input device) against an APM configuration file, and based upon said evaluation, providing an aural and/or visual alert to a user that an input device associated with an uninstalled component has been activated. |
| US08477042B2 |
Apparatus for signaling different notification appliance circuit configurations
An arrangement for use in a safety notification system includes first, second, third and four outputs configurable for first and second wiring configurations of notification appliance circuits. The arrangement also includes a configurable terminal arrangement having first and second configurations corresponding to the first and second wiring configurations, and an end-of-line resistor. The configurable terminal arrangement in the first configuration couples the end-of-line resistor between the third and fourth outputs. The configurable terminal arrangement in the second configuration decouples the end-of-line resistor from the third and fourth outputs. |
| US08477041B2 |
Device and method for temperature monitoring and warning
A wireless communication device and method adapted for temperature monitoring and warning is disclosed. In its simplest form, it can include: providing (510) a multi-mode communication device including an unrestricted mode having an unrestricted operation temperature range, a restricted mode having a restricted operation temperature range and a warning mode having a warning operation temperature range; determining (520) if a temperature in proximity to the energy storage device is in at least one of the restricted operation temperature range, the unrestricted operation temperature range and a warning operation temperature range; and entering (540) the warning mode when in the warning operation temperature range. The warning mode can include a notification, banner or the like, to a user, to suggest that at least one active application be shut down. |
| US08477040B2 |
Method and apparatus for testing the integrity of a tank
A system and method for detecting a leak or structural defect in a tank are provided. The system includes a removable test plate to seal an opening in a tank to be tested with all other openings in the tank to be sealed. The system also includes a motor-driven blower or other vacuum-generating device coupled to a first opening in the test plate. When the blower is activated, it generates a vacuum inside the tank of a predetermined value. A vacuum-monitoring device is coupled to a second opening in the test plate and monitors the vacuum in the tank. A leak or structural defect in the tank is indicated if the vacuum decreases from the predetermined value by more than a predetermined differential within a predetermined time. |
| US08477038B2 |
Method of producing a proof of presence or of operation of an entity in an identified zone for a duration greater than a given threshold, and monitoring system
A method for producing a proof of the presence and/or of the availability of an entity in a site over a period that is greater than or equal to a presence threshold, the method including: successively transmitting messages, the messages being generated from a secret such that the secret may be reconstituted by having the knowledge of a given number of messages that is greater than or equal to a threshold, each message being transmitted over a transmission period whose duration is chosen such that the product of the duration of the transmission period times the threshold is substantially equal to the presence threshold; comparing the secret and a secret candidate generated from messages received by the entity; the proof being produced only if the secret and the secret candidate are equal. |
| US08477031B2 |
Communication port identification system
A communication port identification system enables an intelligent interconnect patch panel to reliably track connections to network switches. Network switch ports are provided with port ID modules that are inserted into the ports. Intelligent interconnect patch cords each utilize a patch cord microcontroller and out-of-band conductors to enable communication between an intelligent interconnect patch panel and the port ID modules of the switch port. Each port ID module is provided with a unique identification number, and the intelligent interconnect patch panel is thereby able to track all of its connections to the port ID modules in real time, and to update a network management system accordingly. |
| US08477030B2 |
Optical amplifier module and dispersion compensation fiber loss detection method
An optical amplifier module includes a first optical amplifier to amplify main signal light to be supplied to a dispersion compensation fiber (DCF), a second optical amplifier to amplify the main signal light supplied from the DCF, a generating part to generate monitoring light having a wavelength longer than a wavelength of the main signal light, a multiplexing part to multiplex the monitoring light generated by the generating part and the main signal light to be supplied to the DCF, a demultiplexing part to demultiplex the monitoring light from the main signal light supplied from the DCF, and a detection part to detect a light intensity of the monitoring light demultiplexed by the demultiplexing part. |
| US08477027B2 |
Wireless sensor system
A wireless sensor system for detecting electrical power lines in proximity to equipment includes a base station mounted in proximity to an operator of the equipment and a wireless sensor. The wireless sensor detects the presence of power lines by sensing an electrical field generated by the power lines and includes an accelerometer which senses motion of the equipment. The wireless sensor communicates data to the base station. The base station presents at least one alarm to the operator when the wireless sensor detects an electrical field with a magnitude which exceeds a selectable threshold and silences the least one alarm if no motion above a predetermined threshold is sensed for a predetermined period of time. |
| US08477026B2 |
Medical data transmission system
A system for transmission of medical data comprises a first device which is designed to be worn on the body of a patient and which generates medically relevant data when in operation, said data being transmitted wirelessly to a second device. The first device comprises a communication unit for the wireless communication with the second device, a circuit which generates medically relevant data when in operation and a handover memory for the intermediate storage of data that are to be transferred from the circuit to the communication unit or from the communication unit to the circuit. The data generating circuit is connected to the handover memory via a first data line and the communication unit is connected to the handover memory via a second data line. The first device comprises a change-over switch closing the first data line and interrupting the second data line in a first switched state and interrupting the first data line and closing the second data line in a second switched state, said change-over switch changing between the first and second switched state without communication with the data generating circuit. |
| US08477022B2 |
Vehicular display apparatus
A vehicular display apparatus of the invention includes a display portion that displays a predetermined graphic in accordance with a present consumption amount of energy used for moving a vehicle. The graphic displayed on the display portion changes at least one of a displayed size and a displayed color thereof in accordance with the consumption amount. The displayed size increases as the consumption amount increases. The displayed color is changed to have a longer wavelength of color as the consumption amount increases. |
| US08477019B2 |
Methods and apparatus for a universal device controller using peer to peer communication
Methods and apparatus relating to wireless remote control are described. A communications device, such as a cell phone with peer to peer signaling capability, supports remote control functionality. The same communications device can be used as a universal wireless remote controller for a plurality of different remotely controllable devices including, e.g., a television, a DVD player, a light switch, a garage door opener, etc. The communications device monitors for and detects peer to peer signals from remotely controllable devices in its local vicinity. The communications device maintains a list of remotely controllable devices in its vicinity based on the detected peer to peer signals. The universal remote control user interface is configured in accordance with the maintained list. The universal remote controller provides a user interface which varies based on the device to be controlled. |
| US08477018B2 |
Rotation-activated electronic component with time-limited use
A rotation-activated electronic component, preferably a RFID tag mounted on or incorporated in a support that is rotated when read, e.g. a CD or DVD. The RFID tag comprises an antenna, a rotational switch, a component, advantageously a processor, and a time usage limiter. The antenna is adapted to transform received RFID signals to electric energy that powers the component and the rotational switch is adapted to cut the circuit unless the support does not rotate at or above a certain rotational speed. The time usage limiter counts down a timer when it is powered via the rotational switch and disables the RFID tag when the timer expires. Supports equipped with the RFID tag of the invention will thus respond until the timer expires, and preferably only if they rotate sufficiently. |
| US08477010B2 |
Method for communicating information by infrared rays between a transmitter and a receiver in a home-automation network
Method for communicating information by infrared radiation between a control command transmitter for a motorized product for closure, privacy or solar protection in a building and a control command receiver, comprising the transmission of a communication frame including: a preamble signal consisting of the repetition of pulses of a first type, and a data signal, the data being translated into the form of pulses of a second type, wherein the preamble signal and the data signal are modulated at the same frequency and wherein the data signal is separated from the preamble signal by a signal-free period having a duration of greater than twice the maximum duration separating two successive pulses of the second type. |
| US08477008B2 |
Electronic apparatus, remote controller and remote control system
An electronic apparatus is remotely controlled based on a remote control signal transmitted from a remote controller using radio wave. The electronic apparatus contains a communication module that receives the remote control signal transmitted from the remote controller and an electronic apparatus main body that performs predetermined processing based on the remote control signal from the remote controller. The remote control signal is received by the communication module. The communication module has an intermittent operation mode in which the communication module operates intermittently when the electronic apparatus main body shifts to a standby state thereof. The period of off time of the communication module in the intermittent operation mode thereof is shorter than a period of transmission time of the remote controller for transmitting a power-on signal that causes the electronic apparatus main body to shift the standby state thereof to a normal state thereof. |
| US08477003B2 |
Apparatus for generating a multi-vibrational field
An apparatus may deliver multi-vibrational electromagnetic (MVEM) fields which are independent but may work simultaneously. The MVEM fields may be used in many applications, including eliminating calcium build-up in pipes, reducing soap usage in laundry, reducing salt usage in water softeners, reducing chlorine use in pools, inhibiting algae growth, increasing water clarity, restructuring or inhibiting nitrates, restructuring or inhibiting tannins, restructuring or inhibiting calcium salts and other minerals, treating pain, treating inflammation, enhancing after-surgery healing, and improving circulation in treated areas of animals and humans. The apparatus may be formed from a plurality of wire-wrapped rods connected to a power supply. The plurality of rods may be incased in flexible foam and wrapped in a fabric outer covering. |
| US08477002B2 |
Electromagnetic hydraulic valve
An electromagnetic hydraulic valve, having a solenoid (1) with a coil carrier (3), which receives at least one coil (4) in a completely encapsulated manner in an injection-molded encapsulation (7) and carries at least one terminal, wherein the terminal is formed of individual segments (10, 11) which are inserted into radially extending through openings (8, 9) that are formed in the coil carrier (3) and in the insert molding (7) adjacent to the at least one coil (4). |
| US08477001B2 |
Starter solenoid with rectangular coil winding
A solenoid for a vehicle starter includes a pull-in coil made of a length of rectangular wire and a hold-in coil adjacent to the pull-in coil. A plunger is configured to move in an axial direction when the pull-in coil made of rectangular wire is energized. The pull-in coil and the hold-in coil are positioned on a spool with the plunger slideably positioned within a central passage of the spool. The plunger is configured to engage a plunger stop when the pull-in coil is energized. In at least one embodiment, the hold-in coil is separated from the plunger stop in the axial direction and the hold-in coil encircles the plunger stop. |
| US08476999B1 |
Magnetically loaded electromechanical switches
A switching device can include a housing with a core rotatably or slidably located therein. The housing and core can have magnetic poles aligned in a natural position at a natural magnetic state. The device can include an armature with a coil that provides armature magnetic poles. The armature magnetic poles are not aligned with the housing magnetic poles. As such, energizing the armature can cause the core to transition from the natural position at the natural magnetic state to an energized position in an energized magnetic state. The core magnetic poles are aligned with the armature magnetic poles when energized. A method can be used that transitions the core when the coil is energized. The core can include a mirror to reflect a beam of light, which can scan the beam of light when the core, and thereby the mirror, is transitioned between natural and energized positions. |
| US08476996B2 |
Bistable switching method and latching relay using the same
A bistable switching method and a latching relay using the same are provided. The latching relay includes a rotor shaft, a cylindrical permanent magnet, a first permeability material, a second permeability material, a coil, a hitting device and a contact unit. The method includes the following steps. While the coil is applied first direction currents, the rotor shaft rotates and to make the contact unit from the open state to the closed state or the contact unit keeps the closed state. After the first direction currents are turned off, the contact unit still remains in the closed state. Otherwise, while the coil is applied second direction currents, the rotor shaft rotates and to make the contact unit from the closed state to the open state or the contact unit keeps the open state. After the second direction currents are turned off, the contact unit still remains in the open state. |
| US08476991B2 |
Elastic wave resonator, elastic wave filter, and antenna sharing device using the same
An acoustic wave resonance device includes: piezoelectric substrate (1), first acoustic wave resonator (100) provided on an upper surface of piezoelectric substrate (1) and including first interdigital transducer electrode (110), and second acoustic wave resonator (200) provided on piezoelectric substrate (1) and including second interdigital transducer electrode (210). First acoustic wave resonator (100) and second acoustic wave resonator (200) are connected to each other. An overlap width of a plurality of first comb-shaped electrodes (112) forming first acoustic wave resonator (100) is larger than an overlap width of a plurality of second comb-shaped electrodes (212) forming second acoustic wave resonator (200). With such a configuration, frequencies in which a transverse mode spurious response is generated can be distributed and loss can be reduced. |
| US08476987B2 |
Integrated bidirectional coupler
A distributed-line directional coupler including: a first conductive line between first and second ports intended to convey a signal to be transmitted; and a second conductive line, coupled to the first one, between third and fourth ports, the second line being interrupted approximately at its middle, the two intermediary ends being connected to attenuators. |
| US08476983B2 |
Optical module and atomic oscillator
An optical module of an atomic oscillator using a quantum interference effect includes a light source to generate first light including a fundamental wave having a center wavelength, and including a first sideband wave and a second sideband wave having wavelengths that are different from each other, a wavelength selection unit that emits second light by selecting the first sideband wave and the second sideband wave of the first light and by allowing them to pass through, a gas cell in which an alkali metal gas is sealed and to which the second light is irradiated, and a light detection unit that detects an intensity of the second light passing through the gas cell. |
| US08476981B2 |
Unbalanced/balanced conversion differential amplifier
A differential amplifier including an input of a balanced type relative to a reference potential; a balanced output; first and second bipolar transistors mounted in common emitter configuration, emitters of the first and second transistors linked by two feedback impedances in series; and a perfect current generator, wherein an impedance Zg at the terminals of the current generator is connected between a common point of the two feedback impedances and the reference potential, the input is connected to a base of the first transistor, a base of the second transistor is linked to the reference potential to form, with a base of the first transistor, the unbalanced input, the balanced output is produced by collectors of the first and second transistors through an impedance matching stage of the output, a correction feedback impedance Zcorr, wherein Zcorr=2·Zg, connects the collector of the second transistor and the base of the first transistor. |
| US08476979B1 |
High-efficiency power module
One or more embodiments of the present invention pertain to an all solid-state microwave power module. The module includes a plurality of solid-state amplifiers configured to amplify a signal using a low power stage, a medium power stage, and a high power stage. The module also includes a power conditioner configured to activate a voltage sequencer (e.g., bias controller) when power is received from a power source. The voltage sequencer is configured to sequentially apply voltage to a gate of each amplifier and sequentially apply voltage to a drain of each amplifier. |
| US08476978B2 |
Headphone driver/charge pump combination
A headphone driver amplifier operative without an external negative voltage power supply, coupled directly to the headphone speakers without the need for DC coupling capacitors used for preventing DC reaching the headphones. An onboard power supply generates a negative voltage rail which powers the output amplifiers, allowing driver amplifier operation from both positive and negative rails. Since the amplifiers can be biased at ground potential (O volts), no significant DC voltage exists across the speaker load and the need for DC coupling capacitors is eliminated. |
| US08476974B2 |
Differential amplifier and method for the operation of a differential amplifier
A differential amplifier comprises a first amplifier (A1) with a signal input (Inp) and a signal output (Out1) that is fed back to a first feedback input (In1) of the first amplifier (A1) and is also connected to a first output (outp) of the differential amplifier. Furthermore, a buffer circuit (Buff) is connected to the first output (outp). A nonlinear resistor circuit (Rnl1, Rnl2) is coupled via a first output node (Vmid1) with the first output (outp) and via a second output node (Vmid2) with the buffer circuit (Buff). |
| US08476971B2 |
Buffer operational amplifier with self-offset compensator and embedded segmented DAC for improved linearity LCD driver
A driver utilizes selective biasing of the terminal of an operational amplifier to reduce offset in the operational amplifier output. Each operational amplifier input includes a differential input pair of transistors including a NMOS transistor and PMOS transistor. At low and high ends of the input voltage range these transistors are selectively and individually coupled to either a standard input or biased to be on so as to contribute offset for offset compensation. The transistors are biased in a conventional manner for input voltages between the low and high ends of the voltage range. |
| US08476963B2 |
Exponential charge pump
An exponential multistage charge pump is provided wherein node voltages in a pumpcell in one stage of the charge pump are used to control operation of clock drivers in a subsequent stage of the charge pump. |
| US08476962B2 |
System having multiple voltage tiers and method therefor
A system includes a first circuit, a first charge pump, a second circuit, and a second charge pump. The first circuit has a first power supply terminal coupled to a positive power supply terminal and a second power supply terminal. The first charge pump has an input coupled to positive power supply terminal and an output coupled to the second power supply terminal of the first circuit. The second circuit has a first power supply terminal coupled the second power supply terminal of the first circuit and a second power supply terminal. The second charge pump has an input coupled to the first power supply terminal of the second circuit and an output coupled to the second power supply terminal of the second circuit. |
| US08476961B2 |
System and method of transistor switch biasing in a high power semiconductor switch
A system and method are provided for biasing transistor switches in a semiconductor based high power switch. Off-state Vgsd biasing for the off transistor switches is based upon acceptable levels of spurious harmonic emissions and linearity. |
| US08476958B2 |
Mixer circuit
The invention discloses a mixer circuit (10, 20, 30, 410, 60) comprising a first mixer component (11, 21) with a first (13, 23) and a second (12, 22) input port for a first and a second input signal respectively and an output port (14, 24) for outputting a mixed signal. According to the invention, the mixer circuit (10, 20, 30, 410, 60) also comprises a transformer (15) which connects the first (13, 23) and second (12, 22) input ports of the mixer component (11, 21) inductively via an inverting coupling. In one embodiment, the mixer circuit (30, 410, 60) also comprises inputs for DC-bias of one (13) of the input ports and of the output port (14), as well as an impedance (31) as a filter at the output port. |
| US08476957B2 |
Voltage level shifter
Provided is a voltage level shifter changing an input voltage level and outputting the input voltage. There is provided the voltage level shifter, including: an operational amplifier having a first input having an applied input voltage thereto; a first MOSFET having a gate connected to an output of the operational amplifier, a source having an applied power thereto, and a drain outputting an output voltage; a voltage dividing resistor unit including a plurality of voltage dividing resistors sequentially connected to the drain of the first MOSFET in series, one connection node between the plurality of voltage dividing resistors being connected to the second input of the operational amplifier; and a second MOSFET having a source and a drain, respectively connected to both ends of at least one of the voltage dividing resistors, and a gate connected to the gate of the first MOSFET. |
| US08476956B2 |
Semiconductor switch
According to one embodiment, a semiconductor switch includes a power supply section, a driver, and a switch section. The power supply section is configured to generate a first potential higher than a positive power supply potential, and a negative second potential. The driver is connected to the power supply section and configured to output a control signal. A potential of the control signal is set to the first potential at high level and set to the second potential at low level according to a terminal switching signal. The switch section is configured to receive the control signal and switch a connection between terminals. The driver has a first level shifter, a second level shifter and a first circuit. The first level shifter has a first high-side switch and a first low-side switch. The second level shifter has a second high-side switch and a second low-side switch. |
| US08476945B2 |
Phase profile generator
Phase profile generator systems and methods are disclosed. A system includes a signal generator, a target phase trajectory module, an error detector and a control loop filter. The signal generator is configured to generate an output signal. In addition, the target phase trajectory module is configured to track a target phase trajectory and determine a next adjustment of the output signal to conform the output signal to a portion of the target phase trajectory. Further, the error detector is configured to determine an error between the output signal and a current target phase trajectory value that precedes the portion of the target phase trajectory, where the determination of the error is independent of the next adjustment of the output signal. Moreover, the control loop filter is configured to control the signal generator in accordance with both the next adjustment and the error to generate a phase profile. |
| US08476944B2 |
Reset circuit
A reset circuit includes two voltage dividing circuits, a switching circuit, a selection button, two voltage converters, and a processor. The voltage converters convert a first or second power supply for supplying power to the processor. When the first power supply supplies power to the processor the processor operates normally. When the second power supply supplies power to the processor, one of the voltage dividing circuits outputs a signal to the processor to restore an electronic device to factory settings according to the signal. |
| US08476938B2 |
Device and method for generating three mode signal
The device for generating three mode signals includes: a voltage setting block including an input terminal receiving three input signals of driving voltage, open, and ground and setting three voltages according to the three input signals; and an output block including two output terminals and a second node B receiving the three voltages from the voltage setting block, and outputting three combined signals by comparing an input voltage with a reference voltage, whereby only a small number of resistors and amplifiers generates three mode signals to further reduce the chip size than the related art and the external power source is not required to solve the problems of the related art due to noise. |
| US08476933B2 |
Receiver circuit of semiconductor apparatus and method for receiving signal
A receiver circuit of a semiconductor apparatus includes a first sense amplifier, a level restriction unit, and a second sense amplifier. The first sense amplifier amplifies an input signal in response to a clock signal and generates a first signal with a voltage swing between a first level and a second level. The level restriction unit receives the first signal and generates a correction signal with a voltage swing between the first level and a third level. The second sense amplifier amplifies the correction signal in response to the clock signal and generates a second signal with the voltage swing between the first level and the second level. |
| US08476928B1 |
System level interconnect with programmable switching
Different functional elements are all located on a same integrated circuit wherein at least one of the functional elements comprises a micro-controller. Configuration registers or configuration memory in the integrated circuit store configuration values loaded by the micro-controller. Connectors are configured to connect the integrated circuit to external signals A system level interconnect also located in the integrated circuit programmably connects together the different functional elements and different connectors according to the configuration values loaded into the configuration registers. |
| US08476926B1 |
Method and apparatus for implementing periphery devices on a programmable circuit using partial reconfiguration
A programmable circuit includes a physical interface at an input output (IO) periphery of the programmable circuit. The programmable circuit also includes a partial reconfigurable (PR) module, at the IO periphery of the programmable circuit, to implement a sequencer unit operable to configure the physical interface during a first instance of the PR module, and a controller unit operable to translate commands to the physical interface during a second instance of the PR module. |
| US08476923B2 |
Impedance control circuit and integrated circuit chip including the same
A circuit, including a first impedance unit having an impedance value based on a first impedance code and configured to drive a first node coupled with a resistor with a first voltage, a first code generation unit configured to generate the first impedance code so that an impedance value of the first impedance unit and an impedance value of the resistor are at a ratio of X:Y, dummy impedance units that receive the first impedance code and drive a second node with the first voltage, a second impedance unit having an impedance value based on a second impedance code and configured to drive the second node with a second voltage, and a second code generation unit configured to generate the second impedance code so that an overall impedance value of the dummy impedance units and an impedance value of the second impedance unit are at a ratio of X:Y. |
| US08476922B2 |
Balanced impedance method for differential signaling
A system and method for implementing a differential signaling driver with a common-mode voltage not equal to one half the power supply voltage using voltage-mode techniques. Embodiments of the present invention maintain balanced impedance at the signal output. In an embodiment, a driver may have multiple operating modes for each potential supply voltage or common-mode voltage. In an embodiment, each potential mode may involve configuring the driver by activating or deactivating switches or resistors in the driver and each potential mode may have different resistor values. |
| US08476906B2 |
Methods and apparatus for generating electronic records of locate operations
Methods and apparatus for detecting a presence or absence of an underground facility and generating electronic records of locate operations are described herein. An exemplary apparatus includes an actuator and at least one receiver antenna to detect a magnetic field from the underground facility. The apparatus further includes a processor coupled to a memory, which may at least be further coupled to the at least one receiver antenna. Upon execution of processor-executable instructions stored in the memory, the processor logs in the memory locate information relating at least in part to operation of the at least one receiver antenna. The processor logs the locate information in response to actuation of the actuator and/or at least one event based at least partially on a characteristic of the magnetic field detected by the at least one receiver antenna. |
| US08476900B2 |
Electromagnetic detection apparatus and methods
Systems and methods for detecting electromagnetic waves are disclosed. A system for detecting such waves includes a device having a first magnetic layer having a fixed magnetization direction, a second magnetic layer having an unfixed magnetization direction responsive to the electromagnetic wave, and a barrier layer positioned between the first and second magnetic layers. The device may have an impedance dependent on a relative angle between the fixed magnetization direction and the unfixed magnetization direction. The system further has a detector configured to detect a change in the impedance indicative of the electromagnetic wave. The electromagnetic wave may be detected by positioning the device in order to detect the electromagnetic wave, determining a change in the impedance of the device, and detecting the electromagnetic wave based on the change in the impedance of the device. Characteristics of the wave such as frequency, power, and phase may also be detected. |
| US08476899B2 |
Magnetic sensor and magnetic balance type current sensor including the same
A magnetic sensor includes a magnetoresistance effect element and a hard bias layer. The magnetoresistance effect element is configured to have a striped form which has a sensitivity axis in a predetermined direction, and configured to have a structure in which a free magnetic layer, in which magnetization varies with respect to an external magnetic field, a non-magnetic layer, and a fixed magnetic layer, in which the magnetization is fixed, are laminated. The hard bias layer is disposed in a longitudinal direction of the striped form, disposed outside of the magnetoresistance effect element to be separated from the magnetoresistance effect element. |
| US08476897B2 |
Method and system for locating a person and medium comprising instructions for performing the method
A method for localizing a person in surroundings equipped with fixed electrical appliances includes measuring an electromagnetic field radiated by one or more of these fixed electrical appliances with a magnetometer carried by the person, identifying a fixed appliance operating near the magnetometer by comparing the measured field with pre-recorded magnetic signatures. Each pre-recorded magnetic signature is associated with an electrical appliance present in the surroundings. The person is then localized at least in part based on pre-recorded items of information that correspond to localization, in the surroundings, of the fixed electrical appliance as identified by its magnetic signature. |
| US08476896B2 |
Method and sensor arrangement for determining the position and/or change of position of a measured object relative to a sensor
A method for determining the position and/or change of position of a measured object relative to a sensor, where the sensor preferably has a sensor coil to which an alternating current is applied, is characterized in that a magnet associated with the measured object, in a soft magnetic foil, whose permeability changes under the influence of a magnetic field on the basis of the magnetic field's field strength and which is arranged in the area of influence of the sensor, brings about a change in the permeability of the foil and in that the change in the permeability of the foil is determined from the latter's reaction to the sensor, and this is used to determine the position and/or change of position of the measured object relative to the sensor. A sensor arrangement is designed accordingly. |
| US08476894B2 |
Monitoring circuit, method for outputting monitor signal, and optical receiver
A monitoring circuit of the present invention provides a monitor signal with which a magnitude of a current flowing across a photodetector, such as a photodiode, can be calculated accurately over a wide temperature range on the basis of a value of the monitor signal. The monitoring circuit of the present invention includes: a current mirror circuit for outputting a monitor current proportional to an input current, the current mirror circuit having an input point for receiving the input current, the input point being connected to a photodetector and a load resistor, which are connected thereto in parallel; and an output circuit for outputting a monitor signal indicating a difference between a monitor electric potential proportional to the monitor current, and an offset electric potential proportional to an offset current which flows across the load resistor concurrently with the monitor current. |
| US08476888B1 |
Switching regulator providing current regulation based on using switching transistor current to control on time
An apparatus includes a sense element that generates a sense signal based on an output signal generated by a regulator. The apparatus also includes a current control unit that generates a compensated reference signal using the sense signal. The compensated reference signal is associated with an average of the output signal. The apparatus further includes a comparator that compares the compensated reference signal and the sense signal. In addition, the apparatus includes a hysteretic control unit that adjusts a control signal based on an output of the comparator and that provides the control signal to the regulator in order to adjust the output signal generated by the regulator. The hysteretic control unit could dynamically adjust peak and valley currents through an inductor in the regulator to maintain the average of the output signal at a substantially constant value. |
| US08476886B1 |
Differential hysteretic DC-DC converter
A hysteretic DC-DC converter includes a reference circuit, a hysteretic comparator, and a control circuit. The hysteretic comparator may be configured to compare a monitored output of the converter to a reference signal generated by the reference circuit and to compare a load ground of the output of the converter to a reference signal ground of the reference signal. The hysteretic comparator may perform the aforementioned comparisons simultaneously. The hysteretic comparator may generate a comparator output based on the comparison of the output of the converter to the reference signal and the comparison of the load ground to the reference signal ground. The control circuit may vary a control output to increase or decrease the output of the converter based on the comparator output. |
| US08476883B2 |
Compensation circuits and control methods of switched mode power supply
A compensation circuit has a resistor, a switch and a compensation capacitor. The resistor and the switch are connected in series between a power node and a compensation node. The compensation capacitor is connected to the compensation node, whose voltage is responsive to the output power source. For a predetermined period of time after the voltage falls below a predetermined value, the switch is open and no current flows through the resistor from the power node to the compensation node. |
| US08476882B2 |
Reference voltage based equivalent series resistance (ESR) emulation for constant on-time (COT) control of buck regulators
The present invention uses a reference voltage that varies within a Pulse Width Modulation (PWM) cycle to generate the PWM signal. This allows for stability in the feedback of Constant On-Time (COT) control for buck controllers when low Equivalent Series Resistance (ESR) capacitors are used as the output capacitor. The reference voltage is adjusted using features of a PWM cycle in a voltage mode without using external inductor current information. |
| US08476879B2 |
Saving energy mode (SEM) for an interleaved power factor correction (PFC) converter
A method of controlling a power factor correction (PFC) converter having a first PFC sub-circuit and a second PFC sub-circuit determines when to transition the PFC converter between an interleaved mode and a saving energy mode (SEM). The method includes generating an amplified error signal based on a monitored output voltage of the PFC converter. The second PFC sub-circuit is disabled in response to the amplified error signal being less than a first threshold value and enabled in response to the amplified error signal exceeding a second threshold value. |
| US08476878B2 |
Startup circuit for DC-DC converter
A startup circuit for use in a DC-DC converter having an input voltage terminal and an output voltage terminal, with the output voltage terminal connected to an output capacitor and with said converter including a pass transistor for transferring charge from the input terminal to the output terminal. The startup circuit includes a control circuit configured to cause the pass transistor to conduct an output current during start up when the output terminal voltage is approaching a final regulated voltage, with the output current being comprised of first and second current components, with the first current component being proportional to the output voltage and the second current component being proportional to the input voltage, with the two components being combined so as to resist changes in the power dissipation in the pass transistor during startup. |
| US08476876B2 |
Voltage-modulated circuit device to form electric power with stepped-down voltage
A voltage-modulated circuit device uses a power source of a modulation circuit to acquire a predetermined trigger voltage through a voltage acquisition circuit and a step-down circuit to step down a voltage, and then a voltage amplification circuit amplifies the voltage by several times, such that the trigger voltage amplified by several times still falling within the range of predetermined voltage values triggers and conducts a switch circuit, and the power source of the modulation circuit can flow from an anode to a cathode in order to supply an electric power with a step-down voltage. With the design of triggering the conduction, the voltage of the modulation circuit can be modulated automatically to maintain the electric power supplied to the circuit device within the range of required voltage values, only if the trigger voltage has the predetermined voltage value. |
| US08476872B2 |
Systems and methods of reducing a load on an engine
A system for reducing an alternator's load on an engine when the engine drives a second load. The system includes an alternator, a battery, a resistor, and a switch. The alternator includes a stator, a voltage regulator, a rectifier, and a field coil. The battery has a first terminal coupled to the alternator and a second terminal coupled to the alternator. The resistor has a first lead coupled to the first terminal and a second lead coupled to the field coil. The switch is coupled in parallel across the resistor, and is open when the engine drives the second load and closed when the engine is not driving the second load. |
| US08476871B2 |
Method and system for controlling a doubly-fed induction machine
The present invention relates to a method and system for controlling a doubly-fed induction machine. In operation a rotor current vector is processed with a rotor position estimate vector. A scalar error quantity is the determined in dependence upon a stator current vector and the processed rotor current vector. The scalar error quantity is integrated and an estimate of the rotor angular frequency is determined in dependence upon the integrated scalar error quantity. To obtain a rotor position estimate, the estimate of the rotor angular frequency is integrated and a rotor position estimate vector is determined in dependence upon the rotor position estimate. The rotor position estimate vector is then provided for processing the rotor current vector. As output signals a signal indicative of the rotor position estimate vector and a signal indicative of the estimate of the rotor angular frequency are provided for controlling the doubly-fed induction machine. |
| US08476867B2 |
Robot battery charging station
A battery charging station, for a robot, includes a base, two side-walls barriers, a stop, a supporting arm, a charging connector, and a transmitter. The side-walls barriers are separately mounted on the base. The stop is mounted on the back of the base to form a docking space together with the barriers and the base. The supporting arm is mounted on the stop by one free end thereof with the other end extending into the space over the docking space. The charging connector is mounted on the free end of the supporting arm and is configured for providing an electrical connection between the robot and a power source. The transmitter is positioned on the upper surface of the supporting arm and is configured for emitting signals for the robot to locate the re battery charging station. |
| US08476858B2 |
Refrigerator and method for controlling same
A refrigerator and a method for controlling the same are provided. In this refrigerator and control method, a receiving box may be automatically drawn in and out together with a door based on a movement command received at an input unit, thus enhancing user convenience and satisfaction. |
| US08476855B2 |
Electric drive and method for controlling it
An electric drive (1) comprises: a permanent magnet brushless motor (2), a motor (2) power supply bridge (3), a circuit for controlling the power supply bridge (3) according to rotor position and phase currents (IS); the drive (1) comprises a circuit (6) for detecting the zero crossings of the induced counter electromotive force (ES) in the stator windings to determine the position of the rotor and a circuit (25) for indirectly detecting the amplitudes of the phase currents (IS). |
| US08476854B2 |
Power supply device
A power supply device for a variable rotation speed drive includes a free-running converter connected to a land-based power grid, and an inverter connected to the variable rotation speed drive. A direct-current cable electrically connects the DC side of the converter with the DC side of the inverter. The inverter includes a plurality of phase modules having an upper and a lower valve branches with least two series-connected, two-pole subsystems with distributed energy storage devices. The inverter is located on the seabed in immediate vicinity of the variable rotation speed drive. Signal electronics of the inverter is located on land. In this way, the distance between the power supply on land and the drive on the ocean floor can reach several hundred kilometers, with ocean depths of several kilometers. |
| US08476853B2 |
Redundant overspeed protection for power tools
An overspeed protection subsystem is provided for a power tool having an electric motor. The overspeed protection subsystem is comprised of: a motor switch coupled in series with the motor; a motor control module interfaced with the motor switch to control switching operation of the motor switch; and an overspeed detection module that determines rotational speed of the motor and disables the power tool when the rotational speed of the motor exceeds a threshold. |
| US08476847B2 |
Thermal foldback system
A thermal-foldback system detects an over-temperature condition in an LED lamp. In response to the over-temperature condition, the thermal-foldback system chops a portion of the input power waveform drawn by the LED lamp. |
| US08476843B2 |
Driving circuit for single-string LED lamp
A driving circuit for a single-string light-emitting diode (LED) lamp includes a push-pull converter. The push-pull converter converts an input low DC voltage (such as 12-19V) to a high DC voltage (such as above 200V) to supply power to the single-string LED lamp. The driving circuit controls a lamp current flowing through the single-string LED lamp by constant current and adjusts brightness of the single-string LED lamp by pulse-width modulation (PWM) dimming. In addition, the single-string LED lamp provides the standardization design for connectors of the driving circuit used to connect to the single-string LED lamp so that the driving circuit has a better common-use characteristic. Moreover, the driving circuit does not need a current balance circuit and only needs a cheaper and general-purpose integrated circuit to control the push-pull converter to reduce design cost of the driving circuit. |
| US08476836B2 |
AC driven solid state lighting apparatus with LED string including switched segments
A diode selection circuit for a light emitting apparatus according to some embodiments includes a plurality of light emitting devices coupled in series. The diode selection circuit includes a comparator configured to receive a rectified AC input signal and a reference voltage and to generate a control signal in response to comparison of the rectified AC input signal with the reference voltage, a voltage controlled current source configured to supply a current to the plurality of light emitting diodes that is proportional to the rectified AC input signal, and a switch configured to receive the control signal and to shunt current away from at least one of the plurality of light emitting devices in response to the control signal. |
| US08476834B2 |
Automatic lighting control system
The present invention relates to an automatic lighting control system, and more particularly, to an automatic lighting control system which is capable of predicting a movement route of a resident in a complex building and automatically controlling lighting located in the movement route. According to the present invention, it is possible to reduce power consumption by simplifying configuration of lamps and controlling luminance of lamps on a resident or vehicle movement route by predicting motion of the resident or the vehicle through centralized control for a plurality of lamps, and to provide increased movement convenience and emotional satisfaction of a resident by showing the resident a movement route through lamps and securing a field of view on the movement route. |
| US08476831B2 |
Dielectric-loaded field applicator for EHID lamps and EHID lamp assembly containing same
A dielectric-loaded field applicator and an EHID lamp assembly are provided wherein the applicator comprises a helical resonator having a cylindrical dielectric core and a helical conductor, the dielectric core having a helical groove extending along its surface substantially from end to end; the helical conductor being contained in the helical groove and connectable at one end to a power source, the dielectric core being comprised of a dielectric material having a relative permittivity greater than about 3, preferably polycrystalline alumina. The EHID lamp assembly includes two opposed dielectric-loaded applicators with a discharge vessel supported between them. |
| US08476826B2 |
Manufacturing method of display device and display device
A manufacturing method of a display device, includes: a first step of collectively transferring light-emitting elements arranged at every specified number of light-emitting elements formed and arranged on a first substrate to a transfer area set on a second substrate; and a second step of transferring light-emitting elements remaining on the first substrate to between the plural light-emitting elements mounted on the second substrate in at least one of a state where the first substrate is moved with respect to the transfer area on the second substrate and a state where the first substrate is rotated in a plane. |
| US08476825B2 |
Organic electroluminescent light source device
An organic electroluminescent light source device including a first transparent electrode layer, a light-emitting layer, a second transparent electrode layer, and a reflective layer having a reflective surface, in this order from a light-emitting surface side, and further including a structural layer X that is provided between the second transparent electrode layer and the reflective surface and is in contact with the reflective surface, wherein the reflective surface has a concavo-convex structure, the concavo-convex structure has a plurality of concavo-convex structure units formed of depressions or protrusions, and a refractive index n of the structural layer X, an inclination angle θ×1 (°) of the concavo-convex structure units, and a mean inclination angle θ×2 (°) of the concavo-convex structure at the reflective surface satisfy θ×1≦sin−1(1/n) and {90−sin−1(1/n) }/3≦θ×2≦sin−1(1/n). |
| US08476819B2 |
Triode-structured field emission display with anode and gate on the same substrate
The present invention relates to a triode field emission display with anode and gate on the same substrate, comprising anode-gate substrate and cathode substrate, parallel and adapted in the size; a number of strip-like cathode conducting layers arranged alternating on the cathode substrate; resistor layer for current limiting and dielectric layer for cathode protection are arranged alternately on the cathode conducting layer in the longitudinal direction; the electron emission materials are arranged on the resistor layer for current limiting; wherein the strip-like anode conducting layer and strip-like gate conducting layer on the anode-gate substrate are perpendicular to the strip-like cathode conducting layer on the cathode substrate, dielectric layer for isolation is arranged between the anode-gate and the cathode substrates, one end of the dielectric layer for isolation is connected to the dielectric layer for gate protection, the other end is connected to the dielectric layer for cathode protection. |
| US08476818B2 |
Electron emitting element including a fine particle layer containing insulating particles, and devices and methods related thereto
An electron emitting element of the present invention includes an electron acceleration layer sandwiched between an electrode substrate and a thin-film electrode, and the electron acceleration layer includes a fine particle layer containing insulating fine particles and a basic dispersant. This makes it possible to provide an electron emitting element which does not cause insulation breakdown in an insulating layer and which can be produced at a low cost. |
| US08476815B2 |
Spark plug and manufacturing method thereof
A ground electrode and a metal shell are joined by welding or the like while an entire end face of a base of the ground electrode is brought into contact with a front end constituent face of the metal shell. The ground electrode has an extending portion extending forward in an axial (O) direction of the ground electrode. A front end portion faces a noble metal tip joined to a front end portion of the center electrode through a bending portion and forms a spark discharge gap (G) therebetween. A gap (a clearance) having a sufficient space to accommodate a virtual sphere (Q) with a radius of 1.2 mm is provided so that the virtual sphere (Q) being in contact with an inner face of the bending portion of the ground electrode is neither in contact with a center electrode nor an insulator. |
| US08476814B2 |
Lamp device
A light utilization efficiency of a high-pressure discharge lamp is improved even in a case of reducing the size of a reflection mirror without using an auxiliary reflection mirror. In a lamp device where a portion of lights emitted from a discharge bulb to the periphery thereof in forward and backward directions for a predetermined range of angle is reflected at a concave reflection mirror and illuminated to a light collection area of a predetermined size formed forward of the lamp, a prism surface having an angle of refracting or deflecting at least a portion of lights emitted from the discharge bulb that is not reflected at the concave reflection mirror to the light collection area is formed to the outer peripheral surface of the discharge bulb. |
| US08476813B2 |
Lamp device
A lamp device includes a heat sink, substrate, and fixing surface. The heat sink has a body with an opening, a plurality of fins for dissipating heat, and a plate coupled to the fins. The substrate is located under the fins and is coupled to a plurality of light emitting diodes. The fixing surface is coupled to the heat sink and also has an opening. Light from the light emitting diodes is emitted to the opening of the fixing surface, and a same axis passes through the openings of the body and fixing surface. |
| US08476812B2 |
Solid state lighting device with improved heatsink
A solid state lighting device includes at least one emitter and a forged heatsink arranged to receive and dissipate heat generated by emitter(s). The heatsink may have a thickness and/or profile that varies in at least two dimensions. Fabrication of a solid state lighting device may include providing a forged heatsink, and mounting at least one solid state emitter in thermal communication with the heatsink. A space or object may be illuminated with a lighting device including at least one solid state emitter and a forged heatsink. The lighting device may be operated responsive to at least one sensor arranged to sense temperature and/or at least one characteristic of light emitted by the emitter(s). |
| US08476810B2 |
Piezoelectric device and piezoelectric device manufacturing method
A piezoelectric device includes: a first substrate; a second substrate disposed opposed to the first substrate; a third substrate disposed between the first substrate and the second substrate, a part of the third substrate forming a piezoelectric oscillating piece, and another part of the third substrate forming a frame which surrounds the piezoelectric oscillating piece; a first metal film which joins the first substrate and the frame; a second metal film which joins the second substrate and the frame; and a resin portion provided at least at any one of positions between the first substrate and the first metal film, between the frame and the first metal film, between the second substrate and the second metal film, and between the frame and the second metal film. |
| US08476809B2 |
Microelectromechanical systems (MEMS) resonators and related apparatus and methods
Devices having piezoelectric material structures integrated with substrates are described. Fabrication techniques for forming such devices are also described. The fabrication may include bonding a piezoelectric material wafer to a substrate of a differing material. A structure, such as a resonator, may then be formed from the piezoelectric material wafer. |
| US08476808B2 |
1-d tire apparatus
Disclosed is a tire mountable apparatus and methodology for mounting devices within a tire. In certain embodiments a signal generator may be mounted to the tire to generate signals based on changes in the radius of curvature of a tire. A piezoelectric sandwich and/or a substrate is/are provided having a length and width based at least in part on tire dimensions and positioned in the tire such that the longer length dimension is positioned laterally with respect to the width of the tire. The sandwich and/or substrate is/are sized such that the width dimension provides substantially no response to changes in the circumferential radius of curvature of the tire so that the length dimension defines the primary bending direction while the width dimension provides a strain free mount for associated devices. |
| US08476805B2 |
Piezoelectric/electrostrictive element having a specific coverage area of electrode on substrate, and manufacturing method of the same
There is disclosed a piezoelectric/electrostrictive element which can be used as a sensor, even if a piezoelectric/electrostrictive layer cracks. Provided is a piezoelectric/electrostrictive element comprising a substrate, a lower electrode layer secured onto the substrate, and a piezoelectric/electrostrictive layer secured onto the lower electrode layer, and the coverage of the lower electrode layer with respect to the substrate is 98% or less. |
| US08476802B2 |
Core and motor having the same
Disclosed is a core including a plurality of core layers in a laminated structure formed through one-directional press shearing and having an insulating layer formed on the surface thereof prevented from being damaged by burrs formed through the press shearing when a winding coil is wound on and around the core, and a motor having the core. The core for a motor includes: a plurality of core plates having a laminated structure formed through one-directional press shearing; and a chamfered portion formed on at least some of the corners of a face opposed to one face of the core plate to which force is applied by the press shearing. |
| US08476800B2 |
Three-phase motor with overlapping coils and fan
A three-phase motor includes a bearing structure, a rotor structure and a stator structure. The bearing structure has a bushing. The rotor structure has a shaft disposed in the bushing. The stator structure is disposed corresponding to the rotor structure and includes a first coil assembly and a second coil assembly overlapped on the first coil assembly. A fan with the motor is also disclosed. The present invention can increase the ratio of the effective coils of the stator structure, and further promote the operation efficiency of the three-phase motor and the fan with the three-phase motor. |
| US08476797B2 |
Magnetic bearing device for supporting roll shaft
A magnetic bearing device includes a magnet generating a magnetic field at a protrusion formed toward a roll shaft, and a body portion supporting the magnet in one direction. The roll shaft is supported while an air gap is formed between the roll shaft and the protrusion, and both sides of the protrusion are rounded. |
| US08476795B2 |
Electric water pump
In a circuit substrate of an electric water pump, a Hall IC can be mounted on a circuit substrate at an optimum position in a stable and durable state. The electric water pump includes a motor housing, a stator constituted by a stator core covered by a resin insulator and a coil, a circuit substrate, a holder 6 mounted on the circuit substrate, and a Hall IC mounted on the holder. A holder accommodation portion, into which the holder is inserted, is formed in the insulator, the stator is disposed in and fixed to the motor housing, the circuit substrate is appropriately mounted on the motor housing, and the holder 6 is inserted into and supported by the holder accommodation portion. |
| US08476794B2 |
Wheel motor with rotating outer rotor
An in-wheel motor having an inner stationary portion (the stator), and an outer rotating portion (the rotor) that rotates around the stator and drives a wheel directly attached to the rotor. The stator may comprise an inner support structure around which a plurality of magnets having windings are disposed in a circumferential fashion. The rotor circumferentially surrounds the stator, and includes permanent magnets placed at an interval along a surface of the rotor. An intermediate layer between the rotor and the stator is comprised of a bearing that allows movement of the rotor relative to the stator. By attaching a wheel directly to the outer surface of the rotor, a compact and efficient wheel-mounted electrical motor may be provided. |
| US08476793B2 |
Stiffener tab for a spindle motor base plate
An apparatus and method are provided for stiffening a base plate of a spindle motor to improve shock resistance and vibration response, and thereby increase reliability and performance of a disc drive memory system. A stiffener tab for stiffening a base plate is connected to the base plate, extends from the base plate, and is dimensioned to fit adjacent to a stator tooth. Stiffening of a base plate is especially useful in the case of stamped base plate designs that typically have uniform thickness, whereas cast base plate designs are formed with thicker sections. In an aspect, the present invention stiffens a motor cup portion of the base plate, and replaces stiffness lost by removal of material from the base plate to form holes for recessing a stator into the base plate. Axial and angular displacement of a spindle motor during shock events and vibration are decreased. |
| US08476792B2 |
Voice coil motor employing elastic electrode member having two elastic sheets separated from each other
A voice coil motor includes a lens retainer, a wire, and an elastic electrode member. The lens retainer includes an end portion. The wire wraps around the lens retainer and includes a first end and a second end. The elastic electrode member is metal and is mounted to the end portion. The elastic member includes a first elastic metal sheet and a second elastic metal sheet. The first elastic metal sheet includes a first electrode. The second elastic plate is physically separated from the first elastic sheet and includes a second electrode. The first end and the second end are respectively soldered to the first electrode and the second electrode. |
| US08476791B2 |
Apparatus and method for reducing power consumption of electronic product
Provided is an apparatus and method for reducing power consumption of an electronic product. The apparatus and method reduces unnecessary power consumption by cutting off power for driving a load if a predetermined control condition is satisfied in an electronic product operating for a long time. In the electronic product operating for a long time, power for driving the load is cut off to prevent waste of the power if the predetermined control condition is satisfied, and the load is driven only when the predetermined control condition is not satisfied, thereby efficiently reducing the power consumption of the electronic product. |
| US08476788B2 |
Wireless energy transfer with high-Q resonators using field shaping to improve K
In embodiments of the present invention improved capabilities are described for a method and system comprising a source resonator optionally coupled to an energy source and a second resonator located a distance from the source resonator, where the source resonator has Q>100 and the second resonator has Q>100, the source resonator and the second resonator are coupled to provide near-field wireless energy transfer among the source resonator and the second resonator, and the field of at least one of the source resonator and the second resonator is shaped using magnetic materials to increase the coupling factor among the resonators. |
| US08476784B2 |
Wind turbine generating apparatus
In a wind turbine generating apparatus, a heat generating device is provided inside the rotor head and has a hermetically-sealed structure from outside. A rotor head cooling air passage is formed through the periphery of the heat generating device to the inside of a wind turbine blade. A cooling air introduction portion through which cooling air flows and an air outlet from which the cooling air is discharged are provided in the rotor head cooling air passage to thereby form the air outlet in the wind turbine blade. |
| US08476783B2 |
Wind energy generator using piezoelectric material and auxiliary mechanism thereof
A wind energy generator using a piezoelectric material and an auxiliary mechanism thereof are disclosed. The wind energy generator comprises the auxiliary mechanism and the piezoelectric material. The auxiliary mechanism comprises a wind collecting device and a wind driving device. The wind collecting device is used for collecting a wind and increasing the wind speed. The wind driving device cooperates with the wind collecting device to receive the wind. The piezoelectric material contacts with the wind driving device. When the wind collecting device receives the wind, the piezoelectric material is vibrated by the wind via the wind driving device to generate an electric power. |
| US08476778B2 |
Energy generator
Inertia driven energy harvesters including a movable arm, suspension system, gearing system, generator and energy distribution system. The energy harvesters enable the efficient capture and conversion of kinetic energy to electrical energy. |
| US08476774B2 |
Off-chip VIAS in stacked chips
A microelectronic assembly includes first and second stacked microelectronic elements, each having spaced apart traces extending along a front face and beyond at least a first edge thereof. An insulating region can contact the edges of each microelectronic element and at least portions of the traces of each microelectronic element extending beyond the respective first edges. The insulating region can define first and second side surfaces adjacent the first and second edges of the microelectronic elements. A plurality of spaced apart openings can extend along a side surface of the microelectronic assembly. Electrical conductors connected with respective traces can have portions disposed in respective openings and extending along the respective openings. The electrical conductors may extend to pads or solder balls overlying a face of one of the microelectronic elements. |
| US08476769B2 |
Through-silicon vias and methods for forming the same
An integrated circuit structure and methods for forming the same are provided. The integrated circuit structure includes a substrate; a through-silicon via (TSV) extending into the substrate; a TSV pad spaced apart from the TSV; and a metal line over, and electrically connecting, the TSV and the TSV pad. |
| US08476766B2 |
Semiconductor memory device and method for manufacturing the same
According to one embodiment, a semiconductor memory device includes a multilayer body, a second electrode film provided on the multilayer body, a second insulating film provided on the second electrode film, a semiconductor film, a memory film and a gate insulating film. At boundary between the inner surface of the second through hole and the inner surface of the third through hole, or on the inner surface of the second through hole, a step difference is formed so that an upper side from the step difference is thicker than a lower side from the step difference. |
| US08476765B2 |
Copper interconnect structure having a graphene cap
A copper interconnect structure has an intrinsic graphene cap for improving back end of line (BEOL) reliability of the interconnect by reducing time-dependent dielectric breakdown (TDDB) failure and providing resistance to electromigration. Carbon atoms are selectively deposited onto a copper layer of the interconnect structure by a deposition process to form a graphene cap. The graphene cap increases the activation energy of the copper, thus allowing for higher current density and improved resistance to electromigration of the copper. By depositing the graphene cap on the copper, the dielectric regions remain free of conductors and, thus, current leakage within the interlayer dielectric regions is reduced, thereby reducing TDDB failure and increasing the lifespan of the interconnect structure. The reduction of TDDB failure and improved resistance to electromigration improves BEOL reliability of the copper interconnect structure. |
| US08476763B2 |
Semiconductor device conductive pattern structures including dummy conductive patterns
Methods of forming conductive pattern structures form an insulating interlayer on a substrate that is partially etched to form a first trench extending to both end portions of a cell block. The insulating interlayer is also partially etched to form a second trench adjacent to the first trench, and a third trench extending to the both end portions of the cell block. The second trench has a disconnected shape at a middle portion of the cell block. A seed copper layer is formed on the insulating interlayer. Inner portions of the first, second and third trenches are electroplated with a copper layer. The copper layer is polished to expose the insulating interlayer to form first and second conductive patterns in the first and second trenches, respectively, and a first dummy conductive pattern in the third trench. Related conductive pattern structures are also described. |
| US08476762B2 |
Ni plating of a BLM edge for Pb-free C4 undercut control
A structure and a method of manufacturing a Pb-free Controlled Collapse Chip Connection (C4) with a Ball Limiting Metallurgy (BLM) structure for semiconductor chip packaging that reduce chip-level cracking during the Back End of Line (BEOL) processes of chip-join cool-down. An edge of the BLM structure that is subject to tensile stress during chip-join cool down is protected from undercut of a metal seed layer, caused by wet etch of the chip to remove metal layers from the chip's surface and solder reflow, by an electroplated barrier layer, which covers a corresponding edge of the metal seed layer. |
| US08476761B2 |
Semiconductor device and method of confining conductive bump material during reflow with solder mask patch
A semiconductor device has a semiconductor die with die bump pads and substrate with trace lines having integrated bump pads. A solder mask patch is formed interstitially between the die bump pads or integrated bump pads. The solder mask patch contains non-wettable material. Conductive bump material is deposited over the integrated bump pads or die bump pads. The semiconductor die is mounted over the substrate so that the conductive bump material is disposed between the die bump pads and integrated bump pads. The bump material is reflowed without a solder mask around the integrated bump pads to form an interconnect between the semiconductor die and substrate. The solder mask patch confines the conductive bump material within a footprint of the die bump pads or integrated bump pads during reflow. The interconnect can have a non-fusible base and fusible cap. |
| US08476753B2 |
Process for enhanced 3D integration and structures generated using the same
An enhanced 3D integration structure comprises a logic microprocessor chip bonded to a collection of vertically stacked memory slices and an optional set of outer vertical slices comprising optoelectronic devices. Such a device enables both high memory content in close proximity to the logic circuits and a high bandwidth for logic to memory communication. Additionally, the provision of optoelectronic devices in the outer slices of the vertical slice stack enables high bandwidth direct communication between logic processor chips on adjacent enhanced 3D modules mounted next to each other or on adjacent packaging substrates. A method to fabricate such structures comprises using a template assembly which enables wafer format processing of vertical slice stacks. |
| US08476752B2 |
Package structure for DC-DC converter
A package structure for DC-DC converter disclosed herein can reduce the number of encapsulated elements as a low-side MOSFET chip can be stacked above the high-side MOSFET chip of a first die pad, through die pads of different thicknesses or interposers with joint parts of different thicknesses; moreover, it further reduces the size of the entire semiconductor package as a number of bond wires are contained in the space between the controller and the low-side MOSFET chip. Moreover, electrical connection between the top source electrode pin and the bottom source electrode pin of the low-side MOSFET chip is realized with a metal joint plate, such that when the DC-DC converter is sealed with plastic, the metal joint plate can be exposed outside to improve the thermal performance and effectively reduce the thickness of the semiconductor package. |
| US08476748B1 |
Exposed die overmolded flip chip package and fabrication method
An exposed die overmolded flip chip package includes a substrate. A die is flip chip mounted to an upper surface of the substrate. The package further includes a mold cap filling a space between an active surface of the die and the upper surface of the substrate. The mold cap includes a principal surface, sidewalls extending from the upper surface of the substrate to the principal surface, an annular surface coplanar with the inactive surface of the die and extending outward from a peripheral edge of the inactive surface of the die, and protruding surfaces extending between the principal surface and the annular surface. The mold cap does not cover the inactive surface of the die such that heat transfer from the die to the ambient environment is maximized and the package thickness is minimized. |
| US08476743B2 |
C-rich carbon boron nitride dielectric films for use in electronic devices
A carbon-rich carbon boron nitride dielectric film having a dielectric constant of equal to, or less than 3.6 is provided that can be used as a component in various electronic devices. The carbon-rich carbon boron nitride dielectric film has a formula of CxByNz wherein x is 35 atomic percent or greater, y is from 6 atomic percent to 32 atomic percent and z is from 8 atomic percent to 33 atomic percent. |
| US08476738B2 |
Electronic package with stacked semiconductor chips
An electronic component package is described. The electronic component package includes a first electronic component package module mounted on a surface of a packaging layer. A second electronic component package module laminated on a bottom of the first electronic component package module is mounted on a surface of a packaging layer. The first and second electronic component package modules respectively include at least two semiconductor chips laminated. A first redistribution layer is between the first and the second electronic component package modules, electrically connected to the first and the second electronic component package modules. A conductive bump is mounted on a bottom of the second electronic component package module, electrically connected to the second electronic component package module. |
| US08476737B2 |
Environment-resistant module, micropackage and methods of manufacturing same
An environment-resistant module which provides both thermal and vibration isolation for a packaged micromachined or MEMS device is disclosed. A microplatform and a support structure for the microplatform provide the thermal and vibration isolation. The package is both hermetic and vacuum compatible and provides vertical feedthroughs for signal transfer. A micromachined or MEMS device transfer method is also disclosed that can handle a wide variety of individual micromachined or MEMS dies or wafers, in either a hybrid or integrated fashion. The module simultaneously provides both thermal and vibration isolation for the MEMS device using the microplatform and the support structure which may be fabricated from a thin glass wafer that is patterned to create crab-leg shaped suspension tethers or beams. |
| US08476734B2 |
Semiconductor component and methods for producing a semiconductor component
A semiconductor component includes a semiconductor body, in which are formed: a substrate of a first conduction type, a buried semiconductor layer of a second conduction type arranged on the substrate, and a functional unit semiconductor layer of a third conduction type arranged on the buried semiconductor layer, in which at least two semiconductor functional units arranged laterally alongside one another are provided. The buried semiconductor layer is part of at least one semiconductor functional unit, the semiconductor functional units being electrically insulated from one another by an isolation structure which permeates the functional unit semiconductor layer, the buried semiconductor layer, and the substrate. The isolation structure includes at least one trench and an electrically conductive contact to the substrate, the contact to the substrate being electrically insulated from the functional unit semiconductor layer and the buried layer by the at least one trench. |
| US08476717B2 |
Semiconductor transistors having reduced distances between gate electrode regions
A semiconductor structure. The semiconductor structure includes: a semiconductor substrate which includes a top substrate surface which defines a reference direction perpendicular to the top substrate surface and further includes a first semiconductor body region and a second semiconductor body region; a first gate dielectric region and a second gate dielectric region on top of the first and second semiconductor body regions, respectively; a first gate electrode region on top of the semiconductor substrate and the first gate dielectric region; a second gate electrode region on top of the semiconductor substrate and the second gate dielectric region; and a gate divider region in direct physical contact with the first and second gate electrode regions. The gate divider region does not overlap the first and second gate electrode regions in the reference direction. |
| US08476714B2 |
Semiconductor device
A semiconductor device includes a semiconductor substrate; an n-channel MOS transistor including a first gate insulating film provided on a p-type layer, a first gate electrode made of TiN, and a first upper gate electrode made of semiconductor doped with impurities; and a p-channel MOS transistor including a second gate insulating film provided on an n-type layer, a second gate electrode including at least as a part, a TiN layer made of TiN crystal in which a ratio of (111) orientation/(200) orientation is about 1.5 or more, and a second upper gate electrode made of semiconductor doped with impurities. |
| US08476712B2 |
Surge-current-resistant semiconductor diode with soft recovery behavior and methods for producing a semiconductor diode
A bipolar semiconductor component, in particular a diode, comprising an anode structure which controls its emitter efficiency in a manner dependent on the current density in such a way that the emitter efficiency is low at small current densities and sufficiently high at large current densities, and an optional cathode structure, which can inject additional holes during commutation, and production methods therefor. |
| US08476709B2 |
ESD protection device and method
An ESD protection device includes an MOS transistor with a source region, drain region and gate region. A node designated for ESD protection is electrically coupled to the drain. A diode is coupled between the gate and source, wherein the diode would be reverse biased if the MOS transistor were in the active operating region. |
| US08476708B2 |
Semiconductor memory device having a circuit formed on a single crystal semiconductor layer with varied germanium concentration
According to one embodiment, a semiconductor memory device includes a semiconductor substrate, memory cell array portion, single-crystal semiconductor layer, and circuit portion. The memory cell array portion is formed on the semiconductor substrate, and includes memory cells. The semiconductor layer is formed on the memory cell array portion, and connected to the semiconductor substrate by being formed in a hole extending through the memory cell array portion.The circuit portion is formed on the semiconductor layer. The Ge concentration in the lower portion of the semiconductor layer is higher than that in the upper portion of the semiconductor layer. |
| US08476705B2 |
High voltage semiconductor device
A semiconductor device for a high voltage application includes a doped source base region, an N+ source region, a P+ source region and a gate structure. The doped source base region has P-type. The N+ source region extends downwards into the doped source base region. The P+ source region is close to the N+ source region, extends downwards into the doped source base region, and is doped heavier than the doped source base region. The gate structure is coupled to the N+ source region and is near to the P+ source region. |
| US08476704B2 |
Circuit structure with vertical double gate
A circuit structure including a semiconductor substrate having a depression; a first insulating layer positioned on the surface of the depression; a bottom conductor positioned in a bottom portion of the depression, wherein the bottom conductor is connected to an external bias through a plurality of longer vertical contact plugs; an upper conductor positioned in an upper portion of the depression, wherein the upper conductor is connected to a plurality of shorter vertical contact plugs, and a top surface of the upper conductor is higher than a depression-bearing surface of the semiconductor substrate; and a second insulating layer positioned between the bottom conductor and the upper conductor. |
| US08476697B1 |
Short-channel silicon carbide power MOSFET
A silicon carbide power MOSFET having a drain region of a first conductivity type, a base region of a second conductivity type above the drain region, and a source region of the first conductivity type adjacent an upper surface of the base region, the base region including a channel extending from the source region through the base region adjacent a gate interface surface thereof, the channel having a length less than approximately 0.6 μm, and the base region having a doping concentration of the second conductivity type sufficiently high that the potential barrier at the source end of the channel is not lowered by the voltage applied to the drain. The MOSFET includes self-aligned base and source regions as well as self-aligned ohmic contacts to the base and source regions. |
| US08476695B2 |
Self aligned narrow storage elements for advanced memory device
A method of forming a sub-lithographic charge storage element on a semiconductor substrate is provided. The method can involve providing first and second layers on a semiconductor substrate, a thickness of the first layer being larger than a thickness of the second layer; forming a spacer adjacent a side surface of the first layer and on a portion of an upper surface of the second layer; and removing an exposed portion of the second layer that is not covered by the spacer. By removing the exposed portion of the second layer while leaving a portion of the second layer that is protected by the spacer, the method can make a sub-lithographic charge storage element from the remaining portion of the second layer on the semiconductor substrate. |
| US08476691B1 |
High reliability-high voltage junction termination with charge dissipation layer
A high voltage power semiconductor device includes high reliability-high voltage junction termination with a charge dissipation layer. An active device area is surrounded by a junction termination structure including one or more regions of a polarity opposite the substrate polarity. A tunneling oxide layer overlays the junction termination area surrounding the active device area in contact with the silicon substrate upper surface. A layer of undoped polysilicon overlays the tunneling oxide layer and spans the junction termination area, with connections to an outer edge of the junction termination structure and to a grounded electrode inside of the active area. The tunneling oxide layer has a thickness that permits hot carriers formed at substrate upper surface to pass through the tunneling oxide layer into the undoped polysilicon layer to be dissipated but sufficient to mitigate stacking faults at the silicon surface. |
| US08476690B2 |
Nonvolatile programmable logic switches and semiconductor integrated circuit
A nonvolatile programmable logic switch according to an embodiment includes: a first semiconductor region of a first conductivity type and a second semiconductor region of a second conductivity type; a memory cell transistor including a first insulating film formed on the first semiconductor region, a charge storage film formed on the first insulating film, a second insulating film formed on the charge storage film, and a control gate formed on the second insulating film; a pass transistor including a third insulating film formed on the second semiconductor region, and a gate electrode formed on the third insulating film and electrically connected to the first drain region; a first electrode applying a substrate bias to the first semiconductor region, the first electrode being formed in the first semiconductor region; and a second electrode applying a substrate bias to the second semiconductor region, the second electrode being formed in the second semiconductor region. |
| US08476682B2 |
Image sensor
An example embodiment of the image sensor includes a light-sensing device including a first electrode, a second electrode disposed opposite to the first electrode, and a photoelectric conversion layer positioned between the first electrode and the second electrode. The photoelectric conversion layer includes a block copolymer including electron donating blocks and electron accepting blocks. The electron donating blocks are deposited together and connected to the first electrode and the second electrode. The electron accepting blocks are deposited together and connected to the first electrode and the second electrode. A color filter may be positioned on the second electrode of the light-sensing device. |
| US08476671B2 |
Light emitting device, light emitting device package, and lighting device
A light emitting device includes a support member, a light emitting structure on the support member, the light emitting structure including a first conductive type semiconductor layer, a second conductive type semiconductor layer, and an active layer between the second conductive type semiconductor layer and the first conductive type semiconductor layer, a first nitride semiconductor layer disposed on the second conductive type semiconductor layer, a second nitride semiconductor layer disposed on the first nitride semiconductor layer and including an uneven structure, and a first electrode pad disposed on the light emitting structure wherein the second nitride semiconductor layer has an opening, the first electrode pad is in contact with the first nitride semiconductor layer through the opening, and the first nitride semiconductor layer has a work function smaller than that of the second nitride semiconductor layer. |
| US08476668B2 |
High voltage low current surface emitting LED
An LED chip comprising a plurality of sub-LEDs on a submount. Electrically conductive and electrically insulating features are included that serially interconnect the sub-LEDs such that an electrical signal applied to the serially interconnected sub-LEDs along the electrically conductive features spreads to the serially interconnected sub-LEDs. A via is included that is arranged to electrically couple one of the sub-LEDs to the submount. The sub-LEDs can be interconnected by more than one of the conductive features, with each one of the conductive features capable of spreading an electrical signal between two of the sub-LEDs. |
| US08476666B2 |
Light emitting elements, light emitting devices including light emitting elements and methods of manufacturing such light emitting elements and/or devices
An emitting device including a first electrode, a second electrode spaced apart from the first electrode, an emitting pattern including a portion between the first electrode and the second electrode, and a block pattern including a portion between the emitting pattern and the first electrode and/or on a same level as the first electrode. |
| US08476664B2 |
Light emitting diode package having multiple luminescent conversion layers
A light emitting diode package comprises a light emitting diode chip, a first luminescent conversion layer and a separate second luminescent conversion layer on the first luminescent conversion layer. The first luminescent conversion layer has a first luminescent conversion element surrounding the light emitting diode chip. The second luminescent conversion layer has a second luminescent conversion element located above the light emitting diode chip. An excitation efficiency of the first luminescent conversion element is higher than that of the second luminescent conversion element. |
| US08476662B2 |
Light emitting device, method for manufacturing the same, and backlight unit
Disclosed are a light emitting device, a method of manufacturing the same, and a backlight unit. The light emitting device includes a body including a cavity to open an upper portion, in which the cavity has a sidewall inclined at a first angle with respect to a bottom surface of the cavity, first and second electrodes formed in the body, in which at least portions of the first and second electrodes are formed along the sidewall of the cavity, a light emitting chip over the first electrode, the second electrode, and the bottom surface of the cavity, at least one wire having one end bonded to a top surface of the light emitting chip and an opposite end bonded to a portion of the first and second electrodes over the sidewall of the cavity, and a molding member formed in the cavity to seal the light emitting chip. |
| US08476660B2 |
Photovoltaic cell on substrate
A photovoltaic device on a non-semiconductor substrate is disclosed. The device comprises two semiconductor layers forming an active region; at least one of the semiconductor layers is formed by a high-purity plasma spray process; optional layers include one or more barrier layers, a cap layer, a conductive and/or metallization layer, an anti-reflection layer, and distributed Bragg reflector. The device may comprise multiple active regions. |
| US08476657B2 |
Light-emitting device
To provide a light emitting device easy to produce and extracting light to its outside with high efficiency, the light-emitting device 70 of the present invention includes an insulating base 10; a light-emitting element 1 mounted on a side of the base 10; and a protection element 2 mounted on the side and protecting the light-emitting element 1. The element 2 is covered with a light-reflecting filler-containing resin 5, which is prepared by causing a flexible silicone resin to contain, before being cured, light-reflecting or light-scattering fillers 5a having a particle diameter larger than the wavelength of light emitted by the element 1. This causes light emitted from the element 1 to be reflected by the resin 5, instead of being absorbed by the element 2, so that such light is released to the outside of the light-emitting device 70. This allows the device 70 to extract light to the outside with high efficiency, and also allows for easy formation of the resin 5 having a desired pattern and position. |
| US08476653B2 |
Light-emitting diode package
A light-emitting diode (LED) package includes a first chip group, a second chip group and an optical wavelength converting substance. The first chip group includes a plurality of red LED chips configured for emitting red light. The second chip group includes a plurality of blue LED chips configured for emitting blue light. The optical wavelength converting substance is arranged on light paths of the blue LED chips. The optical wavelength converting substance is configured for partly absorbing blue light emitted from the blue LED chips and emitting visible lights with different wavelengths. The plurality of blue LED chips has a total light output larger than that of the plurality of red LED chips. |
| US08476651B2 |
Vertical stacked light emitting structure
A vertical stacked light emitting structure includes a substrate unit, a first light emitting unit, a light guiding unit, and a second light emitting unit. The substrate unit includes at least one substrate body. The first light emitting unit includes at least one first LED bare chip disposed on the substrate body and electrically connected to the substrate body. The light guiding unit includes at least one light guiding body disposed on the first LED bare chip. The second light emitting unit includes at least one second LED bare chip disposed on the light guiding body and electrically connected to the substrate body. Therefore, the first LED bare chip, the light guiding body, and the second LED bare chip are stacked on top of one another sequentially. |
| US08476650B2 |
Film-covered LED device
A film-covered LED device includes a high thermal conductive substrate, a reflector, a plurality of LED chips, and a fluorescent film. A pair of electrical contacts is respectively disposed on two ends of the high thermal conductive substrate. A thru opening is formed on the reflector, which is disposed on the high thermal conductive substrate. The LED chips are disposed on the high thermal conductive substrate and connected electrically, within the thru opening. The fluorescent film is disposed on the reflector and casted over the LED chips. Thereby, the LEDs illumination is more evenly distributed, in maintaining illumination efficiency uniformity. The yield rate is also enhanced with savings in labor cost. |
| US08476648B2 |
Light emitting device and method of manufacturing the same
The present invention relates to a light emitting device and a method of manufacturing the light emitting device. According to the present invention, the light emitting device comprises a substrate, an N-type semiconductor layer formed on the substrate, and a P-type semiconductor layer formed on the N-type semiconductor layer, wherein a side surface including the N-type or P-type semiconductor layer has a slope of 20 to 80° from a horizontal plane. Further, the present invention provides a light emitting device comprising a substrate formed with a plurality of light emitting cells each including an N-type semiconductor layer and a P-type semiconductor layer formed on the N-type semiconductor layer, and a submount substrate flip-chip bonded onto the substrate, wherein the N-type semiconductor layer of one light emitting cell and the P-type semiconductor layer of another adjacent light emitting cell are connected to each other, and a side surface including at least the P-type semiconductor layer of the light emitting cell has a slope of 20 to 80° from a horizontal plane. Further, the present invention provides a method of manufacturing the light emitting device. Accordingly, there is an advantage in that the characteristics of a light emitting device such as luminous efficiency, external quantum efficiency and extraction efficiency are enhanced and the reliability is secured such that light with high luminous intensity and brightness can be emitted. |
| US08476642B2 |
Compound semiconductor device and manufacturing method thereof
A compound semiconductor device includes a substrate; an initial layer formed over the substrate; and a core layer which is formed over the initial layer and contains a Group III-V compound semiconductor. The initial layer is a layer of Group III atoms of the Group III-V compound semiconductor contained in the core layer. |
| US08476637B2 |
Nanostructure optoelectronic device having sidewall electrical contact
Nanostructure array optoelectronic devices are disclosed. The optoelectronic device may have a top electrical contact that is physically and electrically connected to sidewalls of the array of nanostructures (e.g., nanocolumns). The top electrical contact may be located such that light can enter or leave the nanostructures without passing through the top electrical contact. Therefore, the top electrical contact can be opaque to light having wavelengths that are absorbed or generated by active regions in the nanostructures. The top electrical contact can be made from a material that is highly conductive, as no tradeoff needs to be made between optical transparency and electrical conductivity. The device could be a solar cell, LED, photo-detector, etc. |
| US08476633B2 |
Thin film transistor array substrate for a display panel and a method for manufacturing a thin film transistor array substrate for a display panel
A method of manufacturing a thin film transistor capable of simplifying a substrate structure and a manufacturing process is disclosed. The method of manufacturing a thin film transistor array substrate comprising a three mask process. The 3 mask process comprising, forming a gate pattern on a substrate, forming a gate insulating film on the substrate, forming a source/drain pattern and a semiconductor pattern on the substrate, forming a first, second, and third passivation film successively on the substrate. Over the above multi-layers of the passivation film forming a first photoresist pattern comprising a first portion formed on part of the drain electrode and on the pixel region, and a second portion wherein, the second portion thicker than the first portion, and then patterning the third passivation film using the first photoresist pattern, forming a second photoresist pattern by removing the first portion of the first photoresist pattern, forming a transparent electrode film on the substrate, removing the second photoresist pattern and the transparent electrode film disposed on the second photoresist pattern; and forming a transparent electrode pattern on the second passivation layer. |
| US08476631B2 |
Thin film transistor with offset structure and electrodes in a symmetrical arrangement
A thin film transistor (TFT) having an offset structure is disclosed. The TFT maintains a sufficiently low “off” current and a sufficiently high “on” current. The TFT includes an active region. The active region includes a gate electrode; an active layer that overlaps with the gate electrode; a gate insulating layer between the gate electrode and the active layer; and a source/drain electrode layer including source/drain electrodes that are electrically connected to the active region. Some of the source/drain electrodes overlap partially with the gate electrode. Other of the source/drain electrodes are offset from the gate electrode. The source/drain electrodes and the gate electrode are in a symmetrical arrangement. |
| US08476627B2 |
Thin-film transistor, method of fabricating the thin-film transistor, and display substrate using the thin-film transistor
Provided is an oxide thin-film transistor (TFT) substrate that may enhance the display quality of a display device and a method of fabricating the same via a simple process. The oxide TFT substrate includes: a substrate, a gate line, a data line, an oxide TFT, and a pixel electrode. An oxide layer of the oxide TFT includes a first region that has semiconductor characteristics and a channel, and a second region that is conductive and surrounds the first region. A portion of the first region is electrically connected to the pixel electrode, and the second region is electrically connected to the data line. |
| US08476625B2 |
Semiconductor device comprising gate electrode of one conductive layer and gate wiring of two conductive layers
A semiconductor device includes an oxide semiconductor layer provided over a substrate having an insulating surface; a gate insulating film covering the oxide semiconductor layer; a first conductive layer and a second conductive layer laminated in this order over the gate insulating film; an insulating film covering the oxide semiconductor layer and a gate wiring including a gate electrode (the first and second conductive layers); and a third conductive layer and a fourth conductive layer laminated in this order over the insulating film and electrically connected to the oxide semiconductor layer. The gate electrode is formed using the first conductive layer. The gate wiring is formed using the first conductive layer and the second conductive layer. A source electrode is formed using the third conductive layer. A source wiring is formed using the third conductive layer and the fourth conductive layer. |
| US08476623B2 |
Light emitting device
A light emitting device having a plastic substrate is capable of preventing the substrate from deterioration with the transmission of oxygen or moisture content. The light emitting device has light emitting elements formed between a lamination layer and an inorganic compound layer that transmits visual light, where the lamination layer is constructed of one unit or two or more units, and each unit is a laminated structure of a metal layer and an organic compound layer. Alternatively, each unit is a laminated structure of a metal layer and an organic compound layer, wherein the inorganic compound layer is formed so as to cover the end face of the lamination layer. In the present invention, the lamination layer is formed on the primary surface of the plastic substrate, so that a flexible substrate structure can be obtained. |
| US08476618B2 |
Organic electroluminescent display device
To provide an organic electroluminescent display device including an organic electroluminescent layer that can be easily fabricated under an atmosphere containing oxygen and which can achieve high efficiency. An organic electroluminescent display device includes a substrate, an organic electroluminescent layer, an upper electrode and a lower electrode sandwiching therein the organic electroluminescent layer, either one of the upper and lower electrodes being a transparent electrode, and the other being a reflecting electrode, and a charge transport layer disposed between the organic electroluminescent layer and the substrate. The charge transport layer is photo-cured by light with a wavelength longer than that of a near-ultraviolet light. |
| US08476616B2 |
Materials for electronic and optoelectronic devices having enhanced charge transfer
A composite material is described. The composite material comprises semiconductor nanocrystals, and organic molecules that passivate the surfaces of the semiconductor nanocrystals. One or more properties of the organic molecules facilitate the transfer of charge between the semiconductor nanocrystals. A semiconductor material is described that comprises p-type semiconductor material including semiconductor nanocrystals. At least one property of the semiconductor material results in a mobility of electrons in the semiconductor material being greater than or equal to a mobility of holes. A semiconductor material is described that comprises n-type semiconductor material including semiconductor nanocrystals. At least one property of the semiconductor material results in a mobility of holes in the semiconductor material being greater than or equal to a mobility of electrons. |
| US08476615B2 |
GaN-based semiconductor light emitting device and the method for making the same
A GaN-based semiconductor light emitting device 11a includes a substrate 13 composed of a GaN-based semiconductor having a primary surface 13a tilting from the c-plane toward the m-axis at a tilt angle α of more than or equal to 63 degrees and less than 80 degrees, a GaN-based semiconductor epitaxial region 15, an active layer 17, an electron blocking layer 27, and a contact layer 29. The active layer 17 is composed of a GaN-based semiconductor containing indium. The substrate 13 has a dislocation density of 1×107 cm−2 or less. In the GaN-based semiconductor light emitting device 11a provided with the active layer containing indium, a decrease in quantum efficiency under high current injection can be moderated. |
| US08476608B2 |
Compact high precision adjustable beam defining aperture
The present invention provides an adjustable aperture for limiting the dimension of a beam of energy. In an exemplary embodiment, the aperture includes (1) at least one piezoelectric bender, where a fixed end of the bender is attached to a common support structure via a first attachment and where a movable end of the bender is movable in response to an actuating voltage applied to the bender and (2) at least one blade attached to the movable end of the bender via a second attachment such that the blade is capable of impinging upon the beam. In an exemplary embodiment, the beam of energy is electromagnetic radiation. In an exemplary embodiment, the beam of energy is X-rays. |
| US08476607B2 |
Charged particle beam drawing apparatus and article manufacturing method
The drawing apparatus includes an optical system housing configured to emit a charged particle beam toward the substrate, a stage configured to hold the substrate and be moved at least in a direction perpendicular to an axis of the optical system housing, a detection device including a detector and a support for supporting the detector such that the detector faces a side surface of the stage, and configured for measuring a position of the stage, and a magnetic shield member provided to the stage and configured to shield an opening of the optical system housing that faces a top surface of the stage from a magnetic field. Here, the magnetic shield member is provided to the stage at a region, in a direction of the axis, other than a region where the detection device is provided. |
| US08476606B2 |
Drawing apparatus and method of manufacturing article
A drawing apparatus for drawing a pattern on a substrate with a plurality of charged-particle beams, includes a blanking aperture array including a plurality of apertures, a blanking unit including a plurality of blankers and configured to respectively deflect the plurality of charged-particle beams by the plurality of blankers to cause the blanking aperture array to block the respectively deflected plurality of charged-particle beams, a generating circuit configured to generate a blanking instruction in a serial format, and a serial transmission cable configured to transmit the blanking instruction generated by the generating circuit to the blanking unit, wherein the blanking unit is configured to convert the blanking instruction in the serial format, that has been received via the serial transmission cable, into a blanking instruction in a parallel format, and to drive the plurality of blankers based on the blanking instruction in the parallel format. |
| US08476599B2 |
Curved scintillation crystal array
Partially and completely curved and spherical scintillation arrays are described. These arrays can provide improved imaging of a variety of subjects and objects. |
| US08476592B2 |
Terahertz wave apparatus
Provided is a terahertz wave apparatus. The terahertz wave apparatus includes: a wavelength-fixed laser emitting a first laser light having a fixed first wavelength; a wavelength-swept laser emitting a second laser light having a tunable second wavelength; a coupler coupling the first laser light with the second laser light; and a generator converting a mixed light emitted from the coupler into a terahertz wave, wherein a frequency of the terahertz wave is continuously tunable. |
| US08476586B2 |
Portable ion trap mass spectrometer with metal hydride container as source of hydrogen buffer gas
A mass spectrometry (MS) method which includes generating in a vicinity of the quadrupole ion trap hydrogen molecules, directing at least part of the hydrogen molecules into the quadrupole ion trap cell, applying AC and DC voltages to quadrupole ion trap cell electrodes to create a combined AC/DC trapping field, placing sample ions inside the quadrupole ion trap cell, cooling at least part of said ions using said hydrogen molecules as a buffer gas, changing the combined AC/DC trapping field to eject the ions from the quadrupole ion trap cell, and detecting the ejected ions. |
| US08476583B2 |
System and method for wellbore monitoring
A system for monitoring a borehole includes: a borehole string configured to be disposed within the borehole and configured to direct a fluid into the earth formation for storage in the earth formation, the fluid including carbon dioxide; at least one optical fiber sensor disposed on the borehole string at a fixed location relative to the borehole string, the optical fiber sensor including a plurality of measurement units disposed therein along a length of the optical fiber sensor, the plurality of measurement units configured to cause a wavelength shift in an interrogation signal received in the at least one optical fiber sensor due to at least one of a strain and a deformation of the borehole string; and a processor configured to transmit the interrogation signal to the at least one optical fiber sensor, and calculate at least one of the strain and the deformation based on the wavelength shift. |
| US08476582B2 |
Device for measuring radiation intensity of small sealed radioactive source for cancer therapy
A radiation intensity measuring apparatus is provided for an encapsulated sealed radioactive source for brachytherapy, which is capable of measuring radiation intensity of sources with a cartridge enclosed under sterile conditions. The radiation intensity measuring apparatus includes a radiation intensity measuring device for measuring radiation emitted from a source, a holding device for holding a cartridge, and a moving mechanism for moving the holding device to the radiation intensity measuring device. The moving device includes a guide portion for guiding the movement of the holding device so that the holding device moves along a direction perpendicular to an axial direction of a slit, and a moving portion for moving the holding device so that all the sources loaded in the cartridge pass through a position of the slit in a housing space of a housing portion. |
| US08476581B2 |
Speckle reduction method and apparatus
An apparatus adapted for confocal imaging of a non-flat specimen comprising a coherent light source for producing a light beam, imaging optics adapted to focus the light beam into at least one spot on a surface of a specimen, and a detector adapted to receive and detect light reflected from the specimen surface. The imaging optics comprise at least one optical component located so that the light reflected from the specimen surface passes therethrough on its way to the detector. The optical component is movable so as to move the at least one spot, within a range of movement, to a number of distinct locations in a plane perpendicular to the apparatus' optical axis, within the detector's integration time. |
| US08476574B1 |
Method of deconvolution of spectral data
A method for improving the analysis of spectral data wherein light is directed through a linearly variable bandpass filter to impinge on a linear array of photodetectors. The ratio of the passband captured by a target detector to the passband captured by adjacent detectors is determined and used to calculate the amount of light to add back to the amount reported by the target detector. The value of the stored information from each target detector is then adjusted by subtracting from that detector what was added to adjacent detectors. |
| US08476572B2 |
Optical receiver circuit
An optical receiver circuit is configured as follows: a preamplifier and a reference voltage generating circuit are connected with a first ground potential wiring and a first power supply wiring, which are used in common, and are formed in a first region where elements are formed on a substrate to which the potential of the first ground potential wiring is supplied; a main amplifier is connected with a second ground potential wiring and a second power supply wiring, which are separated from the first ground potential wiring and the first power supply wiring, and is formed in a second region where elements are formed on the substrate to which the potential of the second ground potential wiring is supplied; and a substrate supply interval where a first substrate supply position at which the potential of the first ground potential wiring is supplied and a second substrate supply position at which the potential of the second ground potential wiring is supplied are closest to each other is large to an extent where a substrate permeability characteristic, in which noise is fully attenuated in an alternating current (AC) manner, is obtained. |
| US08476571B2 |
SiPM photosensor with early signal digitization
The present invention is a Silicon PhotoMulitplier comprising a plurality of photon detection cell clusters each comprising a plurality of avalanche photodiodes connected in parallel, so that the output of each avalanche photodiode is summed together and applied to a cell cluster output. Each of the plurality of cell cluster outputs is connected to one of a plurality of cluster readout circuits, each of which includes an analog to digital converter that converts an analog representation of the total energy received by a photon detection cell cluster to a digital energy signal. A SiPM Pixel reader circuit is connected to the plurality of cluster readout circuits and configured to generate an overall pixel output by digital processing the plurality of digital energy signals received from the plurality of photon detection cell clusters by way of the plurality of cluster readout circuits. The SIPM pixel reader circuit also receives digital signals representative of timing triggers and the total energy received by a specific photon detection cell cluster and generates an overall SiPM energy signal and overall timing trigger in response to the signals received from the plurality of cluster readout circuits. |
| US08476568B2 |
Solid-state imaging device that adjusts frequency of a clock to change a gain of a counter to a determined gain
A solid-state imaging device comprises a pixel array; a reference signal generation unit operable to generate a reference signal that changes monotonically for a predetermined period in a horizontal period; a comparator operable to compare the level of a pixel signal with the level of a reference signal; a counter operable to count input clock pulses; a memory operable to store the number of counts counted by the counter as a digital value; and a timing control unit operable to generate a clock that is to be input into the counter, and change frequency of the clock that is to be input into the counter based on external input data. |
| US08476566B2 |
Library device and inclination correction method of movable unit provided in library device
A library device includes: a storage shelf including storage units aligned in a plurality of columns; and a conveying robot that grasps and conveys cartridges stored in the storage units, wherein the conveying robot includes: a base board located to face the plurality of columns, one end of the base board being supported movably up and down by a first support post, and another end of the base board being supported movably up and down by a second support post; a movable unit including a grasping unit grasping the cartridges stored in the storage units and moving on the base board; an inclination measuring unit measuring an inclination of the movable unit; and an inclination correction unit adjusting heights of both ends of the base board according to an inclination value of the movable unit measured by the inclination measuring unit and correcting the inclination of the movable unit. |
| US08476562B2 |
Inductive heater humidifier
An inductive heater humidifier for heating fluids is provided by the present disclosure. The humidifier includes a reservoir having a ferromagnetic bottom plate. The reservoir is disposed on top of a non-metallic cover plate, which rests on a topless ferrite base. The ferrite base includes induction coil for generating heat. The induction coil is energized to produce eddy currents that generate heat, which is convectively transferred to the reservoir via the bottom plate to heat fluid in the reservoir. |
| US08476560B2 |
Thermal processing furnace
A thermal processing furnace comprises: a tubular heat insulation member 4 surrounding a processing vessel 3 for receiving and thermally processing an object to be processed w; a heating resistor 5 helically arranged on an inner circumferential surface of the heat insulation member 4; and a support member 13 disposed on the inner circumferential surface of the heat insulation member 4, the support member 13 supporting the heating resistor 5 such that the heating resistor 5 can be thermally expanded and thermally shrunk. The thermal processing furnace further comprises: a movement prevention member 15 disposed on the heating resistor 5 to be in contact with one side surface of the support member 13 so as to prevent a downward movement of the heating resistor 5. |
| US08476557B2 |
Device for heating a cylindrical component and use in assembling an inter-shaft bearing in a turbomachine
A device for heating a cylindrical component of given diameter is disclosed. The device includes at least two heaters each delivering a stream of hot gas and emerging in an annular chamber. The inside diameter of the annular chamber is slightly greater than the diameter of the cylindrical component. The device may be used for heating a metal journal in which a bearing ring for an inter-shaft bearing in a double-body turbomachine is mounted. |
| US08476548B2 |
Method of cutting out part with making partially welded spots in wire-cut electrical discharge machining
A method of cutting out a part from a workpiece with making partially welded spots in wire electrical discharge machining to keep the part against falling apart away from the workpiece. There is no need to cut anew the welded spot left as in the conventional process. The cut-out parts are cut off at a time after breakage of the welded spots caused by an external impact. The electric processing condition applied across an inter-electrode space between the wire electrode and the workpiece is changed from a cutting phase to a welding phase in which the wire electrode is fused partially at some spots along a cutting path of a predetermined contour on the workpiece to weld together the cut-out part and the workpiece at the fused spot on the wire electrode. |
| US08476546B2 |
Dual breaking point electrical joint
Switch assemblies and electrical distribution devices for making and breaking electrical connections in an electrical circuit are disclosed herein. One aspect of the present disclosure is directed to a switch assembly that includes a pair of electrically conductive jaws attached to a platform. The first jaw is configured to electrically connect to an incoming line of the electrical circuit, whereas the second jaw is configured to electrically connect to an outgoing line. The switch assembly also includes a blade having at least two electrically conductive plates that are attached to and spaced from each other via an electrical insulator. The blade is pivotably coupled to the platform to rotate between a disengaged position, whereat the blade is electrically decoupled from the first and second jaws, and an engaged position, whereat the blade delivers an electrical current from the incoming line through the first and second plates to the outgoing line. |
| US08476541B1 |
Junction/outlet box locking insert, junction/outlet box system and method
A junction/outlet box locking insert, system and method including an insert body with an outer insert body surface and an inner axially extending pass through region having an open end and an end with an electrical cable/conduit stop with a central electrical conductor pass through opening. A retainer flange is connected with the insert body at an axial end thereof. An insert stop device cooperates with the retainer flange for fixing a position of the insert body relative to a junction/outlet box. A locking finger arrangement is connected to the insert body and includes a locking finger extending radially inwardly of the outer insert body surface. The locking finger is self-actuating for engaging a conduit or a metallic sheath of an electrical cable upon the conduit or a metallic sheath being inserted into the pass through region up to the electrical cable/conduit stop. |
| US08476522B2 |
Power panel
A power panel designed to incorporate a means of both thermal energy production and electrical energy production from the solar energy produced by the sun. The power panel comprises: a synthetic molded enclosure comprising a solar radiation top surface, bottom surface and sidewalls; and a transparent panel disposed on said synthetic molded enclosure. The transparent panel is adapted to insulate the thermal energy captured by the liquid circulating in the enclosure. The enclosure includes a plurality of segmented partitions adapted to form liquid pathways for channeling a liquid through the enclosure when the transparent panel is disposed on the segmented partitions thereby forming a liquid boundary in proximate contact with the segmented partitions and with the liquid in said enclosure. The power panel can also generate electrical power by incorporating a solar panel disposed between the enclosure and the transparent panel, wherein the solar panel forms a liquid boundary for the liquid circulating in the synthetic enclosure. |
| US08476520B2 |
Sound generation control apparatus
A sound generation control apparatus displays in a loop region a music data image corresponding to music data to be generated as time progresses, such that progression of the music data corresponds to a lengthwise position of the loop region. The sound generation control apparatus outputs time information indicating the time that progresses from a start of generation of music sound. The sound generation control apparatus controls the generation of the music sound based on the music data according to a relationship between a lengthwise position of the loop region and a displayed location of the music data image in the loop region. The sound generation control apparatus displays a plurality of the music data images in the loop region, and simultaneously generates a plurality of music sounds corresponding to the plurality of the music data images as the time progresses. |
| US08476512B1 |
Musical instrument neck
According to some embodiments, a musical instrument comprises a neck, a pickup socket, and a bar coupled between the neck and the pickup socket. |
| US08476509B1 |
Hybrid corn variety 980010
The invention provides seed and plants of the hybrid corn variety designated 980010. The invention thus relates to the plants, seeds and tissue cultures of the variety 980010, and to methods for producing a corn plant produced by crossing a corn plant of variety 980010 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety 980010. |
| US08476506B1 |
Variety corn line NPXF5467
The present invention provides an inbred corn line designated NPXF5467, methods for producing a corn plant by crossing plants of the inbred line NPXF5467 with plants of another corn plant. The invention further encompasses all parts of inbred corn line NPXF5467, including culturable cells. Additionally provided herein are methods for introducing transgenes into inbred corn line NPXF5467, and plants produced according to these methods. |
| US08476504B1 |
Inbred corn line SBK22
An inbred corn line, designated SBK22, the plants and seeds of the inbred corn line SBK22, methods for producing a corn plant, either inbred or hybrid, produced by crossing the inbred corn line SBK22 with itself or with another corn plant, and hybrid corn seeds and plants produced by crossing the inbred line SBK22 with another corn line or plant and to methods for producing a corn plant containing in its genetic material one or more transgenes and to the transgenic corn plants produced by that method. This invention also relates to inbred corn lines derived from inbred corn line SBK22, to methods for producing other inbred corn lines derived from inbred corn line SBK22 and to the inbred corn lines derived by the use of those methods. |
| US08476501B2 |
Tomato line FDR-9Q06020
The invention provides seed and plants of tomato hybrid EX15567101 and the parent lines thereof. The invention thus relates to the plants, seeds and tissue cultures of tomato hybrid EX15567101 and the parent lines thereof, and to methods for producing a tomato plant produced by crossing such plants with themselves or with another tomato plant, such as a plant of another genotype. The invention further relates to seeds and plants produced by such crossing. The invention further relates to parts of such plants, including the fruit and gametes of such plants. |
| US08476498B2 |
Lettuce cultivar keeper
A lettuce cultivar, designated Keeper, is disclosed. The invention relates to the seeds of lettuce cultivar Keeper, to the plants of lettuce cultivar Keeper and to methods for producing a lettuce plant by crossing the cultivar Keeper with itself or another lettuce cultivar. The invention further relates to methods for producing a lettuce plant containing in its genetic material one or more transgenes and to the transgenic lettuce plants and plant parts produced by those methods. This invention also relates to lettuce cultivars or breeding cultivars and plant parts derived from lettuce cultivar Keeper, to methods for producing other lettuce cultivars, lines or plant parts derived from lettuce cultivar Keeper and to the lettuce plants, varieties, and their parts derived from the use of those methods. The invention further relates to hybrid lettuce seeds, plants, and plant parts produced by crossing cultivar Keeper with another lettuce cultivar. |
| US08476497B2 |
Lettuce cultivar Camino Verde
A lettuce cultivar, designated Camino Verde, is disclosed. The invention relates to the seeds of lettuce cultivar Camino Verde, to the plants of lettuce cultivar Camino Verde and to methods for producing a lettuce plant by crossing the cultivar Camino Verde with itself or another lettuce cultivar. The invention further relates to methods for producing a lettuce plant containing in its genetic material one or more transgenes and to the transgenic lettuce plants and plant parts produced by those methods. This invention also relates to lettuce cultivars or breeding cultivars and plant parts derived from lettuce cultivar Camino Verde, to methods for producing other lettuce cultivars, lines or plant parts derived from lettuce cultivar Camino Verde and to the lettuce plants, varieties, and their parts derived from the use of those methods. The invention further relates to hybrid lettuce seeds, plants, and plant parts produced by crossing cultivar Camino Verde with another lettuce cultivar. |
| US08476492B2 |
Method of utilizing the pts gene and anti-sense ads to increase patchouli alcohol content in Artemisia annua L
The invention relates to a method of utilizing the pts gene and antisense ads to increase patchouli alcohol content in Artemisia annua L. plants. Using transgenic Artemisia annua L. plants, the method of the invention consistently increases the patchouli alcohol content in those plants, thus laying down a solid foundation for large-scale production of patchouli alcohol and other secondary metabolites such as terpenes other than artemisinin. |
| US08476491B2 |
Method of utilizing the PTS gene and RNA interference of the ads gene to increase patchouli alcohol content in Artemisia annua L.
The invention relates to a method of utilizing the pts gene and RNA interference of the ads gene to increase patchouli alcohol content in Artemisia annua L. plants. Using transgenic Artemisia annua L. plants, the method of the invention consistently increases the patchouli alcohol content in those plants, thus laying down a solid foundation for large-scale production of patchouli alcohol and other secondary metabolites such as terpenes other than artemisinin. |
| US08476487B1 |
Maize variety inbred PH12W5
A novel maize variety designated PH12W5 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH12W5 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH12W5 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH12W5 or a locus conversion of PH12W5 with another maize variety. |
| US08476482B2 |
Removal of pesticide residues in food by ionizing radiation
The present disclosure relates to a process for removal of pesticide residues from aqueous solutions and food products by ionizing radiation. Standard pesticides concentrations recognized by international organizations as maximum residues limit (MRLs) were used as the targeted concentrations in both aqueous solutions and food products. Commercially known pesticides and recommended irradiation doses by International Atomic Energy Agency (IAEA) were selected for this investigation. Aqueous solutions and food products fortified with pesticide residues were subjected to selected doses of ionizing radiation. Radiation-induced removal of pesticide residues is generally greater in aqueous solutions than in food products. Ionizing radiation can reduce the residues of pirimiphos-methyl in potatoes, grapes and dates; malathion and cypermethrin in grapes to below MRLs at the recommended irradiation doses. |
| US08476480B1 |
Bio-oil fractionation and condensation
A method of fractionating bio-oil vapors which involves providing bio-oil vapors comprising bio-oil constituents is described. The bio-oil vapors are cooled in a first stage which comprises a condenser having passages for the bio-oil separated by a heat conducting wall from passages for a coolant. The coolant in the condenser of the first stage is maintained at a substantially constant temperature, set at a temperature in the range of 75 to 100° C., to condense a first liquid fraction of liquefied bio-oil constituents in the condenser of the first stage. The first liquid fraction of liquified bio-oil constituents from the condenser in the first stage is collected. Also described are steps for subsequently recovering further liquid fractions of liquefied bio-oil constituents. Particular compositions of bio-oil condensation products are also described. |
| US08476478B2 |
Process for producing hydrogenolysis products of polyhydric alcohols
The present invention relates to a process for producing hydrogenolysis products of polyhydric alcohols with a good selectivity and a high yield, as well as hydrogenolysis catalysts used in the production process. The present invention provides (1) a process for producing a hydrogenolysis product of a polyhydric alcohol which includes the step of reacting the polyhydric alcohol with hydrogen in the presence of a catalyst containing a copper component, wherein the catalyst is a catalyst (A) containing the copper component, an iron component and an aluminum component, or a catalyst (B) containing the copper component and a silicon component; and (2) a hydrogenolysis catalyst for polyhydric alcohols which includes a copper component, an iron component and an aluminum component, and (3) a hydrogenolysis catalyst for polyhydric alcohols which includes a copper component and a silicon component. |
| US08476477B2 |
Process of oxidative conversion of methanol
A process for preparing polyoxymethylene dimethyl ethers from methanol is disclosed. For example, the process comprises contacting methanol with at least one oxidant in the presence of at least one catalyst wherein the at least one catalyst comprises at least one Group VIB metal component, such as in an amount of from about 0.5 to about 50 wt % (in terms of metal oxide) and at least one Group VIII metal component, such as in an amount of from about 0.2 to about 20 wt % (in terms of metal oxide), and at least one molecular sieve having acidic catalytic activity, such as in an amount of from about 40 to about 95 wt %, based on the total weight of the at least one catalyst for a time sufficient to obtain polyoxymethylene dimethyl ethers. |
| US08476476B2 |
Offgas cleanup in olefin hydroformylation
In the hydroformylation of C5-C14 olefins with cobalt catalyst to produce C6-C15 oxygenates, where offgasses from the hydroformylation or cobalt removal step contain volatile cobalt compounds, the cobalt compounds are recovered by scrubbing the offgas with a liquid, and recycling the liquid to the cobalt removal step. Suitable scrubbing liquids are the organic cobalt-depleted hydroformylation reaction product or a downstream derivative thereof, or an aqueous solution of a Co2+ salt, preferably such salt of formic acid. |
| US08476471B2 |
Synthesis of prostanoids
The presently disclosed subject matter provides a method of synthesizing prostaglandins and prostaglandin analogs comprising the ring closing metathesis of compounds of Formula (I). Also provided are novel compounds of Formula (I) and Formula (II). In addition to their use as synthetic intermediates in the presently disclosed methods, compounds of Formula (II) can be used as prostaglandin and/or prostaglandin analog prodrugs. |
| US08476466B2 |
Method for making harmful compound harmless and method for producing organic semiconductor element compound
The present invention provides a method for making a harmful arsenic compound, antimony compound and selenium compound harmless by using an organic cobalt complex, in which the cost of the method can be improved. The present invention is a method for making a harmful compound harmless, including irradiating light to an organic cobalt complex containing cobalt as a central metal and a corrin ring as a ligand, a methyl group donor, a titanium oxide photocatalyst, and a harmful compound containing an arsenic atom, an antimony atom or a selenium atom to methylate the harmful compound. In the present invention, it is preferable that the harmful compound be trimethylated. |
| US08476465B2 |
Deposition of Ta- or Nb-doped high-k films
Methods and compositions for depositing high-k films are disclosed herein. In general, the disclosed methods utilize precursor compounds comprising Ta or Nb. More specifically, the disclosed precursor compounds utilize certain ligands coupled to Ta and/or Nb such as 1-methoxy-2-methyl-2-propanolate (mmp) to increase volatility. Furthermore, methods of depositing Ta or Nb compounds are disclosed in conjunction with use of Hf and/or Zr precursors to deposit Ta-doped or Nb-doped Hf and/or Zr films, The methods and compositions may be used in CVD, ALD, or pulsed CVD deposition processes. |
| US08476463B2 |
Process for separating off fumaric acid and other minor components during the production of maleic anhydride
Processes for decreasing fumaric acid deposits in preparing maleic anhydride by heterogeneously catalyzed oxidation of a hydrocarbon with molecular oxygen. Maleic anhydride is absorbed from the crude mixture in an absorbent in an absorption column and desorbed in a desorption column, the entirety or portion of absorbent depleted in maleic anhydride, for controlled precipitation of fumaric acid, being cooled and/or concentrated by evaporating a portion of absorbent such that the difference between the concentration of fumaric acid in the recycle stream at the outlet of the desorption column under existing conditions and the equilibrium concentration of fumaric acid according to the solubility curve after cooling and/or evaporation of a portion of absorbent is ≧250 ppm by weight, and the fumaric acid precipitated as a solid is removed completely or partly from the absorbent recycling system and the fumaric acid-depleted absorbent is recycled completely or partly to the absorption column. |
| US08476461B2 |
Dipyrromethene-boron hydrophilic fluorescent compounds
Dipyrromethene-boron hydrophilic fluorescent compoundsThe invention concerns fluorescent and hydrophilic compounds meeting following formula (I): wherein: S1 is a group of formula —C≡C-L′-A where L′ is a linkage group and A is a polar functional group; S2 is a —C≡C-L′-A group the same or different from S1; —F; —H; or a hydrocarbon chain optionally interrupted by one or more oxygen atoms, and use thereof, in particular in aqueous or hydrophilic media. |
| US08476459B2 |
Process for the preparation of 4-sulfinyl-pyrazole derivatives
The present invention relates to a novel process for the preparation of a compound of formula (I), wherein R1, R2, R3, R4 and R5 are each independently selected from hydrogen, halogen, C1-C4-alkyl, C1-C4-haloalkyl, C1-C4-alkoxy, C1-C4-haloalkoxy, nitro, cyano, and pentafluorothio; R6 is C1-C4-alkyl, or C1-C4-haloalkyl; by oxidation of a compound of formula (II) with an oxidation agent selected from trifluoroperacetic acid and trichloroperacetic acid in the presence of a catalyst selected from hydroxides, oxides, sulfates, acetates or trifluoroacetates of lithium, magnesium, calcium, strontium, barium, titanium (IV), zinc (II) and manganese (II). |
| US08476458B2 |
Methods and compositions for modulating P300/CBP activity
The present invention relates to a method for identifying compounds that modulate the activity of p300/CBP. Compounds of the invention are identified by designing or screening for a compound which binds to at least one amino acid residue of the newly identified lysine-CoA inhibitor binding site, L1 loop, electronegative pocket, or electronegative groove of the HAT domain of p300/CBP and testing the compound for its ability to modulate the activity of p300/CBP. Compositions and methods for preventing or treating diseases or disorders associated with p300/CBP are also provided as is a method for producing a semi-synthetic HAT domain. |
| US08476456B2 |
Process for the preparation of 4-(imidazol-1-yl)benzenesulfonamide derivatives
Process for the preparation of 4-(imidazol-1-yl)benzenesulfonamide derivatives of formula I, wherein R1 represents optionally substituted aryl or heteroaryl, which comprises treating a compound of formula II, wherein R1 has the same meaning defined in the formula I and But represents tert-butyl, with an acid. The 4-(imidazol-1-yl)benzenesulfonamide derivatives of formula I are useful as anti-inflammatory agents. |
| US08476452B2 |
Process for preparing 1,2-benzoisothiazoline-3-one
Sodium sulfide hydrate is at least partially dehydrated by heating with N-methyl 2-pyrrolidone. 2-chlorobenzamide is added to the mixture which is heated further. The mixture is cooled and treated with aqueous hydrogen peroxide to give the sodium salt of 1,2-benzoisothiazoline-3-one in good yield. Acidification if desired gives rise to the free 1,2-benzoisothiazoline-3-one. |
| US08476450B2 |
Luminogenic and fluorogenic compounds and methods to detect molecules or conditions
A method to detect the presence or amount of at least one molecule in a sample which employs a derivative of luciferin or a derivative of a fluorophore is provided. Compounds and compositions for carrying out the methods of the invention are also provided. |
| US08476448B2 |
Solid form of 4-[[(6-chloropyridin-3-yl)methyl](2,2-difluoroethyl)amino]furan-2(5H)-one
The present invention relates to a novel solid form of 4-[[(6-chloropyridin-3-yl)methyl](2,2-difluoroethyl)amino]furan-2(5H)-one, to processes for its preparation and to its use in agrochemical preparations. |
| US08476442B2 |
Process for making modulators of cystic fibrosis transmembrane conductance regulator
The invention provides a process for the preparation of a compound of Formula 1, comprising coupling a carboxylic acid of Formula 2 with an aniline of Formula 3 in the presence of a coupling agent. |
| US08476441B2 |
Intermediates in the enantioselective synthesis of 3-(aminomethyl)-5-methyl-hexanoic acid
(S)-(+)-3-(aminomethyl)-5-methyl-hexanoic acid or (S)-pregabalin is an anticonvulsive drug. In addition to its use as an anticonvulsive agent, pregabalin has also been indicated as a medicament in the treatment of anxiety, neuropathic pain and pain in patients with fibromyalgia. Provided herein are thioester intermediates in the synthesis of and processes for the synthesis of 3-(aminomethyl)-5-methyl-hexanoic acid in the (R) or (S) configuration. |
| US08476435B2 |
Method for producing fluorine-containing polyether carboxylic acid amide
A fluorine-containing polyether carboxylic acid amide represented by the general formula: CnF2n+1O(C3F6O)mRfCONHAr, wherein Rf is a fluorocarbon group having 1 to 2 carbon atoms, Ar is a nitrogen-containing heterocyclic group, n is an integer of 1 to 3, and m is an integer of 10 to 30, is produced by reacting a fluorine-containing polyether carboxylic acid fluoride represented by the general formula: CnF2n+1(C3F6O)mRfCOF, wherein Rf, n, and m are as defined above, with a nitrogen-containing heterocyclic amine compound represented by the general formula: ArNH2, wherein Ar is as defined above; wherein the reaction is carried out while a reaction temperature is first increased to 80 to 100° C., and then increased at a temperature increase rate that produces a temperature difference of 3 to 5° C. after 48 hours. |
| US08476434B2 |
Protein kinase modulators and method of use
The present invention relates to chemical compounds having a general formula I wherein A, B, D, E, G, H1-5 and R1-4 are defined herein, and synthetic intermediates, which are capable of modulating various protein kinase receptor enzymes and, thereby, influencing various disease states and conditions related to the activities of these kinases. For example, the compounds are capable of modulating kinase enzymes thereby influencing the process of angiogenesis and treating angiogenesis-related diseases and other proliferative disorders, including cancer and inflammation. The invention also includes pharmaceutical compositions, including the compounds, and methods of treating disease states related to the activity of protein kinases. |
| US08476426B2 |
Process for the synthesis of ivabradine and addition salts thereof with a pharmaceutically acceptable acid
Process for the synthesis of ivabradine of formula (I): and addition salts thereof with a pharmaceutically acceptable acid. |
| US08476425B1 |
Tazobactam arginine compositions
This disclosure provides compositions containing solid forms of tazobactam arginine, and methods of manufacturing and using these compositions. |
| US08476418B2 |
Modified AAV capsid polypeptides
The present invention is concerned with the provision of a polynucleotide encoding an AAV capsid polypeptide comprising an inserted peptide and a vector comprising said polynucleotide. Moreover, contemplated is a host cell comprising said polynucleotide or vector, a method for the manufacture of said capsid polypeptide as well as said polypeptide. Further included is an antibody specifically binding to said polypeptide and a medicament comprising said polynucleotide, vector, polypeptide, or antibody. Also contemplated are the use of said polynucleotide, vector, polypeptide, or antibody for the manufacture of a medicament for the treatment of vascular disease and a method for the identification of a compound binding to said polypeptide. |
| US08476417B2 |
Isolated genomic polynucleotide fragments from the p15 region of isolated genomic polynucleotide fragments from the p15 region of chromosome 11 encoding human tumor suppressing subtransferable candidate 4 (TSSC4)
Provided herein are isolated genomic polynucleotide fragments from the from the p15 region of chromosome 11 encoding human and tumor suppressing subtransferable candidate 4 (TSSC4) and methods of use. |
| US08476415B2 |
Methods for rapid purification of nucleic acids for subsequent analysis by mass spectrometry by solution capture
The present invention provides a method for rapid solution capture purification of nucleic acids for subsequent analysis by electrospray mass spectrometry which is efficient and cost-effective relative to existing methods. The present invention also provides kits useful for practicing rapid solution capture of nucleic acids so that purified samples are in condition for analysis by electrospray mass spectrometry. |
| US08476411B2 |
Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides
Non-natural amino acids and polypeptides that include at least one non-natural amino acid, and methods for making such non-natural amino acids and polypeptides, are disclosed. The non-natural amino acids, by themselves or as a part of a polypeptide, can include at least one oxime, carbonyl, dicarbonyl, and/or hydroxylamine group. Methods for making, modifying, and purifying the non-natural amino acid polypeptides are also disclosed. Further, methods for using such non-natural amino acid polypeptides and modified non-natural amino acid polypeptides, including therapeutic, diagnostic, and other biotechnology uses, are disclosed. |
| US08476410B2 |
Fully human antibodies to high molecular weight-melanoma associated antigen and uses thereof
Disclosed herein are isolated human monoclonal antibodies, and functional fragments thereof, that specifically bind HMW-MAA. Nucleic acids encoding these antibodies, expression vectors including these nucleic acid molecules, and isolated host cells that express the nucleic acid molecules are also disclosed. The antibodies can be used to detect HMW-MAA in a sample. Methods of diagnosing cancer, or confirming a diagnosis of cancer, are disclosed herein that utilize these antibodies. Methods of treating a subject with cancer are also disclosed. |
| US08476407B2 |
Metallopeptide catalysts
This application provides a metallopeptide catalyst comprising dirhodium bound to one or more carboxylate residues of a peptide, protein or peptidomimetic. These stable metallopeptides can achieve structure-selective protein modification though molecular recognition. |
| US08476404B1 |
Selectively functionalized polyhydric compounds
This invention relates to polyhydric compounds containing primary and secondary hydroxyl groups selectively conjugated with linkers, polymers, and/or bioactive agents. |
| US08476403B2 |
Crosslinking of reactive polyolefin prepolymers using a coreactant
The present invention provides a cross linked polyolefin thermoset material, comprising maleic anhydride functionalized reactive polyolefin wax cross linked with a polyamine. The thermoset may be made by a method involving reaction of a maleic anhydride functionalized reactive polyolefin wax with a polyamine. The polyolefin may be polyethylene, polypropylene and their copolymers. The polyamine is a primary or secondary alkyl polyamines, alkyl ether polyamines, aryl polyamines. Polyols may be used instead of polyamines, for example alkyl polyols, alkyl ether polyols or aryl polyols. |
| US08476387B2 |
Catalytic process for preparing (meth)acrylic esters of N-hydroxyalkylated lactams
Provided is a process for preparing a (meth)acrylic ester (F) of an N-hydroxyalkylated lactam, in which a cyclic N-hydroxyalkylated lactam (L): where the structural variables as defined herein, in the presence of at least one metal salt of C1-C10-alkoxides (A), is esterified with (meth)acrylic acid (S) or transesterified with at least one (meth)acrylic ester (D), in which the metal salt of C1-C10-alkoxides (A) used as a catalyst is added in the absence of solvents and completely at the start of the reaction. |
| US08476384B2 |
Olefin acrylate emulsion copolymerization
A polymerization process to copolymerize hydrophobic ethylenically unsaturated C4-C30. J olefins with polar monomers such as acrylates is described. The process utilizes an acid source to modify/catalyze the reactivity of the polar monomer and/or radically activated repeat unit from the polar monomer to promote incorporation of the ethylenically unsaturated olefin. The copolymer shows excellent adhesion to a variety of polymeric and/or polar substrates such as polyolefins, acrylate coatings, wood, etc. |
| US08476382B2 |
Multiple continuous microfluidic reactors for the scaled up synthesis of gel or polymer particles
This present invention provides devices for the parallelization of the formation of droplets in a multiple droplet generator integrating two or more parallel flow-focusing devices (FFDs) with either identical, or different, geometries. In the parallel identical FFDs, emulsification generates droplets with a narrow (below 4%) polydispersity despite weak coupling between the identical flow-focusing devices. Formation of droplets in the integrated droplet generator comprising FFDs with different dimensions of the microchannels occurs with strong coupling between the FFDs and produces droplets with varying sizes and size distributions. For such devices the regime in which emulsification produces droplets with varying dimensions and a narrow size distribution have been identified. The results of this work can be used in scaling up the production of droplets and in the simultaneous production of droplets and particles with different dimensions. |
| US08476378B2 |
Biodegradable aliphatic-aromatic polyesters
Biodegradable aliphatic/aromatic copolyester comprising 50 to 60 mol % of an aromatic dicarboxylic acid and 40 to 50 mol % of an aliphatic acid, at least 90% of which is a long-chain dicarboxylic acid (LCDA) of natural origin selected from azelaic acid, sebacic acid, brassylic acid or mixtures thereof; and a diol component. |
| US08476370B2 |
High density polymer compositions, a method for their preparation and pressure-resistant pipes made therefrom
The present invention deals with polymer compositions suitable for making pipes. The compositions comprise a multimodal copolymer of ethylene and one or more alpha-olefins having from 4 to 10 carbon atoms wherein the multimodal ethylene copolymer has a density of from 937 to 950 kg/m3, a melt index MFR5 of from 0.3 to 3.0 g/10 min, a melt index MFR2 of from 0.1 to 2.0 g/10 min and a shear thinning index SHI2.7/210 of from 2 to 30. In addition the multimodal copolymer comprises: (A) from 30 to 70% by weight, based on the combined amount of components (A) and (B), of a low molecular weight ethylene polymer selected from ethylene homopolymer and a copolymer of ethylene and one or more alpha-olefins having from 4 to 10 carbon atoms and having a weight average molecular weight of from 5000 to 100000 g/mol and a density of from 960 to 977 kg/m3; and (B) from 30 to 70% by weight, based on the combined amount of components (A) and (B), of a high molecular weight copolymer of ethylene and one or more alpha-olefins having from 4 to 10 carbon atoms and having a weight average molecular weight of from 100000 to 1000000 g/mol and a density of from 890 to 929 kg/m3. |
| US08476362B2 |
Moisture-curing polyisocyanate mixtures
The invention relates to moisture-curing polyisocyanate mixtures, to a process for their preparation and to their use as binders in lacquers, coatings, adhesives and sealing materials. |
| US08476359B2 |
Polyolefin based hot melt adhesive having improved heat resistance
A polyolefin based hot melt adhesive composition having improved heat resistance includes a blend of about 5% to 50% by weight of a glassy semicrystalline poly-alpha-olefin polymer, about 5% to 70% by weight of a soft or rubbery polymer, about 5% to 65% by weight of a tackifier, about 0% to 3% by weight of a stabilizer and optionally a wax and/or plasticizer. The composition can also contain other additives and fillers to further modify its properties. An application process for the adhesive composition and various articles assembled therewith are also disclosed. The composition is particularly suited for applications where complicated bonding needs exist that involve bonding of multiple components or parts fabricated from dissimilar materials ranging from steel to plastic to fabrics. |
| US08476358B2 |
Use of vinyl ester copolymers as low-profile additives (LPAS)
The invention relates to the use of protective-colloid-stabilized vinyl ester/ethylene copolymers in the form of polymer powder as low-profile-additives (LPAs). |
| US08476357B2 |
Method for making composite carbon nanotube structure
A method for making a composite carbon nanotube structure includes the following steps. An organic solvent, a polymer, and a carbon nanotube structure are provided. The polymer is dissolved in the organic solvent to obtain a polymer solution. The carbon nanotube structure is soaked with the polymer solution. A contact angle between the organic solvent and a carbon nanotube is less than 90 degrees. |
| US08476354B2 |
Low sink marks and excellent surface appearance reinforced polyamide compositions
The invention relates to resin compositions comprising a) at least one amorphous semi-aromatic polyamide; b) at least two semi-crystalline polyamides, b1) and b2) and c) at least one glass reinforcement agent and shaped articles thereof showing a good balance of properties in terms of good mechanical properties, excellent surface appearance and reduced sink marks. |
| US08476349B2 |
Rubber composition for tire
A rubber composition for a tire is blended with diene-based rubber containing 50 wt % or more of SBR, and 0.2 to 5 parts by weight of cyclic polysulfide represented by the below formula (I), 1 to 30 parts by weight of aromatic denatured terpene resin, 20 to 80 parts by weight of silica, and 40 to 100 parts by weight of carbon black relative to 100 parts by weight of the diene-based rubber. Further, a total blending amount of the silica and the carbon black is 70 to 130 parts by weight. In the formula, R represents a substituted or unsubstituted alkylene group having 2 to 18 carbon atoms, a substituted or unsubstituted oxyalkylene group having 2 to 18 carbon atoms, or an alkylene group including an aromatic ring, x represents an average number of 2 to 6, and n represents an integer of 1 to 15. |
| US08476337B2 |
Wettable silicone hydrogel contact lenses and related compositions and methods
Silicone hydrogel contact lenses having ophthalmically acceptable surface wettabilities are obtained from pre-extracted polymerized silicone hydrogel contact lens products having relatively large amounts of removable or extractable materials. The silicone hydrogel contact lenses can be obtained from non-polar resin based contact lens molds and without surface treatments or an interpenetrating polymeric network of a polymeric wetting agent. Related lens products, polymerizable compositions, and methods are also described. |
| US08476334B2 |
Acrylated polyamides
A radiation-curable acrylate-modified aminoamide resin which is the Michael addition product of an aminoamide thermoplastic polymer derived from a polymerised unsaturated fatty acid with a polyol ester having at least three (meth)acrylate ester groups, the aminoamide thermoplastic polymer having an amine number of from 40 to 60 mgKOH/g, the ratio of the initial (meth) acrylate groups of the polyol ester to the initial amino functional groups of the aminoamide polymer being at least 4:1, is liquid at 25° C., and is useful as the resin component of various types of energy-curable coating composition, including inks, varnishes and lacquers, especially lithographic inks. |
| US08476329B2 |
Bioresin composition for use in forming a rigid polyurethane foam article
A bioresin composition is used to form a rigid polyurethane article that includes a first and a second biopolyol and is substantially free of aprotic solvents that chemically decompose in the presence of water. The first biopolyol includes a natural oil component. The second biopolyol includes the reaction product of a natural carbohydrate and an alkylene oxide. The rigid polyurethane foam article includes the reaction product of the bioresin composition and an isocyanate which are reacted in the presence of a chemical blowing agent. |
| US08476326B2 |
Fibrillated polyolefin foam
A method for generating a thermoplastic foam from an aqueous dispersion, the aqueous dispersion comprising a thermoplastic resin, water, and a dispersion stabilizing agent, the method including: adding at least one froth stabilizing surfactant to the aqueous dispersion to form a mixture; adding a fiber to the mixture; and frothing the mixture to create a froth, removing at least a portion of the water in the froth to create a foam, wherein the foam generated has a non-cellular fibrillated morphology. In another aspect, embodiments disclosed herein relate to a foam having a thermoplastic-based, fibrillated, non-cellular structure, wherein the foam has an average density of about 0.02 g/cm3 to about 0.07 g/cm3. In certain embodiments, the foam may be used in an absorbent article. |
| US08476320B2 |
Formulations for parenteral administration of amino-substituted (E)-2, 6-dialkoxystyryl 4-substituted benzylsulfones
Formulations are provided for parenteral administration of (amino substituted (e)-2,6-dialkoxystyryl 4-substituted benzylsulfones and the sodium and potassium salts thereof for the prevention and/or treatment of conditions mediated by abnormal cell proliferation.Composition for parenteral administration are provided which comprise an effective amount of a compound of formula I or a compound of formula IIa and at least about 50% by weight of at least one water soluble polymer selected from the group consisting essentially of polyethylene glycol (PEG), poly-oxyethylene, poly-oxyethylene-poly-oxypropylene copolymers, polyglycerol, polyvinylalcohol, polyvinylpyrrolidone (PVP), polyvinylpyridine N-oxide, copolymer of vinylpyridine N-oxide and vinylpyridine. |
| US08476315B2 |
N-hydroxy C29-amide derivatives of oleandrane
The present invention encompasses novel triterpene compounds of general formula I, wherein R3a, R3b, R11a, R11b, R31 and R32 are defined as in claim 1, which are suitable for the prevention and/or treatment of diseases mediated by 11 β-HSD and the use thereof for preparing a medicament having the above-mentioned properties. |
| US08476309B2 |
Benzofuran cannabinoid compounds and related methods of use
Furanopyridine cannabinoid analog compounds of the formula I are disclosed. The compounds are useful to modify the activity of CB1 and CB2 receptors and treat conditions mediated by these receptors. |
| US08476308B2 |
GPR120 receptor agonists and uses thereof
GPR120 agonists are provided. These compounds are useful for the treatment of metabolic diseases, including Type II diabetes and diseases associated with poor glycemic control. |
| US08476307B2 |
Pharmaceutical composition based on idazoxan, salts, hydrates or polymorphs thereof
A pharmaceutical composition comprising idazoxan or derivatives and their therapeutically acceptable salts, racemates, optically active isomers and polymorphs. |
| US08476305B2 |
Therapeutic agent or prophylactic agent for inflammatory bowel disease comprising amino alcohol derivative as active ingredient
A novel therapeutic agent or prophylactic agent for an inflammatory bowel disease is provided. An amino alcohol derivative represented by the general formula (1): which is a sphingosine-1-phosphate receptor agonist or a pharmaceutically acceptable salt or hydrate thereof are a therapeutic agent or prophylactic agent for an inflammatory bowel disease comprises. |
| US08476297B2 |
TRP-M8 receptor ligands and their use in treatments
Tetrahydroisoquinoline compounds of formula (I), and compositions containing them, for the treatment of acute, inflammatory and neurophatic pain, dental pain, general headache, migraine, cluster headache, mixed-vascular and non-vascular syndromes, tension headache, general inflammation, arthritis, rheumatic diseases, osteoarthritis, inflammatory bowel disorders, inflammatory eye disorders, inflammatory or unstable bladder disorders, psoriasis, skin complaints with inflammatory components, chronic inflammatory conditions, inflammatory pain and associated hyperalgesia and allodynia, neurophatic pain and associated hyperalgesia and allodynia, diabetic neuropathy pain, causalgia, sympathetically maintained pain, deafferentation syndromes, asthma, epithelial tissue damage or dysfunction, herpes simplex, disturbances of visceral motility at respiratory, genitourinary, gastrointestinal or vascular regions, wounds, burns, allergic skin reactions, pruritus, vitiligo, general gastrointestinal disorders, gastric ulceration, duodenal ulcers, diarrhea, gastric lesions induced by necrotising agents, hair growth, vasomotor or allergic rhinitis, bronchial disorders or bladder disorders. |
| US08476289B2 |
Aza-bicyclohexyl substituted indolyl alkyl amino derivatives as novel inhibitors of histone deacetylace
This invention comprises the novel compounds of formula (I) wherein R1, R2, R3, R4, A and X have defined meanings, having histone deacetylase inhibiting enzymatic activity; their preparation, compositions containing them and their use as a medicine. |
| US08476288B2 |
Salts 756
The invention provides salts of 4-(dimethylamino)butyl 2-(4-((2-amino-4-methyl-6-(pentylamino)pyrimidin-5-yl)methyl)phenyl)acetate, pharmaceutical compositions containing them and their use in therapy. |
| US08476285B2 |
Purine-core inhibitors of HSP90 and their use in treating cancer
The invention relates to compounds of Formulae I-III: and therapeutic uses thereof, wherein A is chosen from a substituted or unsubstituted aryl, heteroaryl, heterocyclic, or carbocyclic group; B is chosen from a substituted or unsubstituted piperidine, homopiperidine, piperazine, pyrrolidine or azetidine group; R1 is chosen from hydro, alkyl, aryl, heteroaryl, amino, or halo; and L1, L2, are as defined herein. |
| US08476283B2 |
[6,5]—bicyclic GPR119 G protein-coupled receptor agonists
Novel compounds are provided which are GPR119 G protein-coupled receptor modulators. GPR119 G protein-coupled receptor modulators are useful in treating, preventing, or slowing the progression of diseases requiring GPR119 G protein-coupled receptor modulator therapy. These novel compounds have the structure: or stereoisomers or prodrugs or pharmaceutically acceptable salts thereof, wherein n2, n3, n4, A, B, D, E, G, J, Y, R1 and R2 are defined herein. |
| US08476282B2 |
Benzoxazole kinase inhibitors and methods of use
The present invention provides chemical entities or compounds and pharmaceutical compositions thereof that are capable of modulating certain protein kinases such as mTor, tyrosine kinases, and/or lipid kinases such as PI3 kinase. For example, the invention provides compounds of Formula: Also provided in the present invention are methods of using such compounds or compositions, and methods of using these compositions to modulate activities of one or more of these kinases, especially for therapeutic applications such as treatment of cancer. |
| US08476281B2 |
Solid forms of gyrase inhibitor (R)-1-ethyl-3-[6-fluoro-5-[2-(1-hydroxy-1-methyl-ethyl)pyrimidin-5-yl]-7-(tetrahydrofuran-2-yl)-1H-benzimidazol-2-yl]urea
The present application is directed to solid forms of compounds of formula I: and pharmaceutically acceptable salts thereof, that inhibit bacterial gyrase and/or Topo IV and pharmaceutical compositions comprising said compounds and salts. These compounds and salts are useful in treating bacterial infections. |
| US08476279B2 |
Phenyl-piperazine derivatives as serotonin reuptake inhibitors
The invention provides compounds represented by the general formula I wherein the substituents are defined in the application. The compounds are useful in the treatment of an affective disorder, including depression, anxiety disorders including general anxiety disorder and panic disorder and obsessive compulsive disorder. |
| US08476278B2 |
Thiazole Derivatives as protein kinase inhibitors
The present invention relates to novel Thiazole Derivatives, compositions comprising the Thiazole Derivatives, and methods for using the Thiazole Derivatives for treating or preventing a proliferative disorder, an anti-proliferative disorder, inflammation, arthritis, a central nervous system disorder, a cardiovascular disease, alopecia, a neuronal disease, an ischemic injury, a viral infection, a fungal infection, or a disorder related to the activity of a protein kinase. |
| US08476275B2 |
N-[piperazinyl hetaryl]arylsufonamide compounds with affinity for the dopamine D3 receptor
The invention related to N-[(piperazinyl)hetaryl]arylsulfonamide compounds of the general formula (I) in which Q is a bivalent, 6-membered heteroaromatic radical which possesses 1 or 2 N atoms as ring members and which optionally carries one or two substituents Ra which is/are selected, independently of each other, from halogen, CN, NO2, CO2R4, COR5, C1-C4-alkyl and C1-C4-haloalkyl; Ar is phenyl or a 6-membered heteroaromatic radical which possesses 1 or 2 N atoms as ring members and which optionally carries one or two substituents Rb, which is/are selected from halogen, NO2, CN, CO2R4, COR5, C1-C6-alkyl, C2-C6-alkenyl, C2-C6-alkynyl, C3-C6-cycloalkyl, C3-C6-cycloalkyl-C1-C4-alkyl and C1-C4-haloalkyl, with it also being possible for two radicals Rb which are bonded to adjacent C atoms of Ar to be together C3-C4-alkylene; R1 is hydrogen, C1-C4-alkyl, C1-C4-haloalkyl, C3-C6-cycloalkyl, C3-C6-cycloalkyl-C1-C4-alkyl, C1-C4-hydroxyalkyl, C1-C4-alkoxy-C1-C4-alkyl, C3-C4-alkenyl or C3-C4-alkynyl; with the radicals n, R1, R2, R3, R4 and R5 having the meanings given in the patent claims, to the N-oxides and to the physiologically tolerated acid addition salts of these compounds and to pharmaceutical compositions which comprise at least one N-[(piperazinyl)hetaryl]arylsulfonamide compound as claimed in one of claims 1 to 10 and/or at least one physiologically tolerated acid addition salt of I and/or an N-oxide of I, where appropriate together with physiologically acceptable carriers and/or auxiliary substances for treating diseases which respond to influencing by dopamine D3 receptor antagonists or agonists, in particular for treating diseases of the central nervous system and disturbances of kidney function. |
| US08476271B2 |
Substituted-quinoxaline-type bridged-piperidine compounds as ORL-1 modulators
Compounds of Formula (I): where R1, R2, R5, a, and b are disclosed herein, and pharmaceutically acceptable derivatives thereof (a “Substituted-Quinoxaline-Type Bridged-Piperidine Compound”), compositions comprising an effective amount of a Substituted-Quinoxaline-Type Bridged-Piperidine Compound, and methods to treat or prevent a condition, such as pain, comprising administering to an animal in need thereof an effective amount of a Substituted-Quinoxaline-Type Bridged-Piperidine Compound. |
| US08476261B2 |
Spirocyclic aminoquinolones as GSK-3 inhibitors
Provided herein are spirocyclic aminoquinolones of formula I and compositions containing the compounds. The compounds and compositions provided herein are useful in the prevention, amelioration or treatment of GSK-3 inhibitors mediated diseases. In Formula (I): X1 is O or NR8; A is bond or substituted or unsubstituted C1-C2 alkylene, wherein the substituents when present are selected from one to four Q2 groups; where Q2 is alkyl or haloalkyl; p is 0 or 1; and q is an integer of 0 to 2. |
| US08476253B2 |
Amide derivative
Compounds or pharmacologically acceptable salts thereof are provided. In various embodiments the compounds have an antagonistic effect on a neurokinin NK1 receptor, a neurokinin NK2 receptor, and a muscarine M3 receptor. The compounds are useful as therapeutic agents for bronchial asthma, chronic obstructive pulmonary disease, or the like. |
| US08476250B2 |
Intravenous formulation with water-soluble cocrystals of acetylsalicylic acid and theanine
A method of treatment using a water-soluble cocrystal composition contains a quantity of acetylsalicylic acid and a quantity of a theanine enantiomer selected from an alpha variant of theanine or a beta variant of theanine or other form of theanine. |
| US08476244B2 |
Method of producing recombinant biological products
A method of producing a recombinant biological product, which method employs a mammalian producer cell culture, comprises the steps of generating a biomass of mammalian producer during an initial phase of cell culture, and causing an increase in a level of one or more of the miRNA molecules of Table 1 within the mammalian producer cells once a desired concentration of mammalian producer cells has been achieved. The method may also comprise the step of increasing a level of an inhibitor of one or more of the miRNA molecules of Table 1 within the mammalian producer cells at the start of or during an initial phase of culture. |
| US08476243B2 |
Methods and compositions for treating keratin hyperproliferative disorders
A method for keratin hyperproliferation disorders such as corns, calluses, or keratosis pilaris (KP) by administering to a subject experiencing the disorder a therapeutically effective amount of an RNA sequence which inhibits expression of a gene encoding for a keratin selected from the group consisting of K6a, K6b, K16, K17, and combinations thereof. |
| US08476237B2 |
Compositions and methods for treating cancer by inhibiting the secretion of microparticles
Novel peptides that inhibit the release of microparticles from cells are disclosed. Also disclosed are polynucleotides encoding the peptides, expression vectors carrying the polynucleotides and methods for treating tumors using the novel peptides. |
| US08476236B2 |
Treatment of skin conditions by Dickkopf1 (DKK1)
The present disclosure is generally related to methods of inducing non-palmoplantar skin to develop a palmoplantar phenotype, for example, methods for increasing skin thickness, decreasing skin pigmentation, and/or decreasing hair growth. In particular, disclosed herein are methods of using topical administration of DKK1 to increase skin thickness, decrease skin pigmentation, or reduce hair growth. Also disclosed are topical DKK1 compositions for inducing non-palmoplantar skin to develop a palmoplantar phenotype. |
| US08476232B2 |
Method for the production of conjugates of insulin-like growth factor-1 and poly(ethylene glycol)
The present invention relates to a fusion protein comprising IGF-I or an IGF-I variant N-terminally linked to the C-terminus of a propeptide. The invention relates also to a method involving the use of the aforementioned fusion protein in the production of a lysine-PEGylated IGF-I or IGF-I variant. The method comprises the steps of cultivating a prokaryotic host cell comprising an expression vector containing a nucleic acid encoding the fusion protein and causing the cell to express the fusion protein, recovering and PEGylating said fusion protein, cleaving said PEGylated fusion protein with IgA protease, and recovering lysine-PEGylated IGF-I or IGF-I variant. The invention relates also to a lysine-PEGylated IGF-I or IGF-I variant produced using the above method. In addition, the invention relates to a method for treating a neurodegenerative disorders like Alzheimer's Disease using the lysine-PEGylated IGF-I or IGF-I variant and a composition comprising the lysine-PEGylated IGF-I or IGF-I variant. |
| US08476230B2 |
Insulinotropic complex using an immunoglobulin fragment
The present invention relates to an insulinotropic peptide conjugate having improved in-vivo duration of efficacy and stability, comprising an insulinotropic peptide, a non-peptide polymer and an immunoglobulin Fc region, which are covalently linked to each other, and a use of the same. The insulinotropic peptide conjugate of the present invention has the in-vivo activity which is maintained relatively high, and has remarkably increased blood half-life, and thus it can be desirably employed in the development of long acting formulations of various peptide drugs. |
| US08476229B2 |
Blood sugar-modulating polypeptides
A blood sugar-modulating polypeptide, a pharmaceutical composition comprising the polypeptide, and a method for modulating blood sugar in a mammal comprising the administration of the polypeptide are provided. The polypeptide has a following amino acid sequence or a homologous amino acid sequence derived from the substitution, deletion, and/or addition of one or more amino acids therein: RVRVWVTERGIVARPPTIG(SEQ ID NO. 11). |
| US08476225B2 |
Antiviral compounds
The invention is related to anti-viral compounds, compositions containing such compounds, and therapeutic methods that include the administration of such compounds, as well as to processes and intermediates useful for preparing such compounds. |
| US08476223B2 |
Metallo-lactoferrin-coenzyme compositions to improve sleep patterns
Formulations are provided for the improvement of sleep patterns. The formulations generally include a trigger complex, an elemental complex and a coenzyme-vitamin B complex. The trigger complex is high in fiber such as glucomannan and includes Metallo-Lactoferrin protein in an alkaline buffer system. The elemental complex includes one or more trace element as a suitable salt. The coenzyme-vitamin B complex includes one or more coenzyme, coenzyme precursor and/or B-vitamin. The compositions may optionally include additional components such as 5-hydroxy-L-tryptophan (5-HTP), choline, melatonin, milk protein hydrolysate, L-arginine, and L-carnitine. The compositions can be administered orally in a variety of forms. |
| US08476220B2 |
Biocompatible polymers, process for their preparation and compositions containing them
A process for treating fibroses including administering a therapeutically effective amount of a pharmaceutical composition which includes at least one biocompatible polymer of the following general formula (I): AaXxYy wherein: A represents a monomer selected from the group consisting of a sugar or —(O—CH2—CH2—CO)—, X represents a carboxyl group bonded to monomer A and is contained within a group according to the following formula: —R—COO—R′, in which R is a bond or an aliphatic hydrocarbon chain, optionally branched and/or unsaturated, and which can contain one or more aromatic rings except for benzylamine and benzylamine sulfonate, and R′ represents a hydrogen atom or a cation, Y represents a sulfate or sulfonate group bonded to monomer A and is contained within a group according to one of the following formulas: —R—O—SO3—R′, —R—N—SO3—R′, —R—SO3—R′, in which R is a bond or an aliphatic hydrocarbon chain, optionally branched and/or unsaturated, and which can contain one or more aromatic rings except for benzylamine and benzylamine sulfonate, and R′ represents a hydrogen atom or a cation, a represents the number of monomers A such that the mass of the polymers of formula (I) is greater than approximately 5,000 da, x represents a substitution rate of the monomers A by the groups X, which is between approximately 20 and 150%, and y represents a substitution rate of the monomers A by the groups Y, which is between approximately 30 and 150%. |
| US08476218B1 |
Antimicrobial compositions and related methods
Antimicrobial compositions and related methods are described. In an embodiment of the invention, an antimicrobial composition comprises parachlorometaxylenol in an amount of 0.75% w/w to 1% w/w; sodium pareth C12-15 sulfonate in an amount of 1% w/w to 1.25% w/w; poly(oxyethylene)20 cetyl ether in an amount of 0.05% w/w to 0.55% w/w; benzoic acid in an amount of 0.075% w/w to 1.25% w/w; glycerol in an amount of 0.01% w/w to 0.02% w/w; phenoxyethanol in an amount of 0.001% w/w to 0.5% w/w; and water in an amount of 94% w/w to 97% w/w. |
| US08476215B1 |
Detergent composition
A detergent composition includes: 11 to 45 parts by weight of a natural surfactant; 25 to 35 parts by weight of mirabilite; 10 to 40 parts by weight of a water softener; 0.2 to 5 parts by weight of a chelating agent; and a balance of an additional detergent builder. |
| US08476214B2 |
Low voc hard surface treating composition providing anti-fogging and cleaning benefits
A multi-functional hard surface treating composition is described which includes (1) a surfactant system including at least two surfactants and (2) at least one alkylene glycol alkyl ether. The at least two surfactants include an anionic surfactant and either a polymer surfactant or a nonionic surfactant. The surfactant system and alkylene glycol alkyl ether have a synergistic effect to provide anti-fogging, anti-streaking, and cleaning benefits to a hard surface treated with the composition. |
| US08476208B2 |
Water-soluble metal-processing agent, coolant, method for preparation of the coolant, method for prevention of microbial deterioration of water-soluble metal-processing agent, and metal processing
Disclosed are a water-soluble metal-processing agent and a coolant both of which have excellent microbial deterioration resistance and are less likely to go rotten, a method for preparing the agent or the coolant, and a metal processing method. The water-soluble metal-processing agent or the coolant comprises an N,N,N′,N′-tetraalkyldiamine compound. The metal processing method is characterized by processing a metal of interest by using the water-soluble metal-processing agent or the coolant. |
| US08476200B2 |
Method for differentiating between the non-infectious and infectious causes of multiple organ failure
The present invention relates to the use of gene expression profiles obtained in vitro from patient samples for differentiating between the non-infectious and infectious causes of multiple organ failure. The invention also relates to a method for measuring gene expression profiles in vitro and the use of said gene expression profiles and/or of the probes used therein for screening active substances against the non-infectious and/or infectious causes of multiple organ failure. |
| US08476199B2 |
Rare earth-type tape-shaped oxide superconductor and a composite substrate used for the same
This invention provides a rare earth-type tape-shaped oxide superconductor having excellent mechanical strength and superconducting properties and a composite substrate using for the same. Non-oriented and non-magnetic Ni-9 at % W alloy tapes (11, 21) were bonded onto both sides of a non-oriented and non-magnetic hastelloy tape (100) by a normal temperature bonding process, and an Ni-3 at % W alloy tape (12) having a cubic texture was bonded onto the surface of the tape (11) by a normal temperature bonding process. Thereafter, the heat-treatment was given in a reducing atmosphere and a bonding layer (50a) etc. was formed on the adhesive interface of each layer. Next, a (Ce, Gd)O2 intermediate layer (13) and a Ce2Zr2O7 intermediate layer (14) by an MOD process, a CeO2 intermediate layer (15), a YBCO superconducting film (16) by a TFA-MOD method, and a silver stabilization layer (17) were stacked sequentially on the surface of the tape (12). A critical current value (Ic) of this superconductor showed 150 A. |
| US08476196B2 |
Control of harmful algal blooms by induction of programmed cell death
The subject invention pertains to compositions, apparatus, and methods for controlling harmful algae and harmful algal bloom (HAB) based on the induction of the programmed cell death (PCD; apoptosis) pathway in the harmful algae, and to kits for determining algal susceptibility to PCD induction. |
| US08476193B2 |
Stable oil-in-water emulsions
Interaction of cloquintocet mexyl in the discontinuous oil phase with water in the continuous aqueous phase of an oil-in-water emulsion, which can lead to cloquintocet mexyl hydrate formation, crystal formation and Ostwald ripening, is minimized by the use of specific surfactants and solvents which provide enhanced stability to the emulsion. |
| US08476192B2 |
Seed treatment pesticidal compositions
An aqueous seed treatment insecticidal and/or nematicidal composition in the form of a suspension comprising (A) at least one insecticide and/or nematicide in an amount of at least 3 weight %, based on the total weight of the composition, and (B) at least two surface active compounds, wherein (i) at least one is an anionic phosphate type compound, and (ii) at least one is a non-ionic alkoxylated phenol. Such compositions demonstrate improved dust-off performance when applied to plant propagation material, such as seeds. |
| US08476189B1 |
Process for superabsorbent polymer and crosslinker composition
The present invention further relates to a process to make a superabsorbent polymer comprising the steps of a) preparing a neutralized monomer solution comprising a polymerizable monomer selected from unsaturated acid groups-containing monomers, ethylenically unsaturated carboxylic acid anhydride, salts, or derivatives thereof and a caustic agent selection from an alkali agent, wherein the polymerizable monomer is neutralized to from about 50 mol % to about 85 mol %; b) forming a crosslinker monomer mixture by adding an internal crosslinker composition to the neutralized monomer solution wherein the internal crosslinking composition is the reaction product of a stoichiometric excess of amine with a glycidyl compound, wherein the internal crosslinker composition has a residual amount of glycidyl compounds of less than about 500 ppm based on the mass of the internal crosslinker composition; and c) polymerizing the crosslinker monomer mixture to make a superabsorbent polymer. |
| US08476187B2 |
Process for preparing catalyst powder
The present invention details a process for producing a catalyst powder. The steps of the process include preparing catalyst slurry, drying, pyrolyzing, and calcining the catalyst slurry to obtain a calcined catalyst powder. The catalyst slurry comprises a catalyst, a liquid carrier, a templating agent, and a catalyst substrate. The catalyst slurry is dried to obtain a raw catalyst powder. The raw catalyst powder is heated in a first controlled atmosphere to obtain a pyrolyzed catalyst powder and the pyrolyzed catalyst powder is calcined in a second controlled atmosphere to obtain a calcined catalyst powder. A method of fabricating a catalyst surface and catalytic converter using the prepared catalyst powder is also illustrated. |
| US08476179B2 |
Grain boundary-insulated semiconductor ceramic, semiconductor ceramic capacitor, and method for producing semiconductor ceramic capacitor
A grain boundary-insulated semiconductor ceramic contains a SrTiO3-based compound as a main component, and a diffusing agent containing a grain boundary insulating agent and a glass component. The grain boundary insulating agent is composed of a material free of lead, the glass component mainly contains a SiO2—X2O-MO—TiO2-based glass material that does not contain boron or lead and in which X represents an alkali metal, and M represents at least one of barium, strontium, and calcium, and the content of the glass component is 3 to 15 parts by weight relative to 100 parts by weight of the grain boundary insulating agent. A component base is composed of the grain boundary-insulated semiconductor ceramic. |
| US08476177B2 |
Highly refractive and highly transparent optical glass
The optical glass has a refractive index nd of 1.945≦nd≦1.97, an Abbe number νd of 33≦νd≦36, and a composition with the following components in amounts expressed in % of their cations, with respect to the total number of cations in the composition: B3+, 35-46; La3+, 25-35; Ta5+, 6-14; W6+, 6-13; Zr4+, 1-7; Gd3+, 0-5; Nb5+, 0-4; Y+3, 0-4; Ba2+, 0-2; Σ alkaline earth metal cations, 0-2, Σ La3++Ta3++W6++Zr4++Gd3++Nb5++Y3+≧50; and at least one fining agent, 0-0.3. Also a ratio of B3+ to La+3 is 1.1 to 1.6 and a ratio of B3+ to Σ Si+4+B3+ is ≧0.5. The glass is free of lead, arsenic, Ti4+, Th4+, Zn2+, F−, and Hf+4. |
| US08476176B2 |
Phosphate glass, fluorophosphate glass, preform for precision press-molding, optical element and process for the production of thereof
A fluorophosphate glass having a fluorine content of 25% or more by anionic %, which is produced from a glass raw material containing 0.1 to 0.5%, by anionic %, of a halide containing a halogen element selected from chlorine, bromine or iodine, and a phosphate glass having a fluorine content of less than 25% by anionic %, which is produced from a glass raw material containing 0.1 to 5%, by anionic %, of a halide containing a halogen element selected from chlorine, bromine or iodine. |
| US08476174B2 |
Glass and glass-ceramics
There is provided a lithium ion conductive glass-ceramics which is dense, contains few microvoids causing the decrease in lithium ion conductivity, and achieves good lithium ion conductivity. A glass-ceramics which comprises at least crystallines having an LiTi2P3O12 structure, the crystallines satisfying 1 |
| US08476173B2 |
Laminate material for absorbent articles and method for its manufacture
Laminate material having a first liquid-permeable material layer and discretely-arranged material pieces of a second liquid-permeable material, wherein the material layer and the discrete material pieces are joined internally. The laminate material also has a second liquid-permeable material layer joined to the first liquid-permeable material layer and the discretely-arranged material pieces. |
| US08476172B2 |
Knitted fabric that is electrically conductive in a biaxial manner
An electrically conductive knitted fabric comprising stitched rows of an electrically non-conductive ground thread (1), and of stitched rows of an electrically conductive thread (2) placed therebetween. In addition, a number of rows of an electrically non-conductive ground thread can alternate with one or more rows of comprising electrically conductive thread. A connection overlapping the rows comprising electrically non-conducting thread exists in places between the rows comprising electrically conductive thread. |
| US08476171B2 |
Heat treatment method of ZnTe single crystal substrate and ZnTe single crystal substrate
The present invention is to provide a heat treatment method for effectively eliminating Te deposits in a ZnTe single crystal substrate, and a ZnTe single crystal substrate having an optical characteristic suitable for use of a light modulation element and having a thickness of 1 mm or more. A heat treatment method of a ZnTe single crystal substrate, includes: a first step of increasing a temperature the ZnTe single crystal substrate to a first heat treatment temperature T1, and retaining the temperature of the substrate for a predetermined time; and a second step of gradually reducing the temperature of the substrate from the first heat treatment temperature T1 to a second heat treatment temperature T2 lower than the heat treatment temperature T1 with a predetermined rate, wherein the first heat treatment temperature T1 is set in a range of 700° C.≦T1≦1250° C. and the second heat treatment temperature T2 is set in a range of T2≦T1−50. |
| US08476170B2 |
Method of forming pattern, method of manufacturing semiconductor device, and method of manufacturing template
According to one embodiment, a pattern formation method includes, before forming a circuit pattern on a substrate using imprinting, a wall pattern with a predetermined height is formed to surround the periphery of an area serving as imprint shots on the substrate in each imprint shot and to allow the imprint shots to be separated from one another. The circuit pattern is formed in the imprint shots surrounded by the wall pattern through imprinting. |
| US08476167B2 |
Lithographic apparatus and method of manufacturing an electrostatic clamp for a lithographic apparatus
The invention relates to a method of manufacturing an electrostatic clamp configured to electrostatically clamp an article to an article support in a lithographic apparatus. The method includes providing a first layer of material, etching a recess in the first layer of material, and disposing an electrode in the recess of the first layer of material. |
| US08476163B2 |
Semiconductor device and manufacturing method therefor
A method for manufacturing a semiconductor device includes providing a substrate having a first surface and a second surface, the second surface is on the opposite side of the substrate facing away from the first surface. The method further includes forming a first portion of an opening by etching a portion of the substrate from the first surface, forming a buffer layer on an inner surface of the first portion, etching a bottom of the buffer layer to expose an area of the underlying substrate, and etching the exposed area of the substrate to form a second portion of the opening. The method also includes performing an isotropic etching on the second portion of the opening to obtain a flask-shaped opening and filling the opening with a filling material. The method also includes partially removing a portion of the second surface and the filling material from the second portion of the opening. |
| US08476162B2 |
Methods of forming layers on substrates
Methods for forming layers on a substrate are provided herein. In some embodiments, methods of forming layers on a substrate disposed in a process chamber may include depositing a barrier layer comprising titanium within one or more features in the substrate; and sputtering a material from a target in the presence of a plasma formed from a process gas by applying a DC power to the target, maintaining a pressure of less than about 500 mTorr within the process chamber, and providing up to about 5000 W of a substrate bias RF power to deposit a seed layer comprising the material atop the barrier layer. |
| US08476160B2 |
Sublithographic patterning employing image transfer of a controllably damaged dielectric sidewall
A first low dielectric constant (low-k) dielectric material layer is lithographically patterned to form a recessed region having expose substantially vertical sidewalls, which are subsequently damaged to de-carbonize a surface portion at the sidewalls having a sublithographic width. A second low-k dielectric material layer is deposited to fill the recessed region and planarized to exposed top surfaces of the damaged low-k dielectric material portion. The damaged low-k dielectric material portion is removed selective to the first and second low-k dielectric material layers to form a trench with a sublithographic width. A portion of the pattern of the sublithographic-width trench is transferred into a metallic layer and optionally to an underlying dielectric masking material layer to define a trench with a sublithographic width, which can be employed as a template to confine the widths of via holes and line trenches to be subsequently formed in an interconnect-level dielectric material layer. |
| US08476158B2 |
Method of preparing and storing GaN substrate, prepared and stored GaN substrate, and semiconductor device and method of its manufacture
A GaN substrate storage method of storing, within an atmosphere in which the oxygen concentration is not greater than 15 vol. % and the water-vapor concentration is not greater than 20 g/m3, a GaN substrate (1) having a planar first principal face (1m), and whose plane orientation in an arbitrary point (P) along the first principal face (1m) and separated 3 mm or more from the outer edge thereof has an off-inclination angle Δα of −10° or more, 10° or less with respect to the plane orientation of an arbitrarily designated crystalline plane (1a) that is inclined 50° or more, 90° or less with respect to a plane (1c), being either the (0001) plane or the (000 1) plane, through the arbitrary point. In this way a method of storing GaN substrates whose principal-face plane orientation is other than (0001) or (000 1), with which semiconductor devices of favorable properties can be manufactured is made available. |
| US08476152B2 |
N-type carrier enhancement in semiconductors
A method includes epitaxially growing a germanium (Ge) layer onto a Ge substrate and incorporating a compensating species with a compensating atomic radius into the Ge layer. The method includes implanting an n-type dopant species with a dopant atomic radius into the Ge layer. The method includes selecting the n-type dopant species and the compensating species in such manner that the size of the Ge atomic radius is inbetween the n-type dopant atomic radius and the compensating atomic radius. |
| US08476151B2 |
Method for manufacturing nitride semiconductor crystal layer
According to one embodiment, a method is disclosed for manufacturing a nitride semiconductor crystal layer. The method can include forming the nitride semiconductor crystal layer having a first thickness on a silicon crystal layer. The silicon crystal layer is provided on a base body. The silicon crystal layer has a second thickness before the forming the nitride semiconductor crystal layer. The second thickness is thinner than the first thickness. The forming the nitride semiconductor crystal layer includes making at least a portion of the silicon crystal layer incorporated into the nitride semiconductor crystal layer to reduce a thickness of the silicon crystal layer from the second thickness. |
| US08476150B2 |
Methods of forming a semiconductor device
A method and structure for a semiconductor device, the device including a handle wafer, a diamond layer formed directly on a front side of the handle wafer, and a thick oxide layer formed directly on a back side of the handle wafer, the oxide of a thickness to counteract tensile stresses of the diamond layer. Nitride layers are formed on the outer surfaces of the diamond layer and thick oxide layer and a polysilicon is formed on outer surfaces of the nitride layers. A device wafer is bonded to the handle wafer to form the semiconductor device. |
| US08476147B2 |
SOI substrate and manufacturing method thereof
A bond substrate is irradiated with ions, so that an embrittlement layer is formed, then, the bond substrate is bonded to a base substrate. Next, a part of a region of the bonded bond substrate is heated at a temperature higher than a temperature of the other part of the region of the bond substrate, or alternatively, a first heat treatment is performed on the bonded bond substrate as a whole at a first temperature; and a second heat treatment is performed on a part of a region of the bonded bond substrate at a second temperature higher than the first temperature, so that separation of the bond substrate proceeds from the part of the region of the bond substrate to the other part of the region of the bond substrate in the embrittlement layer. Accordingly, a semiconductor layer is formed over the base substrate. |
| US08476141B2 |
High performance dielectric stack for DRAM capacitor
A method for fabricating a DRAM capacitor stack is described wherein the dielectric material is a multi-layer stack formed from a highly-doped material combined with a lightly or non-doped material. The highly-doped material remains amorphous with a crystalline content of less than 30% after an annealing step. The lightly or non-doped material becomes crystalline with a crystalline content of equal to or greater than 30% after an annealing step. The dielectric multi-layer stack maintains a high k-value while minimizing the leakage current and the EOT value. |
| US08476140B2 |
High-performance diode device structure and materials used for the same
A diode and memory device including the diode, where the diode includes a conductive portion and another portion formed of a first material that has characteristics allowing a first decrease in a resistivity of the material upon application of a voltage to the material, thereby allowing current to flow there through, and has further characteristics allowing a second decrease in the resistivity of the first material in response to an increase in temperature of the first material. |
| US08476135B2 |
Integrated circuit packaging system with vertical interconnects and method of manufacture thereof
A method of manufacture of an integrated circuit packaging system includes: providing a base carrier having a base carrier hole from a base carrier interconnection side to a base carrier device side; mounting a base integrated circuit over the base carrier; forming an encapsulation over the base carrier covering the base integrated circuit, the encapsulation having an encapsulation top side and having an encapsulation hole directly over the base carrier hole; and forming an interconnection structure as a single integral structure through the base carrier hole and the encapsulation hole, the interconnection structure directly on the encapsulation top side and directly on the base carrier interconnection side. |
| US08476134B2 |
Method of manufacturing super-junction semiconductor device
A method of manufacturing a super-junction semiconductor device includes growing an alternating conductivity type layer epitaxially on a heavily doped n-type semiconductor substrate, the alternating conductivity type layer including n-type and p-type semiconductor regions arranged alternately and repeated such that n-type and p-type regions are adjoining each other, and arranged to extend perpendicular to the substrate's major surface. The method includes forming a first trench having a predetermined depth in the surface portion of n-type semiconductor region; forming an n-type thin layer on the inner surface of the first trench; and burying gate electrode in the space surrounded by the n-type thin layer with a gate insulator film interposed between a gate electrode and the n-type thin layer. |
| US08476133B2 |
Method of manufacture and structure for a trench transistor having a heavy body region
A trenched field effect transistor is provided that includes (a) a semiconductor substrate, (b) a trench extending a predetermined depth into the semiconductor substrate, (c) a pair of doped source junctions, positioned on opposite sides of the trench, (d) a doped heavy body positioned adjacent each source junction on the opposite side of the source junction from the trench, the deepest portion of the heavy body extending less deeply into said semiconductor substrate than the predetermined depth of the trench, and (e) a doped well surrounding the heavy body beneath the heavy body. |
| US08476132B2 |
Production method for semiconductor device
It is intended to provide a method of producing a semiconductor device, comprising the steps of: providing a substrate on one side of which at least one semiconductor pillar stands; forming a first dielectric film to at least partially cover a surface of the at least one semiconductor pillar; forming a conductive film on the first dielectric film; removing by etching a portion of the conductive film located on a top surface and along an upper portion of a side surface of the semiconductor pillar; forming a protective film on at least a part of the top surface and the upper portion of the side surface of the semiconductor pillar; etching back the protective film to form a protective film-based sidewall on respective top surfaces of the conductive film and the first dielectric film each located along the side surface of the semiconductor pillar; forming a resist pattern for forming a gate line in such a manner that at least a portion of the resist pattern is formed on the top surface of the semiconductor pillar by applying a resist and using lithography; and partially removing by etching the conductive film using the resist pattern as a mask while protecting, by the protective film-based sidewall, the portions of the conductive film and the first dielectric film each located along the side surface of the semiconductor pillar, to form a gate electrode and a gate line extending from the gate electrode. |
| US08476131B2 |
Methods of forming a semiconductor device with recessed source/design regions, and a semiconductor device comprising same
In one example, a method disclosed herein includes forming a gate electrode structure for a PMOS transistor and a gate electrode structure for a NMOS transistor, forming a plurality of cavities in the substrate proximate the gate electrode structure of the PMOS transistor and performing an epitaxial deposition process to form raised silicon-germanium regions is the cavities. The method concludes with the step of performing a common etching process on the PMOS transistor and the NMOS transistor to define recessed regions in the substrate proximate the gate electrode structure of the NMOS transistor and to reduce the amount of the silicon-germanium material positioned above the surface of the substrate for the PMOS transistor. |
| US08476128B2 |
Semiconductor device having insulated gate field effect transistors and method of fabricating the same
A CMOSFET is composed of a P-channel MOSFET and an N-channel MOSFET formed on a silicon substrate. The P-channel MOSFET is formed a first gate insulating film, a first hafnium layer and a first gate electrode which are stacked on the silicon substrate. The N-channel MOSFET is formed a second gate insulating film, a second hafnium layer and a second gate electrode which are stacked on the silicon substrate. A surface density of the second hafnium layer is lower than a surface density of the first hafnium layer. |
| US08476123B2 |
Method for manufacturing thin film transistor array panel
A method for manufacturing a thin film transistor array panel includes forming a gate line; forming an insulating layer on the gate line; forming first and second silicon layers first and second metal layers; forming a photoresist pattern having first and second portions; forming first and second metal patterns by etching the first and second metal layers; processing the first metal pattern with SF6 or SF6/He; forming silicon and semiconductor patterns by etching the second and first silicon layers; removing the first portion of the photoresist pattern; forming an upper layer of a data wire by wet etching the second metal pattern; forming a lower layer of the data wire and an ohmic contact by etching the first metal and amorphous silicon patterns; forming a passivation layer including a contact hole on the upper layer; and forming a pixel electrode on the passivation layer. |
| US08476121B2 |
Organic thin film transistors and methods of making them
The present invention provides a method of manufacturing an organic thin film transistor (TFT), comprising: providing a substrate layer; providing a gate electrode layer; providing a dielectric material layer; providing an organic semiconductor (OSC) material layer; providing a source and drain electrode layer; and wherein one or more of the layers is deposited using a laser induced thermal imaging (LITI) process. Preferably the organic TFT is a bottom gate device and the source and drain electrodes are deposited on an organic semiconductor layer, or over a dielectric material layer using LITI. Further preferably a dopant material may be provided between the OSC material and the source and drain electrode layer, wherein the dopant material may also be deposited using LITI. Also preferably, wherein the dopant may be a charge neutral dopant such as substituted TCNQ or F4TCNQ. |
| US08476120B2 |
Semiconductor device and method of forming three-dimensional vertically oriented integrated capacitors
A semiconductor device includes conductive pillars disposed vertically over a seed layer, a conformal insulating layer formed over the conductive pillars, and a conformal conductive layer formed over the conformal insulating layer. A first conductive pillar, the conformal insulating layer, and the conformal conductive layer constitute a vertically oriented integrated capacitor. The semiconductor device further includes a semiconductor die or component mounted over the seed layer, an encapsulant deposited over the semiconductor die or component and around the conformal conductive layer, and a first interconnect structure formed over a first side of the encapsulant. The first interconnect structure is electrically connected to a second conductive pillar, and includes an integrated passive device. The semiconductor device further includes a second interconnect structure formed over a second side of the encapsulant opposite the first side of the encapsulant. |
| US08476117B2 |
Methods and apparatus for a stacked-die interposer
An improved stacked-die package includes an interposer which improves the manufacturability of the package. A semiconductor package includes a package substrate having a plurality of bond pads; a first semiconductor device mounted on the package substrate, the first semiconductor device having a plurality of bond pads provided thereon; an interposer mounted on the first semiconductor device, the interposer having a first interposer bond pad and a second interposer bond pad, wherein the first and second interposer bond pads are electrically coupled; a second semiconductor device mounted on the interposer, the second semiconductor device having a plurality of bond pads provided thereon; a first bond wire connected to one of the plurality of bond pads on said first semiconductor and to the first interposer bond pad; and a second bond wire connected to the second interposer bond pad and to one of the plurality of bond pads on the semiconductor device. |
| US08476114B2 |
Housing for an optoelectronic component, optoelectronic component, and method for producing a housing for an optoelectronic component
A method for making a housing for an optoelectronic component is disclosed. The housing has a plastic base body that has a front side with an assembly region for at least one radiation emitting or radiation detecting body. The plastic base body is formed from at least one first plastic component and at least one second plastic component. The second plastic component is disposed on the front side of the plastic base body, and is formed from a material that differs from the first plastic component in at least one optical property, and forms an optically functional region of the plastic base body. |
| US08476111B2 |
Integrated circuit packaging system with intra substrate die and method of manufacture thereof
A method of manufacture of an integrated circuit packaging system includes: providing a substrate having a through hole; mounting an integrated circuit in the through hole, the integrated circuit having an inactive side and a vertical side; connecting a first interconnect in direct contact with the integrated circuit and the substrate; applying a wire-in-film adhesive around and above the integrated circuit leaving a portion of the vertical side and the inactive side exposed and covering a portion of the first interconnect; and mounting a chip above the integrated circuit and in direct contact with the wire-in-film adhesive. |
| US08476104B1 |
Sodium species surface treatment of thin film photovoltaic cell and manufacturing method
A method for forming a thin film photovoltaic device. The method includes providing a transparent substrate comprising a surface region, forming a first electrode layer overlying the surface region, forming a copper layer overlying the first electrode layer and forming an indium layer overlying the copper layer to form a multi-layered structure. The multi-layered structure is subjected to a thermal treatment process in an environment containing a sulfur bearing species to forming a copper indium disulfide material. The copper indium disulfide material comprising a copper-to-indium atomic ratio ranging from about 1.2:1 to about 2:1 and a thickness of substantially copper sulfide material having a copper sulfide surface region. The thickness of the copper sulfide material is selectively removed to expose a surface region having a copper poor surface comprising a copper to indium atomic ratio of less than about 0.95:1. The method subjects the copper poor surface to a sodium species to convert the copper poor surface from an n-type semiconductor characteristic to a p-type semiconductor characteristic. A window layer is formed overlying the copper indium disulfide material. |
| US08476103B2 |
Methods of fabricating organic thin film transistors
Disclosed is a method for forming banks during the fabrication of electronic devices incorporating an organic semiconductor material that includes preparing an aqueous coating composition having at least a water-soluble polymer, a UV curing agent and a water-soluble fluorine compound. This coating composition is applied to a substrate, exposed using UV radiation and then developed using an aqueous developing composition to form the bank pattern. Because the coating composition can be developed using an aqueous composition rather than an organic solvent or solvent system, the method tends to preserve the integrity of other organic structures present on the substrate. Further, the incorporation of the fluorine compound in the aqueous solution provides a degree of control over the contact angles exhibited on the surface of the bank pattern and thereby can avoid or reduce subsequent surface treatments. |
| US08476100B2 |
Method of forming thin film solar cell and structure thereof
A method of forming thin film solar cell includes the following steps. A substrate is provided, and a plurality of first electrodes are formed on the substrate. A printing process is performed to print a light-absorbing material on the substrate and the first electrodes to form a plurality of light-absorbing patterns. Each of the light-absorbing patterns corresponds to two adjacent first electrodes, partially covers the two adjacent first electrodes, and partially exposes the two adjacent first electrodes. A plurality of second electrodes are formed on the light-absorbing patterns. |
| US08476099B2 |
Methods for improved adhesion of protective layers of imager microlens structures by forming an interfacial region
Methods, structures, and design structures for improved adhesion of protective layers of imager microlens structures are disclosed. A method of fabricating a semiconductor structure includes forming an interfacial region between a microlens and a protective oxide layer. The interfacial region has a lower concentration of oxygen than the protective oxide layer. |
| US08476095B2 |
Diode energy converter for chemical kinetic electron energy transfer
An improved diode energy converter for chemical kinetic electron energy transfer is formed using nanostructures and includes identifiable regions associated with chemical reactions isolated chemically from other regions in the converter, a region associated with an area that forms energy barriers of the desired height, a region associated with tailoring the boundary between semiconductor material and metal materials so that the junction does not tear apart, and a region associated with removing heat from the semiconductor. |
| US08476093B2 |
Method of manufacturing a display substrate
A method of manufacturing a display substrate includes forming a common electrode line, a gate line, a data line and a switching element connected to the gate and data lines on an insulation substrate. A first pixel electrode and an insulation layer are sequentially formed on the insulation substrate. A first photoresist pattern having a first hole and a second hole is formed from a first photoresist layer on the insulation substrate. A first transparent electrode layer is coated on the insulation substrate. A second photoresist layer is coated on the insulation substrate. The second photoresist layer is exposed and developed to form a second photoresist pattern remaining in the first hole and the second hole. The first transparent electrode layer is patterned using the second photoresist pattern, to form a second pixel electrode. |
| US08476092B2 |
Fabricating method of a thin film transistor substrate for liquid crystal display device of minimizing defects due to static electricity
According to an embodiment, there is provided a fabricating method for a thin film transistor substrate divided into a display area displaying images and a non-display area beside the display area, the fabricating method comprising: forming a gate wire in the display area, a common voltage line for a MPS (mass production system) test in the non-display area, and a grounding line for the MPS test in the non-display area with same material at the same time; forming a gate insulating layer covering the gate wire and a first insulating layer covering the common voltage line for the MPS test and the grounding line for the MPS test with same material at the same time; forming a data wire crossing the gate wire and defining a pixel area in the display area; and forming a pixel electrode in the pixel area and an electrode layer on the first insulating layer corresponding to the common voltage line for the MPS test and the grounding line for the MPS test with same material at the same time. |
| US08476089B2 |
Method for manufacturing light emitting diode package
A method for manufacturing an LED package, comprising steps of: providing a substrate, the substrate forming a plurality of spaced rough areas on a surface thereof, each of the rough areas forming a rough structure thereon, a block layer being provided on a remaining part of the surface of the substrate relative to the rough areas; forming a metal layer on a top surface of each rough structure; forming a reflector on the substrate, the reflector defining a cavity and surrounding two adjacent metal layers; arranging an LED chip in the cavity, the LED chip electrically connecting to the two adjacent metal layers; forming an encapsulation layer in the cavity to seal the LED; and separating the substrate from the metal layers, the encapsulation layer and the reflector. |
| US08476088B2 |
Light emitting diode having improved light emission efficiency and method for fabricating the same
Provided is a light emitting diode (LED) having improved light emission efficiency, which can effectively overcome a technical limit of the related art by implementing a surface plasma resonance effect as well as reducing a layer defect such as threading dislocations in an LED structure. |
| US08476086B2 |
Semiconductor device and method of its manufacture
Method of high-yield manufacturing superior semiconductor devices includes: a step of preparing a GaN substrate having a ratio St/S—of collective area (St cm2) of inversion domains in, to total area (S cm2) of the principal face of, the GaN substrate—of no more than 0.5, with the density along the (0001) Ga face, being the substrate principal face, of inversion domains whose surface area where the polarity in the [0001] direction is inverted with respect to the principal domain (matrix) is 1 μm2 or more being D cm−2; and a step of growing on the GaN substrate principal face an at least single-lamina semiconductor layer to form semiconductor devices in which the product Sc×D of the area Sc of the device principal faces, and the density D of the inversion domains is made less than 2.3. |
| US08476081B2 |
Assay for evaluating affinity and specificity of ligand-albumin binding
A method for identifying a ligand or compound which binds to albumin comprises the steps of contacting a reaction mixture comprising a site-specific probe and albumin in the presence and the absence of the ligand or compound and measuring either dissociation constant KD, inhibitor concentration IC50 or fluorescence displacement; whereby a change in KD, IC50 and/or fluorescence in the presence of the ligand or compound is indicative of the ligand or compound binds to albumin. |
| US08476079B2 |
Reagents for reducing leukocyte interference in immunoassays
Methods and devices for reducing interference from leukocytes in an analyte immunoassay are provided. In one embodiment, a method is provided comprising the steps of amending a biological sample such as a whole blood sample with one or more leukocidal reagents that reduce or eliminate the metabolic activity of leukocytes, and performing an immunoassay on the amended sample to determine the concentration of analyte in the sample. Preferably, the sample is amended with one or more enzymes and optionally one or more enzyme substrates and cofactors. |
| US08476078B2 |
Cassette for sample preparation
A cassette for preparing a sample is disclosed herein. The cassette includes a housing, which encloses the structures and the processes used to prepare the sample. |
| US08476077B2 |
Urine and serum biomarkers associated with diabetic nephropathy
Disclosed is use of urine and serum biomarkers in diagnosing diabetic nephropathy, staging diabetic nephropathy, monitoring diabetic nephropathy progress, and assessing efficacy of diabetic nephropathy treatments. These biomarkers include urine precursor alpha-2-HS-glycoprotein, urine alpha-1 antitrypsin, urine alpha-1 acid glycoprotein, urine osteopontin, serum osteopontin, their fragments, and combinations thereof. |
| US08476075B2 |
Analytical technique for measuring bound glycerides in a biodiesel composition
A method of estimating the amount of unreacted starting materials (glycerides, methyl esters, etc.) and the composition of a biodiesel using TLC in conjunction with a lipophilic dye, Nile Red is described herein. The dye based TLC method of the present invention is convenient and provides significant advantages over existing methods for estimating the purity of a biodiesel composition. |
| US08476073B2 |
Automatic analyzing apparatus and quality control method for analysis supporting liquid in the same
An automatic analyzing apparatus can properly determine a quality of an analysis supporting liquid, after being supplied to the automatic analyzing apparatus, which supports an analysis performed in the automatic analyzing apparatus and can properly maintain an accuracy of the analysis. The analysis supporting liquid which supports an analysis of a specimen is dispensed into a reaction vessel by using a specimen dispensing unit which dispenses the specimen, a reagent dispensing unit which dispenses a reagent, a cleaning unit which cleans the reaction vessel, or a diluted solution dispensing unit which dispenses a diluted solution. An optical measurement is performed with respect to a liquid including the dispensed analysis supporting liquid in the reaction vessel. Analysis data of the analysis supporting liquid is generated by using the measured result. The quality of the analysis supporting liquid is determined by comparing the generated analysis data with reference data. |
| US08476070B2 |
Media for culturing stem cells
Well-defined, xeno-free culture media which comprise a TGF-beta isoform or the chimera formed between IL6 and the soluble IL6 receptor (IL6RIL6), which are capable of maintaining stem cells, and particularly, human embryonic stem cells, in an undifferentiated state are provided. Also provided are cell cultures comprising the culture media and the stem cells and methods of expanding and deriving embryonic stem cells in such well-defined, xeno-free culture media. In addition, the present invention provides methods of differentiating ESCs or EBs formed therefrom for the generation of lineage specific cells. |
| US08476063B2 |
Microfluidic devices
Methods and devices for the interfacing of microchips to various types of modules are disclosed. The technology disclosed can be used as sample preparation and analysis systems for various applications, such as DNA sequencing and genotyping, proteomics, pathogen detection, diagnostics and biodefense. |
| US08476061B1 |
Methods for isolation, use and analysis of ferritin
This invention provides methods of isolating ferritin from plant and animal material. The isolated ferritin can be administered to humans or animals in need of iron, and can be used to treat or supplement iron deficiency. The isolated ferritin can be used in industrial applications, such as increasing the iron content in heat-processed food or beverages. The methods of the invention also include quantitation of iron derived from plant or animal ferritin. |
| US08476058B2 |
Probiotic yeast compositions and methods for inflammatory diseases
The invention relates to novel yeast strains, to the yeasts resulting from these strains, to a composition containing at least one Saccharomyces cerevisiae yeast and/or derivatives of a yeast having a particular interest as a food additive and/or probiotic and/or functional food and/or neutraceutic and/or functional ingredient and/or cosmeceutical and/or pharmaceutical active agent. The invention also relates to the use of the same in human and/or animal nutrition, or for the treatment or prevention of inflammatory diseases. |
| US08476053B2 |
Stabilized aqueous alpha-galactosidase composition and methods relating thereto
The present invention provides an aqueous composition comprising a protein with enzymatic activity of alpha-galactosidase. The present invention further provides a method of stabilizing an aqueous composition comprising a protein with enzymatic activity of alpha-galactosidase, and a method of preparing a purified aqueous composition comprising the protein with enzymatic activity of alpha-galactosidase. |
| US08476048B2 |
Xylose utilizing zymomonas mobilis with improved ethanol production in biomass hydrolysate medium
Xylose-utilizing, ethanol producing strains of Zymomonas mobilis with improved performance in medium comprising biomass hydrolysate were isolated using an adaptation process. Independently isolated strains were found to have independent mutations in the same coding region. Mutation in this coding may be engineered to confer the improved phenotype. |
| US08476046B2 |
Method of pre-treating and saccharifying algae biomass
Disclosed is a method of pre-treating and saccharifying an algae biomass, by dehydrating the algae biomass to have a water content of about 10% to about 70% by weight, cutting the algae biomass having a water content of about 10% to about 70% by weight to a predetermined size, and saccharifying the cut algae biomass using a hydrolysis catalyst and/or a hydrolase to yield a monosaccharide. |
| US08476041B2 |
Glucose transport mutants for production of biomaterial
A method is disclosed for restoring a Glu+ phenotype to a PTS−/Glu− bacterial cell which was originally capable of utilizing a phosphotransferase transport system (PTS) for carbohydrate transport. Bacterial cells comprising the Glu+ phenotype have modified endogenous chromosomal regulatory regions which are operably linked to polynucleotides encoding galactose permeases and glucokinases. |
| US08476037B2 |
Method for screening of antiviral agents
A method for screening for an antiviral agent capable of blocking a viral viroporin by determining whether a test agent can rescue expression of a fragment of a viral viroporin in a Single Protein Production system of Escherichia coli is provided. |
| US08476032B2 |
Complement factor H-based assays for serum bactericidal activity against Neisseria meningitidis
Assays for detection of bactericidal anti-Neisserial antibodies using a factor H polypeptide having a human amino acid sequence that mediates binding to Neisserial factor H binding protein (fHBp) are provided, as well as non-human animal models of Neisserial infection. |
| US08476026B2 |
Biomarkers of ovarian cancer
The invention is directed to assays for biomarkers associated with ovarian cancer that can be used diagnostically. It includes glass or plastic plates or slides on which the biomarkers have been immobilized and kits containing these plates or slides. |
| US08476024B2 |
Botulinum neurotoxin a protein receptor and uses thereof
The invention relates to an isolated polypeptide of the luminal domain of synaptic vesicle glycoprotein 2C of Homo sapiens wherein at least 70 percent of the amino acid sequence is identical to the amino acid sequence of the SV2C of Homo sapiens. The polypeptide binds the HC fragment of botulinum neurotoxin A provided that the polypeptide is not the synaptic vesicle glycoprotein 2C of Homo sapiens. |
| US08476020B1 |
BRCA2 mutations and use thereof
Genetic variants in the BRCA2 gene are disclosed which are useful as diagnosis biomarkers. |
| US08476013B2 |
Processes and compositions for methylation-based acid enrichment of fetal nucleic acid from a maternal sample useful for non-invasive prenatal diagnoses
Provided are compositions and processes that utilize genomic regions differentially methylated between a mother and her fetus to separate, isolate or enrich fetal nucleic acid from a maternal sample. The compositions and processes described herein are useful for non-invasive prenatal diagnostics, including the detection of chromosomal aneuplodies. |
| US08476012B2 |
Physiogenomic method for predicting metabolic and cardiovascular side effects of thiazolidinediones
Disclosed herein are genetic markers related to the efficacy and/or safety of thiazolidinedione therapy identified by a physiogenomic methodology that correlates the genetic markers with a physiological response. The genetic markers described herein were not previously associated with the efficacy and/or safety of thiazolidinedione therapy. The markers related to safety are those associated with the important side effects of BMI increase and development of edema. In one embodiment, markers related to efficacy of thiazolidinedione therapy are associated with glycosylated hemoglobin. Method of assessing an individual for markers associated with the safety and/or efficacy of thiazolidinedione therapy are described. |
| US08476010B2 |
Propofol formulations with non-reactive container closures
A sterile pharmaceutical composition for parenteral administration of propofol, said composition comprising propofol, optionally albumin, and less than about 10% by weight solvent for propofol, wherein said composition is stored in a container having a closure wherein said closure is inert to propofol. |
| US08476009B2 |
Methods for detecting enveloped virus infections by measuring cell surface TSG101
The invention involves the detection of virally infected cells by antibodies or antibody fragments which selectively bind to TSG101. TSG101 is on the surface of mammalian cells, and thus available for detection by antibodies, during viral budding—a phenomenon wherein viral particles escape a virally infected cell after propagation in that cell, so as to infect other cells. To achieve budding, a protein, TSG101 is “hijacked” and misdirected to, or mis-expressed on, the surface of the infected cell. Antibodies can be used to selectively detect such infected cells. Certain TSG101 antibodies may provide therapeutic benefit when administered to infected mammals. |
| US08476004B2 |
Method for forming photoresist patterns
A method for forming photoresist patterns includes providing a substrate, forming a bi-layered photoresist on the substrate, and performing a photolithography process to pattern the bi-layered photoresist. The bi-layered photoresist includes a first photoresist layer and a second photoresist layer positioned between the first photoresist layer and the substrate. The first photoresist layer has a first refraction index and the second photoresist layer has a second refraction index, and the second refraction index is larger than the first refraction index. |
| US08476003B2 |
Iterative rinse for semiconductor fabrication
An iterative rinse for fabrication of semiconductor devices is described. The iterative rinse includes a plurality of rinse cycles, wherein each of the plurality of rinse cycles has a different resistivity. The plurality of rinse cycles may include a first rinse of a semiconductor substrate with de-ionized (DI) water and carbon dioxide (CO2), followed by a second rinse the semiconductor substrate with DI water and CO2. The first rinse has a first resistivity; the second rinse has a second resistivity lower than the first resistivity. |
| US08476002B2 |
Methods of forming patterned masks
Some embodiments include methods in which spaced-apart first features are formed from a first material having a reflow temperature. Second material is formed along sidewalls of the first features, and third material is formed over the second material and the first features. The third material may be formed at a temperature above the reflow temperature of the first material, and the second material may support the first features so that the first features do not collapse even though they are exposed to such temperature. In some embodiments the third material has an undulating topography. Fourth material may be formed within the valleys of the undulating topography, and subsequently the first features may be removed together with at least some of the third material to leave a pattern comprising second features formed from the second material and pedestals formed from the fourth material. |
| US08476000B2 |
Method of producing a relief image from a liquid photopolymer resin
A method of producing a relief image from a liquid photopolymerizable resin, said method comprising the steps of: a) placing a coverfilm onto an exposure glass; b) casting a liquid photopolymerizable resin layer onto the coverfilm; c) laminating a substrate to a backside of the liquid photopolymerizable resin layer as the liquid photopolymerizable resin layer is being cast onto the coverfilm; d) placing an image or film negative on top of the substrate; and e) exposing the liquid photopolymerizable resin layer through the image or film negative from the backside of the liquid photopolymerizable resin layer to selectively crosslink and cure the photopolymerizable resin layer and form a cured relief image, wherein said depth of the cured relief image is less than the height of the cast liquid photopolymerizable resin. |
| US08475999B2 |
Compound and photoresist composition containing the same
The present invention provides a compound represented by the formula (C1): wherein Rc2 represents a C6-C10 aromatic hydrocarbon group having at least one nitro group and Rc1 represents a group represented by the formula (1): wherein Rc4 represents a hydrogen atom etc., Rc5 represents a C1-C30 divalent hydrocarbon group, and Rc3 represents a group represented by the formula (3-1), (3-2) or (3-3): wherein Rc6, Rc7, Rc8, Rc9, Rc10, Rc11, Rc12, Rc13 and Rc14 each independently represent a C1-C30 hydrocarbon group, and a photoresist composition comprising a resin, an acid generator and the compound represented by the formula (C1). |
| US08475998B2 |
Compound synthesis method, microarray, acid-transfer composition, and biochip composition
A compound synthesis method includes bonding a first compound to a substrate to form a first film. A second film is formed on the first film using an acid-transfer composition including (A) a polymer that includes a structural unit shown by a following formula (1) and a structural unit shown by a following formula (2), (B) a photoacid generator shown by a following formula (3), and (C) a sensitizer shown by a following formula (4). The second film is exposed to remove the protecting group from the first compound under an exposed area of the second film. An acid generated in the exposed area of the second film is transferred to the first film. The second film after being exposed is removed. A second compound is bonded to the first compound from which the protecting group has been removed. |
| US08475997B2 |
Resist composition for immersion exposure, method of forming resist pattern, and fluorine-containing polymeric compound
A resist composition for immersion exposure including: a fluorine-containing polymeric compound (F) containing a structural unit (f1) having a base dissociable group and a structural unit (f2) represented by general formula (f2-1) (wherein R represents a hydrogen atom, a lower alkyl group or a halogenated lower alkyl group; and W is a group represented by any one of general formulas (w-1) to (w-4)); a base component (A) that exhibits changed solubility in an alkali developing solution under the action of acid; and an acid generator component (B) that generates acid upon exposure. |
| US08475995B2 |
Toner having core-shell structure and method of preparing the same
A toner has a core-shell structure including a toner core portion having a resin with an active hydrogenactive hydrogen containing group, a colorant and at least one additive, and a toner shell portion surrounding the toner core portion, wherein the toner shell portion includes a cross-linked resin prepared by reaction of at least a portion of the active hydrogen containing group and the cross-linking agent. |
| US08475991B2 |
Transparent toner and image forming method
A transparent toner for forming a glossy surface is disclosed, wherein a critical surface tension of a glossy surface formed by the transparent toner at 20° C. is at least 50 mN/m, and the transparent toner comprises a resin composed of a polymer formed by employing at least a polymerizable monomer containing a carboxylic group (—COOH). An image forming method employing the transparent tone is also disclosed. |
| US08475988B2 |
Resin-filled ferrite carrier core material for electrophotographic developer, ferrite carrier and electrophotographic developer using the ferrite carrier
Disclosed are a resin-filled ferrite carrier core material for an electrophotographic developer, including a porous ferrite particle, wherein the composition of the porous ferrite particle is represented by the following formula (1), and part of (MgO) and/or (Fe2O3) in the following formula (1) is replaced with SrO; a ferrite carrier obtained by filling a resin in the voids of the ferrite carrier core material; and an electrophotographic developer using the ferrite carrier: ( MgO ) x ( Fe 2 O 3 ) y ( x = 10 mol % or more and less than 25 mol % y = exceeding 75 mol % and 90 mol % or less x + y = 100 mol % ) . ( 1 ) |
| US08475972B2 |
Fuel cell
A fuel cell stack comprising a second metal separator set to have an external dimension larger than a first metal separator, wherein the second metal separator comprises, formed integrally, a first seal member in contact with the peripheral edge of a first electrolyte membrane/electrode structure, a second seal member in contact with the peripheral edge of the first metal separator, and a third seal member in contact with the peripheral edge of an adjoining fourth metal separator. Since the first seal member, the second seal member and the third seal member are integrally formed on one surface of the second separator or one surface of the first separator, a seal-forming step can be carried out at one effort, simply and economically. In addition, use of a triple seal structure containing the first through the third seal members can favorably improve the sealing feature of reaction gas and minimize reaction gas leakage. |
| US08475970B2 |
Fluoroesin-coated polymer film for reinforcing polymer electrolyte membrane, reinforced polymer electrolyte membrane, and membrane electrode assembly
Disclosed is a fluororesin-coated polymer film for reinforcing a polymer electrolyte membrane, wherein the fluororesin-coated polymer film is fabricated by forming on at least one side of a polymer film a coating of a reaction product of (A) a fluorine-containing copolymer composed of a fluoroolefin, a cyclohexyl group-containing acrylic ester, and a hydroxyl group-containing vinyl ether, and (B) a crosslinking agent having two or more isocyanate groups. The polymer film according to the present invention not only exhibits sufficiently high initial adhesion strength, with respect to the polymer electrolyte membrane, but also retains thereafter high adhesion strength in actual operating environments. |
| US08475967B2 |
Membrane/electrode assembly for polymer electrolyte fuel cell and process for producing cathode for polymer electrolyte fuel cell
To provide a membrane/electrode assembly for polymer electrolyte fuel cells, capable of achieving high power generation performance under low or no humidity operation conditions, and a process for producing a cathode for polymer electrolyte fuel cells. A membrane/electrode assembly 10, comprising: an anode 20 having a catalyst layer 22 and a gas diffusion layer 28, a cathode 30 having a catalyst layer 32 and a gas diffusion layer 38, and a polymer electrolyte membrane 40 interposed between the catalyst layer 22 of the anode 20 and the catalyst layer 32 of the cathode, wherein the cathode 30 has, between the catalyst layer 32 and the gas diffusion layer 38, a first interlayer 36 comprising carbon fibers (C1) and a fluorinated ion exchange resin (F1), and a second interlayer 34 comprising carbon fibers (C2) and a fluorinated ion exchange resin (F2), in this order from the gas diffusion layer 38 side. |
| US08475966B2 |
Apparatus and method of recovering vapors
An apparatus and method is disclosed for recovering a flammable vapor emanating from a vent of a tank. The apparatus comprises an input conduit for connecting to the vent of the tank. An input manifold connects the input conduit to an input of a compressor with an output manifold connecting an output of the compressor to an input of a storage tank. An output conduit connects an output of the storage tank to the turbine generator for generating electrical power by processing the flammable vapor. An electrical connector directs electrical power from the turbine generator to drive the apparatus as well as to supply surplus power to an external load. |
| US08475965B2 |
Fuel cell power generation system with valve on raw material gas supply passage and valve downstream of carbon monoxide decreasing unit, and method for operating fuel cell power generation system
The fuel cell power generation system includes a fuel cell, a reformer, a carbon monoxide decreasing unit, a first raw material supply source, a first valve which is provided to a first raw material flow passage, a second valve which is provided downstream of the carbon monoxide decreasing unit, a second raw material supply source which supplies a raw material to the inside of a flow passage which is closed by the first valve and the second valve from downstream of the carbon monoxide decreasing unit, and a control unit which controls the first valve and the second valve, wherein the control unit, after the first valve and the second valve are closed, supplies the raw material fed from the second raw material supply source to the inside of the flow passage closed by the first valve and the second valve at the time of stopping the system. |
| US08475963B2 |
Lithium microbattery and fabrication method thereof
The microbattery is formed by a stack of solid thin layers on a substrate which, starting from the substrate, successively comprises a first electrode, a solid electrolyte and a second electrode/current collector assembly. A first surface and a second surface of the electrolyte are respectively in contact with a main surface of the first electrode and a main surface of the second electrode/current collector assembly. The dimensions of the main surface of the first electrode are smaller than the dimensions of the main surface of said assembly, and the dimensions of the first surface of the solid electrolyte are smaller than the dimensions of the second surface of the solid electrolyte. The solid electrolyte is furthermore not in contact with the substrate. |
| US08475960B2 |
Anode material for lithium-ion chemical power sources and method of obtaining thereof
An anode material is based on lithium-titanium spinel that contains doping components, chromium and vanadium, in equivalent quantities, of the chemical formula Li4Ti5-2y(CryVy)O12-x, where x is the deviation from stoichiometry within the limits 0.02 |
| US08475956B2 |
Polyradical compound-conductive material composite, method for producing the same, and battery using the same
An exemplary embodiment provides: a composite of an electrode active material and an electric conductivity-imparting agent, which has a high capacity density and can produce a large current; a method for producing it; and a battery which has a high energy density and can produce a large output. Specifically, a polyradical compound as the electrode active material and a conductive material are heated and mixed at a temperature of not less than the softening temperature of the polyradical compound and less than the decomposition temperature thereof to form a composite of the polyradical compound and the conductive material. Fabricating an electrode using the composite can provide a novel battery having a high energy density and a large output. |
| US08475954B2 |
Flexible voltage nested battery module design
Exemplary embodiments of the present invention provide flexible, multi-voltage battery modules having multiple cells that are nested together. The cells can be, for example, cylindrical lithium ion cells. To increase cell package density, the cells can be disposed in a nested configuration so that adjacent cell centers form equilateral triangles. The cells can be placed in a housing or case with interlocking tabs that allow multiple modules to be connected together. Within a module, the cells can be connected in different configurations by buss bars at the top and the bottom of the battery cells. The different configurations may provide different voltages for the module. |
| US08475953B2 |
Energy storage unit for a motor vehicle
An energy store for a motor vehicle for storage and emission of electrical energy as required, having a multiplicity of cells which are positioned one above the other and/or alongside one another like an array, wherein each cell is surrounded by a first material, wherein a second material is positioned between the cells which are surrounded by the first material and form a cell array, and wherein heat exchanging ribs are positioned at edges of the cell array. |
| US08475952B2 |
Battery module and battery pack using the same
The battery module includes: a plurality of batteries; a housing 50 in which the plurality of batteries are aligned and stored; and a cooling pipe 70 provided along the plurality of batteries in the housing 50, the cooling pipe 70 being filled with a cooling medium, wherein the cooling pipe 70 is made of a material which melts when the temperature of the battery reaches or exceeds a predetermined temperature. |
| US08475949B2 |
Method for manufacturing magnetic recording medium and magnetic recording medium
A magnetic recording medium is presented that includes protruded magnetic patterns formed on a substrate, and a nonmagnetic material filled in recesses between the magnetic patterns in which an oxygen concentration thereof is higher at a surface side than at a substrate side. The nonmagnetic material is at least one selected from the group consisting of Si, SiC, SiC—C, SiOC, SiON, Si3N4, Al, AlxOy, Ti and TiOx. |
| US08475948B2 |
Magnetic recording medium for thermally assisted recording
A magnetic recording medium suppresses an anticipated decline in performance due to heating of the lubricant layer and protective layer in thermally assisted recording, and has superior durability and reliability. The magnetic recording medium comprises a layer stack comprising, in order on a nonmagnetic substrate, at least a magnetic recording layer, adiabatic layer, carbon-based protective layer, and lubricant layer. |
| US08475947B2 |
Perpendicular magnetic recording medium
A perpendicular magnetic recording medium, which includes a first magnetic recording layer, a second magnetic recording layer, and a third magnetic recording layer disposed sequentially on a nonmagnetic substrate, and a coupling layer formed between the first and second magnetic recording layers. The first, second and third magnetic recording layers have an easy axis of magnetization in a direction perpendicular to a film plane of the nonmagnetic substrate. The first and second magnetic recording layers are ferromagnetically coupled via the coupling layer. |
| US08475945B2 |
Composite article including silicon oxycarbide layer
A composite article includes a substrate, at least one protective layer on the substrate and an intermediate layer between the at least one protective layer and the substrate. The intermediate layer includes dense silicon oxycarbide. |
| US08475942B2 |
Hard-coating-coated member, tool, and target
A member covered with a hard coating having good wear resistance, a tool using the member, and a target for forming the hard coating are provided. A hard-coating-coated member has a hard coating on a substrate, in which the hard coating has a composition of (TiaCrbAlcSidYeRf)(CyNz), the R being at least one element selected from Ho, Sm, Dy and La, and when the subscripts a, b, c, d, e, f, y and z denote atomic ratios respectively, 0.05≦a≦0.3, 0.05≦b≦0.3, 0.4≦c≦0.65, 0≦d≦0.05, 0≦e≦0.05, 0.005≦f≦0.05, a+b+c+d+e+f=1, 0≦y≦0.3, 0.7≦z≦1, and y+z=1 are satisfied. |
| US08475934B2 |
Flame-retardant timber materials
The present invention relates to timber materials rendered flame-retardant by using halogen-free organophosphorus compounds, to means and processes for producing these materials, and also to their use. |
| US08475929B2 |
Barrier film and laminated material, container for wrapping and image display medium using the same, and manufacturing method for barrier film
A laminated material having a barrier film containing a barrier layer on at least one surface of a substrate film that is a silicon oxide film having an atomic ratio in a range of Si:O:C=100:140 to 167:20 to 40, peak position of infrared-ray absorption due to Si—O—Si stretching vibration between 1060 to 1090 cm−1, a film density in a range of 2.6 to 2.8 g/cm3, and a distance between grains of 30 nm or shorter. |
| US08475927B2 |
Tin-doped indium oxide fine particle dispersion, method for manufacturing the same, interlayer film for laminated glass with heat ray blocking properties formed by using said dispersion, and laminated glass therewith
A dispersion of tin-doped indium oxide fine particles has tin-doped indium oxide fine particles, a plasticizer for an interlayer film, an organic solvent containing alcohols as a main component, and a dispersion stabilizer, wherein under measuring conditions of a concentration of tin-doped indium oxide fine particles of 0.7% by weight and an optical path length of a glass cell of 1 mm, a visible light transmittance is 80% or more, a solar radiation transmittance at a wavelength within a range from 300 nm to 2100 nm is ¾ or less of the visible light transmittance, a haze value is 1.0% or less, and a reflection yellow index is −20 or more. |
| US08475921B2 |
Composite material, composite material substrate, composite material dispersed fluid, and manufacturing methods thereof
A composite material includes an aggregate which contains a first metal particle constituting a core and second metal oxide particulates surrounding the first metal particle and having an average primary particle diameter ranging from 1 to 100 nm. |
| US08475912B2 |
Coating composition for forming low-refractive-index layer, antireflective film using the same, and image display device including the antireflective film
A coating composition for forming a low-refractive-index layer includes a first fluorine compound represented by Formula 1 below, (CH2═CR1COO)2Rf Formula 1 and a reactive silicon compound, a (meth)acrylate compound, a polymerization initiator, and a solvent. The first fluorine compound represented by Formula 1, the reactive silicon compound, the (meth)acrylate compound, the polymerization initiator, and the solvent may each be different from one another, and in Formula 1, Rf may be a C1-19 perfluoro group, and R1 may be a hydrogen atom or a methyl group. |
| US08475910B2 |
Edge stiffened polymeric corrugated sheet material
Edge stiffened corrugated polymeric sheet material can be utilized as storm panels for mounting about a perimeter surface of an opening so as to protect the opening from wind and impact loads. The panels can include a corrugated sheet material having a corrugated contiguous band horizontally extending at about an end of the top and the bottom, wherein the corrugated contiguous band is complementary and contiguous to the plurality of corrugations of the corrugated sheet panel. The complementary and contiguous corrugated band can be configured to sandwich the sheet material. The panel may also include, individually or in combination, a contiguous band sandwiching the polymeric sheet material at a terminal end of each side and extending vertically from the top to the bottom. The panels provide wind and impact load protection for the opening. |
| US08475908B2 |
3D embossing
An embossing roll for producing fibrous products, has a structurized embossing surface suitable to run against an anvil roll. The structurized embossing surface includes male protrusions or female depressions starting from a base circumferential surface of the roll. The embossing pattern is characterized by the following features: the base areas of selected male protrusions or female depressions in the base circumferential surface are different; the heights or depths of selected male protrusions or selected female depressions in a radial direction of the roll and starting from the base circumferential surface are different; and the angles between sidewall sections and the adjacent base circumferential surface of selected male protrusions and/or female depressions are different. |
| US08475902B2 |
Optical recording medium
A multilayer optical recording medium in which, as a recording layer is located farther from a surface of incidence of a light beam for reading, the amount of light that reaches the surface of incidence after being reflected off the recording layer is smaller. |
| US08475898B2 |
Polyolefin resin blends for crack-resistant pipe
Resin blends useful for pipe and blow-molded articles are disclosed. The blends comprise a low-molecular-weight, high-density polyethylene and a high-molecular-weight, low-density ethylene copolymer. The high-molecular-weight component is made with a bridged indenoindolyl Group 4 metal complex having open architecture. Blends of the invention uniquely have high molecular weight (Mw>200,000) and low levels of long-chain branching. A quick, convenient approach for estimating levels of long-chain branching in polyethylenes from gel permeation chromatography and dynamic oscillatory rheometry (“viscosity enhancement factor”) is disclosed. |
| US08475891B2 |
Embossed release paper and process for producing the same
This invention provides an embossed release paper that has high heat resistance and embossing properties. The embossed release paper comprises a paper base material, an ionizing radiation-cured resin layer, and a heat-cured silicone layer stacked in that order, the embossed release paper having embosses. The embossed release paper has high heat resistance and thus is suitable for use in synthetic leather production and melamine decorative sheet production that involve surface emboss pattern formation. |
| US08475890B2 |
Colored material coated transparent chip for artificial stone, method of preparing same, and artificial stone including same
The present invention provides transparent chips with natural metal-like texture by coating silica-containing transparent chips with colored material, such as a metal powder, in a transparent resin as a base resin. The present invention also provides artificial stone with natural metal-like texture and patterns by mixing the colored material coated transparent chips and inorganic filler with a matrix resin. The artificial stone of the present invention can be prepared by mixing about 4 to about 24 parts by weight of inorganic filler and about 0.1 to about 5.0 parts by weight of the colored material coated transparent chips, per about 1 part by weight of the matrix resin. The colored material coated transparent chips can have a specific gravity of about 2.0 to about 2.65, while the matrix resin can have a specific gravity of about 2.2 to about 2.8, and the specific gravity of the transparent chips can be equal to or lower than the specific gravity of the matrix resin in promote uniform distribution of the transparent chips in the matrix resin. |
| US08475887B2 |
Optically isotropic liquid crystal medium, and optical device
A liquid crystal medium having a wide temperature range of a liquid crystal phase, a large optical anisotropy, and a large dielectric anisotropy and having an optically isotropic liquid crystal phase is provided. The liquid crystal medium is characterized by containing a liquid crystal compound having a pyrimidine ring and a linking group —CF2O— and a chiral dopant, and exhibiting an optically isotropic liquid crystal phase. |
| US08475885B2 |
Method of forming organic film, and organic film, nozzle plate, inkjet head and electronic device
The method of forming an organic film, includes: an organic film formation step of forming an organic film on a surface of a base member using a silane coupling agent; and a post-processing step including a water vapor introduction step of holding the base member on which the organic film has been formed in an atmosphere containing at least water vapor, and a dehydration processing step of holding the base member in an atmosphere having a smaller presence of water vapor than the atmosphere in the water vapor introduction step. |
| US08475879B1 |
Polymer nanocomposites with improved resistance to ionizing radiation
Polymer nanocomposites with improved resistance to high energy ionizing radiation. Certain embodiments involve methods for providing a nanocomposite material with resistance to high energy ionizing radiation using nanodiamond, zinc oxide and mixtures of these nanoparticles with other nanoparticles dispersed within the matrix. Other embodiments relate to methods of delivering and dispersing the nanoparticles through the material or a surface layer. Other embodiments include methods of forming chemical bonds between the nanoparticles and the material. This abstract is not to be considered limiting, since other embodiments may deviate from the features described in this abstract. |
| US08475872B2 |
Patterning of thin film layers
Simplified patterning of layers of a thin film is disclosed. In some embodiments, the patterning can include patterning a first conductive layer using a patterned dielectric layer as a mask and patterning a second conductive layer using a patterned passivation layer as another mask. In other embodiments, the patterning can include patterning a first conductive layer using a removable photosensitive layer as a mask, patterning a black mask layer using a removable photo mask, and patterning a second conductive layer using a patterned passivation layer as another mask. In still other embodiments, the patterning can include patterning a first conductive layer using a patterned black mask layer as a mask and patterning a second conductive layer using a patterned passivation layer as another mask. An exemplary device utilizing the thin film so patterned can include a touch sensor panel. |
| US08475869B2 |
Selective nanoparticle assembly systems and methods
Disclosed are methods and systems for transferring dry or semi-dry nanoparticles onto a substrate. In one embodiment, this includes the steps of providing a roller comprising an elastomeric stamp; transferring nanoparticles in a dry or semi-dry state, and which contact the surface of a donor substrate, from the donor substrate onto the elastomeric stamp; and depositing the dry or semi-dry nanoparticles from the elastomeric stamp onto a receiver substrate by rolling the elastomeric stamp onto the receiver substrate. The substrate, in other embodiments, can have a relief structure. |
| US08475864B1 |
Method for removing an oxidized off-flavor from milk
A method of reversing the formation of an oxidized off-flavor in milk that includes providing milk, and heating the milk to a temperature between approximately 70° C. and approximately 90° C. for a period of between approximately 25 seconds and approximately 60 seconds. |
| US08475862B2 |
Isothiocyanate preservatives and methods of their use
A composition for preserving solid food products comprising a moisture-sensitive isothiocyanate compound and a hygroscopic carrier, wherein the composition is substantially free of sorbic acid, benzoic acid, and salts thereof. Also disclosed is a solid food product containing the aforementioned preservative composition and a method for preserving solid food products including the steps of adding a moisture-sensitive isothiocyanate to the solid food product and storing the resulting product at a reduced temperature. |
| US08475861B2 |
Process and installation for making a restructured meat article, device for compacting meat fragments and device for compressing an unfinished meat article
In the process, at least one piece of meat is destructured by fragmenting it, and the meat fragments are transformed into a restructured meat article. The fragments are transformed into a restructured meat article by: forming a block of meat fragments by cohesive compaction of the meat fragments; removing at least a portion of the block, termed a preform; and compressing the preform between complementary surfaces for molding the preform. The meat fragment compacting device comprises two conveyor belts for cohesive compaction of the meat fragments, the belts converging from upstream to downstream relative to a direction of movement of the meat fragments. The device for compressing a preform for a meat article comprises pistons having surfaces for molding the preform, which surfaces vary from one piston to another. |
| US08475860B2 |
Method and system for preparing a liquid extract from a cell using centrifugal forces
A method for preparing a liquid comestible from a cell by passing liquid through the substance using centrifugal forces, wherein gas contained in the cell is controllably purged from the cell as liquid fills the cell. In one embodiment, the method includes prewetting the substance in the cell by filling liquid in the cell and rotating the cell at a first rotational speed; and then extracting the liquid comestible from the cell in an extraction phase which comprises continuing to fill liquid into the cell and rotating the cell at a second rotational speed that is higher than the first rotational speed. The invention also discloses a cell for use in these methods which cell includes a filter for preventing solids from being carried by gas during the gas purge. |
| US08475859B2 |
Coffee dispensing device and method
A coffee dispensing device is provided with a transport device that couples various components for the processing of unroasted coffee beans together. For example a roaster may be coupled to a grinding and brewing device to enable the transfer of roasted coffee beans between the roaster and grinder/brewer. Also, the transport device may transfer the roasted coffee beans from a roaster to an output port so that roasted coffee beans may be obtained. An automated coffee transaction device (ACTD) is also provided to automate aspects of the purchasing of coffee. A service delay projection calculator is also provided to estimate the expected wait time of a customer entering a queue. |
| US08475856B2 |
OTG (on the go) specialty multi-beverage container systems
A multi-beverage container and mixing system to increase the convenience of mixing and transporting a variety of powder-based beverages in a single unit. The multi-beverage container employs a lid equipped with compartments designed to house multiple powder drink mixes and a container housing designed to accommodate water for mixing. At user activation, powder drink mix is released from a compartment and is mixed with the water to create the desired beverage for instant consumption by the user. |
| US08475853B2 |
Colour reduction in canola protein isolate
In the recovery of canola protein isolates from canola oil seeds steps are taken to inhibit the formation of coloring components and to reduce the presence of materials tending to form coloring components, to obtain a lighter and less yellow canola protein isolate. |
| US08475851B2 |
Preparations with wood extracts of locust trees
The present invention relates primarily to the use of locust tree (Gleditsia) wood or heartwood extracts as anti-cellulite active substances. The present invention further relates to certain locust-tree wood extracts and mixtures containing locust-tree wood extracts and corresponding cosmetic, dermatological or pharmaceutical preparations, which are suitable in particular for the prevention and treatment of cellulite in humans. |
| US08475846B2 |
Colored micaceous pigments having bismuth oxychloride appearance and performance effects
A combination pigment having a mica and/or metal oxide-coated mica substrate, an absorption colorant coating, and a waxy film bonding the absorption colorant coating to the substrate. |
| US08475844B2 |
Fluoropolymer-based medical implant coating compositions
Polymers of fluorinated monomers and acrylate and alkyl acrylates are disclosed which demonstrate improved performance as coatings for implantable devices. Such coatings may, for example, be used to release a bioactive agent from the medical device. One specific application lies in drug-eluting coatings for stents. |
| US08475843B2 |
Silyl ether-modified hydrophilic polymers and uses for medical articles
Silane-functionalized hydrophilic polymers and polymeric matrices are described. Hydrophilic matrices can be formed from the polymers, and can be used in association with the preparation of implantable and injectable medical devices. Exemplary devices include those having a durable lubricious coating formed from the hydrophilic polymers. |
| US08475836B2 |
Topical patch for pain relief using cooling agent
Topical patch preparations that contain an odorless physiological cooling agent, and methods for using the same are provided. The subject topical patch preparations are made up of an adhesive gel composition that is present on a support, where the adhesive gel composition includes the odorless physiological cooling agent, a water-soluble polymer gel, water and a water holding agent. In using the subject topical patch preparations, the topical patch preparations are applied to a skin surface of a subject and maintained at the site of application for a period of time sufficient for an effective amount of the an odorless physiological cooling agent to be administered to the subject. The subject invention finds use in a variety of applications. |
| US08475835B2 |
Transdermal preparation
Provided is a transdermal preparation, which is capable of long-term (1-day to 7-day) release of a basic drug from a preparation, continuously and at a consistent concentration; shows little reduction over time in the drug content, even if multiple drugs are contained in the preparation; and is produced by a simple process. The transdermal preparation comprises a substrate, and an adhesive layer containing a basic drug and a water-soluble polymer. |
| US08475834B2 |
Method of improving absorption of vitamin E by a pet animal
A method of providing a pet with a benefit relating to effective assimilation of a lipid is described wherein the pet is administered, as a part of, or in addition to its regular diet, an edible composition that contains an ingredient that maintains, promotes or enhances the capacity of the pet to digest lipid efficiently. The invention extends to compositions for use in promoting lipid assimilation in pets, particularly senior or elderly pets. The compositions include pancreatic, liver and intestinal mucosa function-promoters. In embodiments, the liver function-promoter may be selected from taurine, emulsifiers, vitamins, minerals, glutathione and glutathione promoters. |
| US08475833B2 |
Jelly-form preparation and method for producing jelly-form preparation
Provided is a jelly preparation which enables easy intraoral dissolution thereof, easy adjustment of the dissolution time, and stable containment of a drug therein. The jelly preparation of the present invention is a jelly preparation including water, a gelatin, a drug, and a trivalent metal ion. |
| US08475831B2 |
Treatment of ophthalmic conditions
Ophthalmic conditions such as presbyopia, myopia, and astigmatism can be corrected by the use of a molding contact lens in combination with a pharmaceutical composition suitable for delivery to the eye. The molding contact lenses are preferably commercially available and are not specifically designed for orthokeratology. The agents in the pharmaceutical compositions such as hyaluronase allow the cornea of the eye to be molded in order to correct the refractive error of the eye. The contact lenses and the pharmaceutical composition induce a change in the radius of curvature of the anterior surface of the cornea, thereby correcting the refractive error of the eye. One advantage of the inventive technique is that the patient with his or her own individual visual needs guides the treatment until the patient near and far visual needs are met. The present invention also provides for kits, which contain molding contact lenses, pharmaceutical composition suitable for delivery to the eye, and instructions, useful in the inventive system. |
| US08475829B2 |
Implants for the treatment of dopamine associated states
Biodegradable implants comprising dopamine modulating compounds are described. |
| US08475826B2 |
Titanium oxide-organic polymer conjunction suitable for artificial bone
The titanium oxide-organic polymer composite material for artificial bone obtained by forming titania gel on the surface of said base material by titania solution treatment to dip into a solution of 0° C. to 50° C. temperature for from several seconds to 1 week obtained by adding a solution consisting of acidic alcohol and water into alcohol solution of titaniumtetraalcoxide to a base material composed of a polymer compound selected from a group consisting of polyolefin, polyester and nylon, and modifying to a titanium oxide membrane which forms apatite having similar Ca/P atom ratio to an apatite of mammalian's bone in supersaturated aqueous solution to apatite or from a body fluid of mammalian by dipping said base material on the surface of which titania gel is formed into hot water of. 50° C. to 95° C. or solution of room temperature to 95° C. to which acid is added. |
| US08475825B2 |
Cyanoacrylate initiator system
The present invention is directed to curable compositions that comprise a non-porous substrate, one or more cyanoacrylate polymerization initiators and a prepolymer composition comprising at least one liquid cyanoacrylate monomer or mixture of such monomers (solid or liquid) and/or cyanoacrylate oligomers. The non-porous substrate is a collection of individual particulates that are not bound, bonded or fixed to one another. At least one initiator is deposited on the surface of the individual particulates to form a plurality of initiator carriers. The prepolymer composition receives the plurality of initiator carriers to begin a controlled and consistent polymerization or curing of the liquid cyanoacrylate monomer in order to produce a biocompatible adhesive composition for use on living tissue. The present invention also provides for methods of making and using and devices for such a curable compositions, particularly in treating living tissue by applying to living tissue a biocompatible adhesive composition. |
| US08475823B2 |
Baclofen formulation in a polyorthoester carrier
Effective treatments of pain for extended periods of time are provided. The treatments include the administration of one or more drug depots intraspinally wherein the drug depots include an effective amount of baclofen formulated within a polyorthoester. By administration of one or more drug depots, one can relieve pain caused by diverse sources, including but not limited to chronic pelvic pain syndromes, spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discongenic back pain and joint pain, as well as pain that is incidental to surgery. In some embodiments, the relief can be for at least thirty days, at least sixty days, at least one hundred days or at least one hundred and thirty-five days. |
| US08475821B2 |
Bone prosthetic material and method of manufacturing the same
A method of manufacturing a bone prosthetic material, includes by forming tricalcium phosphate (TCP) particle precursor particles; by performing preliminary sintering on the TCP precursor particles at a temperature in a first temperature range to produce TCP particles of diameters in a predetermined diameter range; by granulating the TCP particles to produce granulated bodies; and by performing sintering on the granulated bodies at a temperature in a second temperature range to generate sinter assemblies. The second temperature range is higher than the first temperature range. In the bone prosthetic material manufactured thus, a first space in a range of 100 to 400 μm is formed between adjacent two of a plurality of sintered assemblies. Each of the plurality of sintered assemblies includes tricalcium phosphate (TCP) particles which are subjected to sintering, and a second space in a range of 5 to 100 μm is formed between adjacent two of the TCP particles. The second space communicates with the first space. Each of the plurality of sintered assemblies has a connection portion connecting the TCP particles, and the connection portion has a width in a range of 5 to 20 μm. |
| US08475819B2 |
Cyano anthranilamide insecticides
This invention provides compounds of Formula 1, N-oxides and suitable salts thereof wherein R1 is Me, Cl, Br or F; R2 is F, Cl, Br, C1-C4 haloalkyl or C1-C4 haloalkoxy; R3 is F, Cl or Br; R4 is H; C1-C4 alkyl, C3-C4 alkenyl, C3-C4 alkynyl, C3-C5 cycloalkyl, or C4-C6 cycloalkylalkyl, each optionally substituted with one substituent selected from the group consisting of halogen, CN, SMe, S(O)Me, S(O)2Me, and OMe; R5 is H or Me; R6 is H, F or Cl; and R7 is H, F or Cl. Also disclosed are methods for controlling an invertebrate pest comprising contacting the invertebrate pest or its environment with a biologically effective amount of a compound of Formula 1, an N-oxide thereof or a suitable salt of the compound (e.g., as a composition described herein). This invention also pertains to a composition for controlling an invertebrate pest comprising a biologically effective amount of a compound of Formula 1, an N-oxide thereof or a suitable salt of the compound and at least one additional component selected from the group consisting of a surfactant, a solid diluent and a liquid diluent. |
| US08475815B2 |
Alloplastic injectable dermal filler and methods of use thereof
A composition comprising an alloplastic injectable suspension for use as a dermal filler comprising a biocompatible and pliable material and a physiologically acceptable suspending agent comprising particles of the unsubstituted acrylate/substituted acrylate copolymer with a diameter of less than about 100μ. Methods for making a composition comprising an alloplastic injectable suspension for use as a dermal filler are provided. Methods of augmenting soft tissue to provide long-term reduction of a skin defect and the stimulation of collagen production are also provided. |
| US08475813B2 |
Methods of treatment using a gastric retained gabapentin dosage
A method of treatment for epilepsy and other disease states is described, which comprises delivery of gabapentin in a gastric retained dosage form. |
| US08475812B2 |
Gelatin sponge comprising an active ingredient, its preparation and use
The present invention is directed to a method for manufacturing a cross-linked gelatin sponge having a surface by providing a cross-linked gelatin sponge, wetting the surface of the sponge by applying a sufficient amount of liquid comprising a protein or peptide active ingredient, wherein a sufficient amount of liquid is one that retains the flexibility of the sponge even after drying. The sponge is then dried the sponge to obtain a flexible, dry and ready to use cross linked gelatin sponge having a layer of protein or peptide active ingredient on the surface thereof. |
| US08475810B2 |
Attenuated Salmonella enterica serovar paratyphi a and uses thereof
The present invention is drawn to a live, attenuated S. Paratyphi A strain, a live, attenuated S. Paratyphi A strain comprising a stabilized plasmid expression system, and methods of using these strains. |
| US08475809B2 |
Composition comprising sortase anchored surface proteins of Streptococcus uberis
The present invention provides an immunogenic composition comprising one or more Streptococcus uberis sortase-anchored surface proteins, or an immunogenic part thereof, wherein the composition is capable of eliciting an immune response, when administered to a subject. |
| US08475805B2 |
Methods of reducing concomitant infections in pigs with a PCV2 antigen
The present invention relates to a method for reducing the percentage of concomitant infections in pigs or a herd of pigs caused by pathogens other than PCV2 comprising the step administering to said pig(s) an effective amount of PCV2 antigen or an immunogenic composition comprising PCV2 antigen. It also refers to a method for improving the resistance of pigs against concomitant infections with pathogens other than PCV2, comprising the step administering to said pig(s) an effective amount of PCV2 antigen or an immunogenic composition comprising PCV2 antigen. |
| US08475802B2 |
Peptide sequences and compositions
Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3DLIFLARSALILRGSVAHKSC SEQ ID 4PGIADIEDLTLLARSMVVVRP SEQ ID 5LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein. |
| US08475801B2 |
IgE CH3 peptide vaccine
The present invention relates to the provision of novel immunogens comprising an antigenic IgE peptide preferably linked to an immunogenic carrier for the prevention, treatment or alleviation of IgE-mediated disorders. The invention further relates to methods for production of these medicaments, immunogenic compositions and pharmaceutical compositing thereof and their use in medicine. |
| US08475800B2 |
Phosphorylated derivatives of a U1-70K peptide and their use in the treatment of autoimmune pathologies
Derivatives of the peptide corresponding to the sequence RIHMVYSKRSGKPRGYAFIEY (SEQ ID NO: 1), pharmaceutical compositions, and methods of use thereof are provided. |
| US08475795B2 |
Anti-folate receptor alpha antibodies and uses thereof
Described herein are antibodies, and antigen-binding fragments thereof, that are specific for folate receptor alpha, related polynucleotides, expression vectors, and cells that express the described antibodies. Also provided are methods of using the described antibodies, and antigen-binding fragments thereof, and related kits. Provided herein are also methods for diagnosing cancers, such as breast cancer, thyroid cancer, colorectal cancer, endometrial cancer, fallopian tube cancer, ovarian cancer, or lung cancer, using the described antibodies, and antigen-binding fragments thereof. The methods involve determining the amount of folate receptor alpha in a sample derived from a subject and comparing this level with the level of folate receptor alpha in a control sample or reference sample. |
| US08475794B2 |
Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases
Disclosed herein are compositions and methods of use comprising combinations of anti-CD74 antibodies with a therapeutic agent. The therapeutic agent may be attached to the anti-CD74 antibody or may be separately administered, either before, simultaneously with or after the anti-CD74 antibody. In preferred embodiments, the therapeutic agent is an antibody or fragment thereof that binds to an antigen different from CD74, such as CD19, CD20, CD21, CD22, CD23, CD37, CD40, CD40L, CD52, CD80, IL-6, CXCR4 and HLA-DR. However, the therapeutic agent may an immunomodulator, a cytokine, a toxin or other therapeutic agent known in the art. More preferably, the anti-CD74 antibody is part of a DNL complex, such as a hexavalent DNL complex. Most preferably, combination therapy with the anti-CD74 antibody or fragment and the therapeutic agent is more effective than the antibody alone, the therapeutic agent alone, or the combination of anti-CD74 antibody and therapeutic agent that are not conjugated to each other. Administration of the anti-CD74 antibody and therapeutic agent induces apoptosis and cell death of target cells in diseases in which CD74 is overexpressed, such as solid tumors, B-cell lymphomas or leukemias, autoimmune disease, immune dysfunction disease, type 1 or type 2 diabetes. |
| US08475792B2 |
Molecules with extended half-lives, compositions and uses thereof
The present invention provides molecules, including IgGs, non-IgG immunoglobulins, proteins and non-protein agents, that have increased in vivo half-lives due to the presence of an IgG constant domain, or a portion thereof that binds the FcRn, having one or more amino acid modifications that increase the affinity of the constant domain or fragment for FcRn. Such proteins and molecules with increased half-lives have the advantage that smaller amounts and or less frequent dosing is required in the therapeutic, prophylactic or diagnostic use of such molecules. |
| US08475789B2 |
Products and methods to prevent infections
The present invention relates to products and methods for preventing, ameliorating and/or treating infections and other diseases. In one aspect, the products of the present invention relates to compositions comprising germ free colostrum. In another aspect, the products of the present invention relates to compositions comprising synthetically multimerised immunoglobulins. In a third aspect, the products of the present invention relates to compositions comprising germ free colostrum enriched with synthetically multimerised immunoglobulins. The invention also relates to use of said compositions as a pharmaceutical e.g. for prophylactic or ameliorating treatment of infections and other diseases. In addition the invention comprises methods for production of said compositions. |
| US08475787B2 |
Beneficial effects of bacteriophage treatments
The invention relates to use of one or more bacteriophages in vivo in a human or animal in order to induce sensitivity to chemical antibiotics in bacterial cells, where such susceptibility is heritable, independent of continuing bacteriophage metabolism within those cells, and does not relate to the destruction of a biofilm to induce such sensitivity. |
| US08475785B2 |
Allogeneic cancer cell-based immunotherapy
Cell-based immunotherapy (e.g., immunization or vaccination) may be improved by frequent administration to a human subject of allogeneic cancer cells secreting a modified heat shock protein (e.g., gp96), depletion of B cells in the subject, or both. Antigen (e.g., epitope derived from neoantigen or tumor antigen of allogeneic or syngeneic cancer cells) may induce a specific immune response in the subject. For example, the epitope bound in an immunogenic complex with the secreted heat shock protein may be obtained from allogeneic cancer cells coexpressing both secreted gp96 and antigen, or from syngeneic cancer cells of the subject expressing only antigen. |
| US08475780B2 |
Ion binding polymers and uses thereof
The present invention provides methods and compositions for the treatment of ion imbalances. In particular, the invention provides compositions comprising potassium binding polymers and pharmaceutical compositions thereof. Methods of use of the polymeric and pharmaceutical compositions for therapeutic and/or prophylactic benefits are disclosed herein. Examples of these methods include the treatment of hyperkalemia, such as hyperkalemia caused by renal failure and/or the use of hyperkalemia causing drugs. |
| US08475777B2 |
Silicone emulsions, and methods for the production thereof
Emulsions of high viscosity silicones are prepared by emulsifying a lower viscosity condensable silicone with a partial phosphate ester surfactant, and ripening the emulsion to obtain a higher viscosity silicone dispersed phase without generation of objectional amounts of octaorganocyclotetrasiloxanes. The emulsions are well suited for body care products. |
| US08475775B1 |
Retinoids and use thereof
The present invention provides new retinoid compounds and uses of the compounds in humans and animals for non-neoplastic dermal or inflammatory conditions or disorders. |
| US08475768B2 |
Paramagnetic chelates thereof and their use as contrast agents in magnetic resonance imaging (MRI)
The present invention relates to chelators, in particular to chelators which are capable of forming complexes, i.e. paramagnetic chelates, with paramagnetic metal ions. The invention also relates to said paramagnetic chelates, said paramagnetic chelates linked to other molecules and their use as contrast agents in magnetic resonance imaging (MRI). |
| US08475767B2 |
Anti-trypanosomal peptides and uses thereof
The present invention provides methods of killing, inhibiting the growth, and/or inhibiting the reproduction of kinetoplastid protozoan with hydrophobic signal sequence peptides and compositions including such hydrophobic signal sequence peptides. |
| US08475763B2 |
Method of determining the course of treatment for a patient having adenocarcinoma
A method for detecting antigen associated with adenocarcinoma commences by forming a 124I conjugate of a preferential locator, such as an antibody, and introducing the conjugate into a patient suspected of having adenocarcinoma. Positron emission tomography (PET) scanning of the patient reveals sites of accumulated conjugate, such sites including lymph nodes. The course of treatment of the patient then is determined by the amount of revealed lymph nodes. |
| US08475762B2 |
Method and apparatus to minimize air-slurry separation during gypsum slurry flow
A method and apparatus for providing an evenly mixed additive enhanced gypsum slurry to a web. Calcined gypsum and water are inserted into a mixer through at least one inlet of the mixer. The contents are agitated to form a slurry. The slurry is passed from an outlet of the mixer into a conduit. An additive is introduced into the slurry along a length of the conduit to achieve a flow stream of a slurry/additive mixture. A cross section of the flow stream is expanded in the conduit while not changing direction of the flow stream and a direction of the flow stream is changed while not expanding the cross section of the flow stream and conduit, all prior to the flow steam exiting from an outlet of the conduit. |
| US08475756B1 |
Method for the production of uranium chloride salt
A method for the production of UCl3 salt without the use of hazardous chemicals or multiple apparatuses for synthesis and purification is provided. Uranium metal is combined in a reaction vessel with a metal chloride and a eutectic salt- and heated to a first temperature under vacuum conditions to promote reaction of the uranium metal with the metal chloride for the production of a UCl3 salt. After the reaction has run substantially to completion, the furnace is heated to a second temperature under vacuum conditions. The second temperature is sufficiently high to selectively vaporize the chloride salts and distill them into a condenser region. |
| US08475748B2 |
Metal solvent extraction reagents and use thereof
Reagent compositions, methods for their manufacture and methods of their use are described. In particular, provided are reagent compositions comprising an aldoxime and ketoxime with an alkyl substituent. Also provided are methods of metal recovery using these reagent compositions. |
| US08475744B2 |
Solution bag for apparatus for chemically analyzing blood
The present invention provides a solution bag that is used for medical treatment and stores solution used for an apparatus for analyzing blood chemistry that measures and analyzes the concentrations of electrolytes, the partial pressures of gases, and the concentrations of metabolites or the volume ratio of red blood cells contained in blood. The solution bag for an apparatus for analyzing blood chemistry of the present invention includes: a receptacle that contains a solution; a valve body that is attached to the receptacle and has a through-hole longitudinally formed therein; a valve spool that is disposed in the through-hole of the valve body; and a solution leakage preventing unit that is disposed in the valve spool, in which the valve body has a flow channel and a solution discharging pipe spaced at a predetermined distance from each other. |
| US08475738B2 |
Photocatalytic apparatus and method for injecting microfluidic volumes
Provided is a microfluidic injection device and a method for injecting microfluidic. The microfluidic injection device includes a fluid injection chamber, a gas generation chamber applying pressure to the fluid injection chamber, and a channel connecting the fluid injection chamber to the gas generation chamber. |
| US08475735B2 |
Disposable immunodiagnostic test system
A disposable immunodiagnostic test system tests for marker proteins in a sample and includes intimately contacting passage, protein, and absorbent layers. The passage layer is non-porous and has an aperture therethrough. The protein layer is porous, has combinable proteins immobilized thereon, and enables passage of the sample therethrough. The protein layer has an active surface aligned with the passage layer aperture. The sample is introduced onto the protein layer through the passage layer aperture. In positive results, the marker proteins are bound to the combinable proteins and immobilized relative to the protein layer. In negative results, the sample passes through the protein layer, and is absorbed by the absorbent layer. A housing may also be provided, as may a wash structure. The system may be constructed of combustible materials that produce non-toxic by-products upon incineration, preferably enabling ecologically responsible disposal after diagnostic use of the system. |
| US08475730B2 |
Apparatus for single cell separation and position fixing
The present invention relates to an apparatus for single cell trap and position fixing of the trapped cell thereof, and specifically, it induces cell movement from where fluid flows strongly to where the fluid flows weakly, by injecting pressed air to an air channel to modify a thin film of a vibrator, and therefore to induce the fluid flow. Further, the present invention relates to an apparatus which can fix the cell position as well as minimizing the external stimulation to the cells, wherein single cells are trapped in a region wherein the fluid flows are minimized and their positions are fixed using the effect that the fluid flows induced by the vibrators are offset one another because the vibrators are formed symmetrically one another. |
| US08475729B2 |
Methods for forming honeycomb minireactors and systems
A method of forming a honeycomb reactor or reactor component is disclosed, including the steps of providing a honeycomb structure having cells divided by cell walls, providing an array of cutting tools arrayed in a pattern so as to be able to simultaneously align with a first plurality of the cell walls at a first end of the structure, and cutting the walls of the first plurality, reducing their height. Systems utilizing the reactors or reactor components thus formed are also disclosed. |
| US08475726B2 |
Reactor and apparatus for pyrolyzing waste, especially tyre
A reactor (6) for pyrolysing waste, in particular rubber tires, said reactor comprising a pyrolysis space (68), an inlet port (63) and an outlet port (64) enabling a flow across the pyrolysis space (68) of a heating medium for transferring heat required for the pyrolysis, and a lower discharge port (62) for discharging solid residues of the pyrolysis. The invention is, characterized in that—it comprises a baffle means (65) made of a plate material and enabling a gravitational slipping of the solid residues towards the discharge port (62), which baffle means (65) has openings (66) allowing the flow of the heating medium and is arranged to divide the inner space of the reactor (6) to form an upper pyrolysis space (68) and a lower space and—one of the inlet and outlet ports (63, 64) is in connection with the pyrolysis space (68) and the other one with the lower space. The invention is also an apparatus comprising the above reactor (6). |
| US08475725B1 |
System and method for liquid treatment
A method and energy-efficient apparatus for the treatment of liquids through the joint use of a gas mixture-oxidizing agent and UV radiation. This method uses an excimer UV lamp performing two actions affecting the liquid and changing its properties with UV radiation and the generation of a gas mixture containing strong oxidizing agents for influence on the liquid, disinfection and purification of the liquid being treated from contaminants. The apparatus incorporates energy efficient design features to reduce energy consumption and operational costs, as well as an excimer lamp design that improves performance parameters to surpass and outlast existing devices. Unique electrode designs, cleaning systems, and materials combine to create a state-of-the-art liquid treatment apparatus that exceeds existing industrial analogs and norms. |
| US08475721B2 |
Holding sealer and exhaust gas processing device
A holding sealer for keeping a exhaust gas processing device, in which comprises a sheet member including inorganic fibers, the inorganic fibers are oriented in a predetermined angle except parallel against a direction of a thickness of a sheet member within at least a portion of the sheet member. |
| US08475720B2 |
Method for improving a polymerization reaction by taking out and analysing a sample
The disclosure relates to a device for removing and analyzing a sample from a polymerization reactor including one or more sample conduits for removing a sample from the reactor and transferring the sample to a sample flash tank, whereby the conduits are in communication with the reactor and are provided with at least two sampling valves; a sample flash tank for separating said solid particles and evaporated gas, whereby the sample flash tanks are connected to the conduits and provided with a device for analyzing evaporated gas, and including a sample receiver for purifying the solid particles. The receivers are connected to the sample flash tanks and provided with an apparatus for analyzing the solid particles. The disclosure includes a method for improving a polymerization reaction. |
| US08475719B1 |
Electric censer
An electric censer includes a censer body, a receiving unit and an incense branch. The censer body is a hollow container with an opening defined at a top thereof. The receiving unit is received in the censer body and includes a hollow tube communicating with the opening of the censer body. The incense branch includes a light guiding bar and a light emitting unit positioned on a bottom end the light guiding bar. A top end of the light guiding bar extends outwardly from the opening of the censer body and act as a light outputting side of the incense branch. The position of the light emitting unit is adjustable by pressing or pulling the light guiding bar. |
| US08475718B2 |
Method and apparatus for controlling fecal odors
Methods and apparatus for controlling fecal odors in an enclosed space, such as a pit latrine, include providing an oxidizer, such as a catalytic heater and an optional mechanical ventilation unit, such as an inline fan, both flow connected to a vault (pit) of the latrine. The heater is also connected to a source of fuel, for example, propane. Fresh air is drawn through vents in the latrine housing and thereafter through toilets in the latrine and through the vault, providing oxygen for the reaction. The fan and/or oxidation process draws both fresh air and accompanying odorous compounds directly from the latrine and into the oxidizer wherein the odorous components are substantially destroyed. |
| US08475717B2 |
Explosive or drug detection reporting system
A police tester to detect the presence of a target substance includes a housing adapted to be mounted in a police cruiser; a chemical reservoir insertable into the housing; a test swipe in a disc or an automated cartridge, the test swipe adapted to receive a chemical from the chemical reservoir, the test swipe including one or more chemically treated pads; a camera to capture an image from the test swipe; a processor coupled to the camera to process the image to detect the target substance; and a transmitter coupled to the processor to transmit a test result to a remote computer at a police headquarter. |
| US08475712B2 |
Arrangement for neutralisation or microorganisms
An arrangement for the exposure of a pumpable medium to an electric field. The arrangement comprises, at least two power supplies (100) for the generation of electrical voltage, at least one non-conducting chamber (102) for pumping said pumpable medium, which said at least one chamber (102) is provided with a first (106) and a second electrode plate (108), a control means (104) for controlling said at least two power supplies (100). During control the control means (104), by synchronous control, establishes a series connection between at least two of said at least two power supplies (100), the first electrode plate (106) and the second electrode plate (108). A resulting composite voltage arises between the first (106) and the second electrode plate (108), which resulting composite voltage will result in an electric field between the first (106) and the second electrode plate (108). The pumpable medium is exposed to the electric field. A method for the exposure of a pumpable medium to an electric field is also provided. |
| US08475710B2 |
Cemented carbide body and method
A method of producing a cemented carbide body provides: (1) a grain refiner compound comprising a grain refiner and carbon and/or nitrogen, and, (2) a grain growth promoter, on at least one portion of the surface of a compact of a WC-based starting material comprising one or more hard-phase components and a binder, and then sinters the compact. The invention also relates to a cemented carbide body comprising a WC-based hard phase and a binder phase, wherein at least one part of an intermediate surface zone has a lower average binder content than a part further into the body, and at least one part of an upper surface zone has in average a larger average WC grain size than the intermediate surface zone. The cemented carbide body can be used as a cutting tool insert for metal machining, an insert for a mining tool, or a coldforming tool. |
| US08475708B2 |
Support post clamps for molten metal pumps
An improved post clamp for a molten metal pump includes a support post clamp that supports the weight of a pump superstructure on the top of the support posts. The clamp preferably includes (a) a bottom flange for connecting to the pump superstructure, (b) a cavity for receiving an end of a support post, wherein the end has a top surface, and (c) a top flange for being positioned above the top surface. In operation the top flange rests on the top surface of the support post thereby supporting at least part of the weight of the superstructure. It is preferred that a plurality of support posts and post clamps according to the invention be used with a molten metal pump wherein the top surface of each support post supports some of the weight of the superstructure. Also disclosed are novel support posts that may be used with the post clamp, and a pump in which the post clamp and/or support posts may be used. |
| US08475707B2 |
Method of manufacturing direct reduction iron and reduction firing apparatus
An apparatus and a method of manufacturing direct reduction iron and a reduction firing apparatus. The apparatus has a reduction furnace including a left chamber, a right chamber, a material containing device, a step mechanism, a slag distributing device, a charging device, heating burners, a fume extraction path, a charging device, a material receiving tank and a slag discharging path. The method includes the following steps: distributing and charging the slag in the material containing device; carrying and sending the material containing device through a preheating station, a heating station and a reduction station sequentially. Meanwhile, heating the material to be reduced by a combustion of fuel with the heating burners; discharging the reduced material into the material receiving tank; placing the material device from which the material is discharged into the feeding side of the other chamber, then a next work circulation begins. |
| US08475704B2 |
Fabrication of printhead nozzle plate coating with self cleaning and high drool pressure by electrospinning technique
Exemplary embodiments provide materials and methods for ink jet printhead nozzle plate and related printing apparatus, wherein the ink jet printhead nozzle plate can include a coaxially electrospun layer to provide a low adhesion oleophobic textile surface exhibiting a low sliding angle and a high contact angle with ultra-violet gel ink and/or solid ink. |
| US08475703B2 |
Method of orientating fillers in composite materials
A method is provided of fabricating a composite incorporating fillers. The method includes the steps of depositing the fillers in a matrix material either in a rapid prototyping device or prior to inserting the matrix material into a mold. The mold is positioned at a desired location with respect to an electrical field such that at least a portion of the fillers in the matrix material align in a first direction in response thereto. For producing a heterogeneous composite through a rapid prototyping process, the electrodes are positioned at a desired orientation to align the fillers. Thereafter, at least a portion of the matrix material is cured with desirable filler orientation. The procedure is repeated with the desired filler orientation and distribution being introduced layer by layer within the composite. |
| US08475702B2 |
Imprint device and imprint method
According to one embodiment, first image information of a mold is acquired by irradiating the mold with first light, the mold having an uneven pattern with a shape corresponding to a pattern to be transferred onto a substrate to be processed. The position of the uneven pattern of the mold is adjusted by applying stress to the mold. Second image information is acquired by irradiating the mold whose position is adjusted with the first light. Stress information of the mold whose position is adjusted is measured by comparing the first image information with the second image information. The position adjustment is repeated until the measurement result satisfies a desired condition, and a pattern is formed on the substrate by using the mold whose position is adjusted. |
| US08475699B2 |
Method for rounding edges of openings in a tubular body and a product thereof
A method for rounding at least a part of an edge of an opening in a tubular body formed of thermo-formable material, wherein a mandrel is brought into contact with the edge and the mandrel has a temperature that allows it to permanently deform the material of the tubular body and a product thereof. |
| US08475696B2 |
Method for packaging light emitting diode
A method for packaging a light emitting diode is provided. The steps comprise: providing a material; drying the material; feeding the material into a feeding inlet; and providing a mold with pre-embedded light diodes. The material enters the feeding inlet and is injected into the mold by pressing a screw, allowing the material to combine with the light emitting diode. |
| US08475695B2 |
Ceramic composite with integrated compliance/wear layer
The integral layer provides a ductile interface for attachment locations of a turbine engine component where a metallic surface is adjacent the attachment location. The ductile layer provides a favorable load distribution through the composite at the attachment location, and eliminates the need for a metallic shim. |
| US08475693B2 |
Methods of making substrate structures having a weakened intermediate layer
This invention provides composite semiconductor substrates and methods for fabricating such substrates. The composite structures include a semiconductor substrate, a semiconductor superstrate and an intermediate layer interposed between the substrate and the superstrate that comprises a material that undergoes a structural transformation when subject to a suitable heat treatment. The methods provide such a heat treatment so that the intermediate layer becomes spongy or porous, being filled with numerous micro-bubbles or micro-cavities containing a gaseous phase. The composite semiconductor substrates with structurally-transformed intermediate layers have numerous applications. |
| US08475690B2 |
Diffusing agent composition, method of forming impurity diffusion layer, and solar battery
An embodiment of the present invention relates to a diffusing agent composition used in printing an impurity-diffusing component onto a semiconductor substrate, wherein the diffusing agent composition contains: a hydrolysis product of alkoxysilane (A); a component (B) containing at least one selected from the group consisting of a hydrolysis product of alkoxy titanium, a hydrolysis product of alkoxy zirconium, titania fine particle, and zirconia fine particle; an impurity-diffusing component (C); and an organic solvent (D). |
| US08475689B2 |
Topical composition containing galvanic particulates
A topical composition containing galvanic particulates consisting of a first conductive material that is zinc and a second conductive material that is copper is provided. |
| US08475683B2 |
Yellow-green to yellow-emitting phosphors based on halogenated-aluminates
Disclosed herein are yellow-green and yellow-emitting aluminate based phosphors for use in white LEDs, general lighting, and LED and backlighting displays. In one embodiment of the present invention, the cerium-activated, yellow-green to yellow-emitting aluminate phosphor comprises the rare earth lutetium, at least one alkaline earth metal, aluminum, oxygen, at least one halogen, and at least one rare earth element other than lutetium, wherein the phosphor is configured to absorb excitation radiation having a wavelength ranging from about 380 nm to about 480 nm, and to emit light having a peak emission wavelength ranging from about 550 nm to about 600 nm. |
| US08475681B2 |
Neutron scintillating materials
Neutron scintillating materials are provided, including boron substitution scintillation materials, boron and Li substitution scintillation materials, and Gd-based substitution scintillation materials. |
| US08475677B2 |
Etchant gas
An etchant gas and a method for removing at least a portion of a late transition metal structure. The etchant gas includes PF3 and at least one oxidizing agent, such as at least one of oxygen, ozone, nitrous oxide, nitric oxide and hydrogen peroxide. The etchant gas provides a method of uniformly removing the late transition metal structure or a portion thereof. Moreover, the etchant gas facilitates removing a late transition metal structure with an increased etch rate and at a decreased etch temperature. A method of removing a late transition metal without removing more reactive materials proximate the late transition metal and exposed to the etchant gas is also disclosed. |
| US08475673B2 |
Method and apparatus for high aspect ratio dielectric etch
An apparatus for etching high aspect ratio features is provided. A plasma processing chamber is provided, comprising a chamber wall forming a plasma processing chamber enclosure, a lower electrode, an upper electrode, a gas inlet, and a gas outlet. A high frequency radio frequency (RF) power source is electrically connected to at least one of the upper electrode or lower electrode. A bias power system is electrically connected to both the upper electrode and the lower electrode, wherein the bias power system is able to provide a bias to the upper and lower electrodes with a magnitude of at least 500 volts, and wherein the bias to the lower electrode is pulsed to intermittently. A gas source is in fluid connection with the gas inlet. A controller is controllably connected to the gas source, the high frequency RF power source, and the bias power system. |
| US08475672B2 |
Plasma processing device, plasma processing method and method of manufacturing element including substrate to be processed
The present invention provides a plasma processing device and a plasma processing method that can easily adjust plasma density distribution while making the plasma density uniform, and a method of manufacturing an element including a substrate to be processed. In an embodiment of the present invention, the inside of a vacuum vessel (1) is divided by a grid (4) having communication holes into a plasma generation chamber (2) and a plasma processing chamber (5). On the upper wall (26) of the plasma generation chamber (2), magnetic coils (12) are arranged such that magnetic field lines within the vacuum vessel (1) point from the center of the vacuum vessel (1) to a side wall (27), and, outside the side wall (27) of the plasma generation chamber (2), ring-shaped permanent magnets (13) are arranged such that a polarity pointing to the inside of the vacuum vessel (1) is a north pole and a polarity pointing to the outside of the vacuum vessel (1) is a south pole. |
| US08475669B2 |
System, method and apparatus for master pattern generation, including servo patterns, for ultra-high density discrete track media using e-beam and self-assembly of block copolymer microdomains
A system, method, and apparatus for forming a high quality master pattern for patterned media, including features to support servo patterns, is disclosed. Block copolymer self-assembly is used to facilitate the formation of a track pattern with narrower tracks. E-beam lithography forms a chemical contrast pattern of concentric rings, where the spacing of the rings is equal to an integral multiple of the target track pitch. The rings include regions within each servo sector header where the rings are offset radially by a fraction of a track pitch. Self-assembly is performed to form a new ring pattern at the target track pitch on top of the chemical contrast pattern, including the radial offsets in the servo sector headers. When this pattern is transferred to disks via nanoimprinting and etching, it creates tracks separated by nonmagnetic grooves, with the grooves and tracks including the radial offset regions. |
| US08475668B2 |
Substrate liquid processing apparatus, substrate liquid processing method, and storage medium having substrate liquid processing program stored therein
Provided are a substrate liquid processing apparatus, a substrate liquid processing method, and a computer readable storage medium having a substrate liquid processing program stored therein that can prevent the occurrence of the electrostatic breakdown caused by the discharge of electric charges in a substrate. The substrate liquid processing apparatus processes a circuit-forming surface of the substrate with a chemical liquid. Furthermore, prior to processing the substrate with the chemical liquid, the substrate liquid processing apparatus performs an anti-static process for an surface opposite to the circuit-forming surface of the substrate by an anti-static liquid, thereby emitting the electric charges on the substrate. |
| US08475665B2 |
Nanoparticle filter
Technologies are generally described for a nanoparticle filter and system effective to move a nanoparticle from a fluid to a location. In some examples, the method includes providing the fluid including the nanoparticles. In some examples, the method further includes applying a first light to the fluid to create a first plasmon. In some examples, the first plasmon is effective to aggregate the nanoparticles to generate a nanoparticle aggregation. In some examples, the method includes applying a second light to the fluid to create a second plasmon. In some examples, the second plasmon is effective to move the nanoparticle aggregation to a location. |
| US08475663B2 |
Vessel and method for treating contaminated water
A method for removing immiscible fluid from contaminated water includes at least one chamber; an injection line in fluid communication with an inlet of the one chamber; bubble generation means in fluid communication with the injection line for injecting gas bubbles into the injection line and allowing mixing in the injection line of the gas bubbles and the contaminated water to form an inlet fluid; an inlet weir within the chamber adjacent the inlet; an immiscible fluid weir within the chamber; a trough for collecting the immiscible fluid and allowing the immiscible fluid to flow out of the at least one chamber through an immiscible fluid outlet; and a cleaned water outlet generally at the bottom of the chamber. |
| US08475661B2 |
Asymmetric nanotube containing membranes
This invention relates to heterogenous pore polymer nanotube membranes useful in filtration, such as reverse osmosis desalination, nanofiltration, ultrafiltration and gas separation. |
| US08475659B2 |
Strainers for emergency core cooling systems—ECCS
A strainer wall structure that removes foreign substances from a fluid suctioned into a pipe and a re-circulation pump that is part of an emergency core cooling system (ECCS). The strainer wall structure has an inlet side and an outlet side through which cooling water is introduced and discharged, respectively, and includes a body having an opening in a direction of the inlet side, closed side surfaces, and an outlet port disposed at one of the closed side surfaces. The strainer includes a punched plate filter screen inserted into the opening. A modular cassette apparatus including grooved first filter plates is inserted into the body, and second filter plates having second grooves is inserted into the first grooves. |
| US08475657B2 |
Method and device for filtering liquid in an aquarium
The method and device for filtering liquid in an aquarium, the filtration device made by the liquid filtration method comprises a box-shaped casing, the filtration bodies and filtration materials are set inside the casing, wherein the casing includes a water inlet set around the casing and grid panels set inside both sides of the casing; the filtration bodies include an inner filtration body set inside the grid panels and an outer filtration body set outside the grid panels; the filtration materials are filled inside the casing, between the inner filtration body and grid panels; in this way, the liquid to be filtered enters into the casing through the water inlet and flows out from the grid panels, and proceeds further from the casing via the inner filtration body, filtration materials and outer filtration body treatment. The liquid filtration device has the advantages of being an integrated replacement as a filtration consumable, good universality, convenient installation and maintenance, large filtration area and effective prevention of dirt left after filtration from a backflow. |
| US08475654B1 |
Downspout drain connection and filter
Included in this disclosure is a downspout drain filter for rain gutter downspouts. The downspout drain filer comprises elongated housing having an axis, a top portion, and a bottom portion. A transition portion connects the top portion to the bottom portion. The top portion includes an intake opening, a top portion perimeter, a debris opening, a filter attachment location, and a downspout attachment location. The downspout attachment location includes a flexible collar that defines a downspout attachment location perimeter that is less than the top portion perimeter. The bottom portion includes a flexible collapsible body that extends from the transition portion. A connection end is positioned opposite the transition portion as a part of the bottom portion. A filter is positioned in the top portion to direct debris out the debris opening and to permit liquid to pass to the bottom portion. |
| US08475653B2 |
Water treatment apparatus having meshed tubes provided with cilia and water treatment method using the same
A water treatment apparatus includes a plurality of meshed tubes made of synthetic yarn and provided with cilia; a plurality of tube stack cages containing the meshed tubes; and an aeration diffuser positioned between the tube stack cages and configured to provide air so that to-be-treated influent water moves to the tube stack cages. The hollow interior of the filter media, i.e. meshed tubes, enables water to move in any direction, and the high porosity maximizes the area for filtering of suspended solids and attachment of microorganisms. The resulting efficiency of removal of suspended solids and soluble organic material is far greater than conventional methods. Arrangement of diffusers in the middle of the reaction tank and between the tube stack cages and aeration by them result in perfect mixing in the reaction tank. The load of suspended solids and soluble organic materials is evenly distributed over the entire filer media. |
| US08475639B2 |
Titration device and method
A titration apparatus comprising a titration reservoir for a non-flowing sample solution to be titrated; an ion source reservoir comprising an ion source solution of selected ions; an ion exchange membrane barrier capable of passing ions from the ion source solution to the titration reservoir, but of blocking bulk liquid flow; a first electrode in electrical communication with the ion source reservoir; and a second electrode in electrical communication with the titration reservoir. Also, an electrolytic titrant generator for use in the titration apparatus. |
| US08475638B2 |
Biosensor
In a biosensor that detects introduction of a sample liquid into a specimen supply path using a detecting electrode, a means of improving accuracy of detection is provided. The biosensor has: an electrode system including measuring electrode, counter electrode, and detecting electrode on first electrically insulating support; specimen supply path for introducing the sample liquid; and reagent layer used for quantifying a substrate contained in the sample liquid. The means is characterized in that detecting electrode is spaced from measuring electrode by a distance sufficient for the sample liquid to sufficiently cover measuring electrode before the sample liquid reaches detecting electrode. |
| US08475636B2 |
Method and apparatus for electroplating
An apparatus for electroplating a layer of metal onto the surface of a wafer includes an ionically resistive ionically permeable element located in close proximity of the wafer and an auxiliary cathode located between the anode and the ionically resistive ionically permeable element. The ionically resistive ionically permeable element serves to modulate ionic current at the wafer surface. The auxiliary cathode is configured to shape the current distribution from the anode. The provided configuration effectively redistributes ionic current in the plating system allowing plating of uniform metal layers and mitigating the terminal effect. |
| US08475634B2 |
Application of HIPIMS to through silicon via metallization in three-dimensional wafer packaging
A method of magnetically enhanced sputtering an electrically-conductive material onto interior surfaces of a trench described herein includes providing a magnetic field adjacent to a target formed at least in part from the electrically-conductive material, and applying a DC voltage between an anode and the target as a plurality of pulses. A high-frequency signal is applied to the pedestal supporting the semiconductor substrate to generate a self-bias field adjacent to the semiconductor substrate. The high-frequency signal is applied to the pedestal in pulses, during periods of time that overlap with the periods during which the DC voltage pulses are applied. The periods of time that the high-frequency signals are applied include a duration that extends beyond termination of the DC voltage pulse applied between the anode and the target. During each DC voltage pulse the electrically-conductive material is sputter deposited onto the side walls of the trench formed in the semiconductor substrate. |
| US08475632B2 |
Method for recycling cutting fluid
A method for recycling cutting fluid includes preparing and processing a cutting fluid of silicon including a silicon mixture and a cutting fluid at an anoxic circumstance of 150° C. to 350° C. in a container, to obtain a vaporized cutting fluid and a silicon slurry; and condensing the vaporized cutting fluid to obtain a recycling cutting fluid. |
| US08475631B2 |
Reduction of fiber knots of cellulose crosslinked fibers by using plasma pre-treated pulpsheets
The process of making crosslinked cellulose pulp fiber comprising plasma treating a sheet of cellulose pulp fiber before the sheet is impregnated with a crosslinking formulation which comprises a crosslinking agent and a catalyst, then defiberizing the treated cellulose pulp sheet to form treated defiberized cellulose pulp, then heating and curing the treated defiberized cellulose pulp to form intrafiber crosslinked cellulose pulp fibers. |
| US08475628B1 |
Process and apparatus for orienting bast stalks for decortication
A process and apparatus for orienting a plurality of bast stalks for decortication includes receiving a plurality of harvested bast stalks onto a moving belt. The belt has a longitudinal axis in the direction the belt is moving. The process and apparatus orients a substantial portion of the plurality of harvested bast stalks on the belt so that the harvested bast stalks are generally parallel to the longitudinal axis of the belt. The oriented plurality of bast stalks may be collected for decortication. |
| US08475626B2 |
Multiple connected channel micro evaporator
An evaporator for evaporating a liquid containing fluid, having an inlet and an outlet connected to an evaporation volume with an internal structure, the inlet and the outlet defining a main flow path there between and the cross-section of the evaporation volume is substantially constant along the main flow path is described. A method method for evaporating a liquid containing fluid by providing an evaporator supplying a liquid containing feed stream to the inlet; exerting heat; choosing the operating conditions so that an annular flow is created. |
| US08475624B2 |
Method and system for distributing gas for a bevel edge etcher
A plasma etch processing chamber configured to clean a bevel edge of a substrate is provided. The chamber includes a bottom edge electrode and a top edge electrode defined over the bottom edge electrode. The top edge electrode and the bottom edge electrode are configured to generate a cleaning plasma to clean the bevel edge of the substrate. The chamber includes a gas feed defined through a top surface of the processing chamber. The gas feed introduces a processing gas for striking the cleaning plasma at a location in the processing chamber that is between an axis of the substrate and the top edge electrode. A pump out port is defined through the top surface of the chamber and the pump out port located along a center axis of the substrate. A method for cleaning a bevel edge of a substrate is also provided. |
| US08475618B2 |
Manufacturing method of hermetic container
A manufacturing method of a hermetic container includes an assembling step of assembling the hermetic container and a sealing step of sealing by first and second sealing materials. Thus, in a case where local heating light is scanned toward an already-sealed portion of the second sealing material, since a separation portion of an unsealed state is located between the already-sealed portion and a downstream end of scanning, a load due to expansion/contraction of a frame body is applied to the first sealing material which is present in the separation portion of the unsealed state. After then, since the local heating light is irradiated to the first sealing material to which the load has been applied so as to heat and melt it, the load is relieved, whereby it is possible to suppress deterioration of joining strength and airtightness of the hermetic container. |
| US08475615B2 |
Method for repairing a wall consisting of a plurality of layers
The invention relates to a method for repairing a wall (1), including a plurality of layers (2), each layer including fibers (3) extending in a main direction (4), and having a damaged area (5) over a plurality layers (2). The repair method includes a material removal step comprising making a recessed area (6) encircling the damaged area (5) and comprising a peripheral area (7) including steps (8) and adapted such that each step defines an interface area (9) having a width (10), the dimension of which in the main direction of the fibers of the lower layer adjoining the interface area (9) is greater than the dimension of said width in directions other than the main direction (4), a step of producing a replacement part (12) suitable for obstructing the recessed area, and a step of assembling the replacement part (12) onto the wall. |
| US08475614B2 |
Method for producing a fuel tank provided with internal accessories
Method for producing a fuel tank provided with internal accessories and having a wall made of plastic made in a single piece by moulding a split parison or a parison in at least two parts, said method comprising the following steps: a) the parison is introduced in the heat-softened state into a mould comprising dies; b) a core on which the accessories are placed is introduced inside the parison; c) the parison is pressed onto the dies of the mould; d) the accessories are fastened to the parison with the aid of the core in an ideal layout; e) the core is withdrawn and the mould is closed; f) the tank is moulded from the parison; and g) the tank is removed from the mould. |
| US08475610B2 |
Induction hardening system and method
A system and method of induction heat treating a gear includes a workstation. The workstation has a power source, an inductor coil, and a rotational mechanism. The gear is induction heat treated at a first portion of the gear and a second portion of the gear remains untreated by induction hardening. The gear has an inner surface. The inner surface includes the first portion and the second portion. The first portion has a first width. The second portion has a second width. The inductor coil includes at least one heating loop and at least one non-heating loop. The inductor coil is energized to a predetermined frequency to create an alternating magnetic field, where the alternating magnetic field developed in the heating loop induces an eddy current in the first portion of the gear. |
| US08475609B2 |
Treating Al/Zn-based alloy coated products
A method of treating an Al/Zn-based alloy coated product that includes an Al/Zn-based alloy coating on a substrate is disclosed. The method includes the steps of rapid intense heating of the alloy coating for a very short duration, and rapid cooling of the alloy coating, and forming a modified crystalline microstructure of the alloy coating. |
| US08475608B2 |
Magnesium-based hydrogen storage alloys
Magnesium-based hydrogen storage alloys having metallic magnesium (Mg) and a magnesium-containing intermetallic compound (MgxMy wherein y is 1−x) and containing not less than 60 mass-% of magnesium in total, and having a phase of a primarily crystallized magnesium-containing intermetallic compound in its solidification structure. |
| US08475603B2 |
Self-sanitizing automated condensate drain cleaner and related method of use
The invention is directed toward a system and method for sanitizing a condensate drain to reduce sludge and related pathogens. The system is directed to a sanitizing assembly having a treatment chamber connected to the condensate drain, where the treatment chamber includes a top end and a shaft. A spray assembly is positioned proximate to the top end of the treatment chamber. This spray assembly has a nozzle spray connected to a hot water source. A spray controller within the spray assembly helps disperse a sufficient quantity and pressure of hot water within the shaft to dislodge sludge, when necessary. |
| US08475602B2 |
Substrate cleaning method and apparatus
A substrate cleaning method for cleaning and removing foreign materials adhered to a surface of a substrate includes heating the substrate to peel off the foreign materials from the surface of the substrate by a thermal stress, removing the foreign materials from the surface of the substrate by a temperature gradient created in a proximity of the surface of the substrate, and collecting the foreign materials removed from the surface of the substrate by a collecting unit facing the substrate. |
| US08475600B2 |
Cleaning sheet, transfer member provided with cleaning function, and method for cleaning substrate processing apparatus
A cleaning sheet including a cleaning layer which has a microasperity shape having an arithmetic average roughness Ra of 0.05 μm or less and a maximum height Rz of 1.0 μm or less. Preferably, a substantial surface area of the cleaning layer per a flat surface of 1 mm2 is 150% or more of a substantial surface area of a silicon wafer mirror surface per a flat area of 1 mm2. The cleaning sheet may be provided on at least one surface of a transfer member so that the transfer member has a cleaning function. When the cleaning sheet or the transfer member having a cleaning function is transferred in a substrate processing apparatus in place of a substrate to be processed therein, the cleaning sheet contacts and cleans a site of the substrate processing apparatus. |
| US08475599B2 |
Substrate preparation using stabilized fluid solutions and methods for making stable fluid solutions
A method for making a solution for use in preparing a surface of a substrate is provided. The method includes providing a continuous medium that adds a polymer material to the continuous medium. A fatty acid is adding to the continuous medium having the polymer material, and the polymer material defines a physical network that exerts forces in the solution that overcome buoyancy forces experienced by the fatty acid, thus preventing the fatty acids from moving within the solution until a yield stress of the polymer material is exceeded by an applied agitation. The applied agitation is from transporting the solution from a container to a preparation station that applies the solution to the surface of the substrate. |