最新美国发明专利第2013-07-02期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US08476243B2	Methods and compositions for treating keratin hyperproliferative disorders A method for keratin hyperproliferation disorders such as corns, calluses, or keratosis pilaris (KP) by administering to a subject experiencing the disorder a therapeutically effective amount of an RNA sequence which inhibits expression of a gene encoding for a keratin selected from the group consisting of K6a, K6b, K16, K17, and combinations thereof.
US08476237B2	Compositions and methods for treating cancer by inhibiting the secretion of microparticles Novel peptides that inhibit the release of microparticles from cells are disclosed. Also disclosed are polynucleotides encoding the peptides, expression vectors carrying the polynucleotides and methods for treating tumors using the novel peptides.
US08476236B2	Treatment of skin conditions by Dickkopf1 (DKK1) The present disclosure is generally related to methods of inducing non-palmoplantar skin to develop a palmoplantar phenotype, for example, methods for increasing skin thickness, decreasing skin pigmentation, and/or decreasing hair growth. In particular, disclosed herein are methods of using topical administration of DKK1 to increase skin thickness, decrease skin pigmentation, or reduce hair growth. Also disclosed are topical DKK1 compositions for inducing non-palmoplantar skin to develop a palmoplantar phenotype.
US08476232B2	Method for the production of conjugates of insulin-like growth factor-1 and poly(ethylene glycol) The present invention relates to a fusion protein comprising IGF-I or an IGF-I variant N-terminally linked to the C-terminus of a propeptide. The invention relates also to a method involving the use of the aforementioned fusion protein in the production of a lysine-PEGylated IGF-I or IGF-I variant. The method comprises the steps of cultivating a prokaryotic host cell comprising an expression vector containing a nucleic acid encoding the fusion protein and causing the cell to express the fusion protein, recovering and PEGylating said fusion protein, cleaving said PEGylated fusion protein with IgA protease, and recovering lysine-PEGylated IGF-I or IGF-I variant. The invention relates also to a lysine-PEGylated IGF-I or IGF-I variant produced using the above method. In addition, the invention relates to a method for treating a neurodegenerative disorders like Alzheimer's Disease using the lysine-PEGylated IGF-I or IGF-I variant and a composition comprising the lysine-PEGylated IGF-I or IGF-I variant.
US08476230B2	Insulinotropic complex using an immunoglobulin fragment The present invention relates to an insulinotropic peptide conjugate having improved in-vivo duration of efficacy and stability, comprising an insulinotropic peptide, a non-peptide polymer and an immunoglobulin Fc region, which are covalently linked to each other, and a use of the same. The insulinotropic peptide conjugate of the present invention has the in-vivo activity which is maintained relatively high, and has remarkably increased blood half-life, and thus it can be desirably employed in the development of long acting formulations of various peptide drugs.
US08476229B2	Blood sugar-modulating polypeptides A blood sugar-modulating polypeptide, a pharmaceutical composition comprising the polypeptide, and a method for modulating blood sugar in a mammal comprising the administration of the polypeptide are provided. The polypeptide has a following amino acid sequence or a homologous amino acid sequence derived from the substitution, deletion, and/or addition of one or more amino acids therein: RVRVWVTERGIVARPPTIG(SEQ ID NO. 11).
US08476225B2	Antiviral compounds The invention is related to anti-viral compounds, compositions containing such compounds, and therapeutic methods that include the administration of such compounds, as well as to processes and intermediates useful for preparing such compounds.
US08476223B2	Metallo-lactoferrin-coenzyme compositions to improve sleep patterns Formulations are provided for the improvement of sleep patterns. The formulations generally include a trigger complex, an elemental complex and a coenzyme-vitamin B complex. The trigger complex is high in fiber such as glucomannan and includes Metallo-Lactoferrin protein in an alkaline buffer system. The elemental complex includes one or more trace element as a suitable salt. The coenzyme-vitamin B complex includes one or more coenzyme, coenzyme precursor and/or B-vitamin. The compositions may optionally include additional components such as 5-hydroxy-L-tryptophan (5-HTP), choline, melatonin, milk protein hydrolysate, L-arginine, and L-carnitine. The compositions can be administered orally in a variety of forms.
US08476220B2	Biocompatible polymers, process for their preparation and compositions containing them A process for treating fibroses including administering a therapeutically effective amount of a pharmaceutical composition which includes at least one biocompatible polymer of the following general formula (I): AaXxYy wherein: A represents a monomer selected from the group consisting of a sugar or —(O—CH2—CH2—CO)—, X represents a carboxyl group bonded to monomer A and is contained within a group according to the following formula: —R—COO—R′, in which R is a bond or an aliphatic hydrocarbon chain, optionally branched and/or unsaturated, and which can contain one or more aromatic rings except for benzylamine and benzylamine sulfonate, and R′ represents a hydrogen atom or a cation, Y represents a sulfate or sulfonate group bonded to monomer A and is contained within a group according to one of the following formulas: —R—O—SO3—R′, —R—N—SO3—R′, —R—SO3—R′, in which R is a bond or an aliphatic hydrocarbon chain, optionally branched and/or unsaturated, and which can contain one or more aromatic rings except for benzylamine and benzylamine sulfonate, and R′ represents a hydrogen atom or a cation, a represents the number of monomers A such that the mass of the polymers of formula (I) is greater than approximately 5,000 da, x represents a substitution rate of the monomers A by the groups X, which is between approximately 20 and 150%, and y represents a substitution rate of the monomers A by the groups Y, which is between approximately 30 and 150%.
US08476218B1	Antimicrobial compositions and related methods Antimicrobial compositions and related methods are described. In an embodiment of the invention, an antimicrobial composition comprises parachlorometaxylenol in an amount of 0.75% w/w to 1% w/w; sodium pareth C12-15 sulfonate in an amount of 1% w/w to 1.25% w/w; poly(oxyethylene)20 cetyl ether in an amount of 0.05% w/w to 0.55% w/w; benzoic acid in an amount of 0.075% w/w to 1.25% w/w; glycerol in an amount of 0.01% w/w to 0.02% w/w; phenoxyethanol in an amount of 0.001% w/w to 0.5% w/w; and water in an amount of 94% w/w to 97% w/w.
US08476215B1	Detergent composition A detergent composition includes: 11 to 45 parts by weight of a natural surfactant; 25 to 35 parts by weight of mirabilite; 10 to 40 parts by weight of a water softener; 0.2 to 5 parts by weight of a chelating agent; and a balance of an additional detergent builder.
US08476214B2	Low voc hard surface treating composition providing anti-fogging and cleaning benefits A multi-functional hard surface treating composition is described which includes (1) a surfactant system including at least two surfactants and (2) at least one alkylene glycol alkyl ether. The at least two surfactants include an anionic surfactant and either a polymer surfactant or a nonionic surfactant. The surfactant system and alkylene glycol alkyl ether have a synergistic effect to provide anti-fogging, anti-streaking, and cleaning benefits to a hard surface treated with the composition.
US08476208B2	Water-soluble metal-processing agent, coolant, method for preparation of the coolant, method for prevention of microbial deterioration of water-soluble metal-processing agent, and metal processing Disclosed are a water-soluble metal-processing agent and a coolant both of which have excellent microbial deterioration resistance and are less likely to go rotten, a method for preparing the agent or the coolant, and a metal processing method. The water-soluble metal-processing agent or the coolant comprises an N,N,N′,N′-tetraalkyldiamine compound. The metal processing method is characterized by processing a metal of interest by using the water-soluble metal-processing agent or the coolant.
US08476200B2	Method for differentiating between the non-infectious and infectious causes of multiple organ failure The present invention relates to the use of gene expression profiles obtained in vitro from patient samples for differentiating between the non-infectious and infectious causes of multiple organ failure. The invention also relates to a method for measuring gene expression profiles in vitro and the use of said gene expression profiles and/or of the probes used therein for screening active substances against the non-infectious and/or infectious causes of multiple organ failure.
US08476199B2	Rare earth-type tape-shaped oxide superconductor and a composite substrate used for the same This invention provides a rare earth-type tape-shaped oxide superconductor having excellent mechanical strength and superconducting properties and a composite substrate using for the same. Non-oriented and non-magnetic Ni-9 at % W alloy tapes (11, 21) were bonded onto both sides of a non-oriented and non-magnetic hastelloy tape (100) by a normal temperature bonding process, and an Ni-3 at % W alloy tape (12) having a cubic texture was bonded onto the surface of the tape (11) by a normal temperature bonding process. Thereafter, the heat-treatment was given in a reducing atmosphere and a bonding layer (50a) etc. was formed on the adhesive interface of each layer. Next, a (Ce, Gd)O2 intermediate layer (13) and a Ce2Zr2O7 intermediate layer (14) by an MOD process, a CeO2 intermediate layer (15), a YBCO superconducting film (16) by a TFA-MOD method, and a silver stabilization layer (17) were stacked sequentially on the surface of the tape (12). A critical current value (Ic) of this superconductor showed 150 A.
US08476196B2	Control of harmful algal blooms by induction of programmed cell death The subject invention pertains to compositions, apparatus, and methods for controlling harmful algae and harmful algal bloom (HAB) based on the induction of the programmed cell death (PCD; apoptosis) pathway in the harmful algae, and to kits for determining algal susceptibility to PCD induction.
US08476193B2	Stable oil-in-water emulsions Interaction of cloquintocet mexyl in the discontinuous oil phase with water in the continuous aqueous phase of an oil-in-water emulsion, which can lead to cloquintocet mexyl hydrate formation, crystal formation and Ostwald ripening, is minimized by the use of specific surfactants and solvents which provide enhanced stability to the emulsion.
US08476192B2	Seed treatment pesticidal compositions An aqueous seed treatment insecticidal and/or nematicidal composition in the form of a suspension comprising (A) at least one insecticide and/or nematicide in an amount of at least 3 weight %, based on the total weight of the composition, and (B) at least two surface active compounds, wherein (i) at least one is an anionic phosphate type compound, and (ii) at least one is a non-ionic alkoxylated phenol. Such compositions demonstrate improved dust-off performance when applied to plant propagation material, such as seeds.
US08476189B1	Process for superabsorbent polymer and crosslinker composition The present invention further relates to a process to make a superabsorbent polymer comprising the steps of a) preparing a neutralized monomer solution comprising a polymerizable monomer selected from unsaturated acid groups-containing monomers, ethylenically unsaturated carboxylic acid anhydride, salts, or derivatives thereof and a caustic agent selection from an alkali agent, wherein the polymerizable monomer is neutralized to from about 50 mol % to about 85 mol %; b) forming a crosslinker monomer mixture by adding an internal crosslinker composition to the neutralized monomer solution wherein the internal crosslinking composition is the reaction product of a stoichiometric excess of amine with a glycidyl compound, wherein the internal crosslinker composition has a residual amount of glycidyl compounds of less than about 500 ppm based on the mass of the internal crosslinker composition; and c) polymerizing the crosslinker monomer mixture to make a superabsorbent polymer.
US08476187B2	Process for preparing catalyst powder The present invention details a process for producing a catalyst powder. The steps of the process include preparing catalyst slurry, drying, pyrolyzing, and calcining the catalyst slurry to obtain a calcined catalyst powder. The catalyst slurry comprises a catalyst, a liquid carrier, a templating agent, and a catalyst substrate. The catalyst slurry is dried to obtain a raw catalyst powder. The raw catalyst powder is heated in a first controlled atmosphere to obtain a pyrolyzed catalyst powder and the pyrolyzed catalyst powder is calcined in a second controlled atmosphere to obtain a calcined catalyst powder. A method of fabricating a catalyst surface and catalytic converter using the prepared catalyst powder is also illustrated.
US08476179B2	Grain boundary-insulated semiconductor ceramic, semiconductor ceramic capacitor, and method for producing semiconductor ceramic capacitor A grain boundary-insulated semiconductor ceramic contains a SrTiO3-based compound as a main component, and a diffusing agent containing a grain boundary insulating agent and a glass component. The grain boundary insulating agent is composed of a material free of lead, the glass component mainly contains a SiO2—X2O-MO—TiO2-based glass material that does not contain boron or lead and in which X represents an alkali metal, and M represents at least one of barium, strontium, and calcium, and the content of the glass component is 3 to 15 parts by weight relative to 100 parts by weight of the grain boundary insulating agent. A component base is composed of the grain boundary-insulated semiconductor ceramic.
US08476177B2	Highly refractive and highly transparent optical glass The optical glass has a refractive index nd of 1.945≦nd≦1.97, an Abbe number νd of 33≦νd≦36, and a composition with the following components in amounts expressed in % of their cations, with respect to the total number of cations in the composition: B3+, 35-46; La3+, 25-35; Ta5+, 6-14; W6+, 6-13; Zr4+, 1-7; Gd3+, 0-5; Nb5+, 0-4; Y+3, 0-4; Ba2+, 0-2; Σ alkaline earth metal cations, 0-2, Σ La3++Ta3++W6++Zr4++Gd3++Nb5++Y3+≧50; and at least one fining agent, 0-0.3. Also a ratio of B3+ to La+3 is 1.1 to 1.6 and a ratio of B3+ to Σ Si+4+B3+ is ≧0.5. The glass is free of lead, arsenic, Ti4+, Th4+, Zn2+, F−, and Hf+4.
US08476176B2	Phosphate glass, fluorophosphate glass, preform for precision press-molding, optical element and process for the production of thereof A fluorophosphate glass having a fluorine content of 25% or more by anionic %, which is produced from a glass raw material containing 0.1 to 0.5%, by anionic %, of a halide containing a halogen element selected from chlorine, bromine or iodine, and a phosphate glass having a fluorine content of less than 25% by anionic %, which is produced from a glass raw material containing 0.1 to 5%, by anionic %, of a halide containing a halogen element selected from chlorine, bromine or iodine.
US08476174B2	Glass and glass-ceramics There is provided a lithium ion conductive glass-ceramics which is dense, contains few microvoids causing the decrease in lithium ion conductivity, and achieves good lithium ion conductivity. A glass-ceramics which comprises at least crystallines having an LiTi2P3O12 structure, the crystallines satisfying 1
US08476173B2	Laminate material for absorbent articles and method for its manufacture Laminate material having a first liquid-permeable material layer and discretely-arranged material pieces of a second liquid-permeable material, wherein the material layer and the discrete material pieces are joined internally. The laminate material also has a second liquid-permeable material layer joined to the first liquid-permeable material layer and the discretely-arranged material pieces.
US08476172B2	Knitted fabric that is electrically conductive in a biaxial manner An electrically conductive knitted fabric comprising stitched rows of an electrically non-conductive ground thread (1), and of stitched rows of an electrically conductive thread (2) placed therebetween. In addition, a number of rows of an electrically non-conductive ground thread can alternate with one or more rows of comprising electrically conductive thread. A connection overlapping the rows comprising electrically non-conducting thread exists in places between the rows comprising electrically conductive thread.
US08476171B2	Heat treatment method of ZnTe single crystal substrate and ZnTe single crystal substrate The present invention is to provide a heat treatment method for effectively eliminating Te deposits in a ZnTe single crystal substrate, and a ZnTe single crystal substrate having an optical characteristic suitable for use of a light modulation element and having a thickness of 1 mm or more. A heat treatment method of a ZnTe single crystal substrate, includes: a first step of increasing a temperature the ZnTe single crystal substrate to a first heat treatment temperature T1, and retaining the temperature of the substrate for a predetermined time; and a second step of gradually reducing the temperature of the substrate from the first heat treatment temperature T1 to a second heat treatment temperature T2 lower than the heat treatment temperature T1 with a predetermined rate, wherein the first heat treatment temperature T1 is set in a range of 700° C.≦T1≦1250° C. and the second heat treatment temperature T2 is set in a range of T2≦T1−50.
US08476170B2	Method of forming pattern, method of manufacturing semiconductor device, and method of manufacturing template According to one embodiment, a pattern formation method includes, before forming a circuit pattern on a substrate using imprinting, a wall pattern with a predetermined height is formed to surround the periphery of an area serving as imprint shots on the substrate in each imprint shot and to allow the imprint shots to be separated from one another. The circuit pattern is formed in the imprint shots surrounded by the wall pattern through imprinting.
US08476167B2	Lithographic apparatus and method of manufacturing an electrostatic clamp for a lithographic apparatus The invention relates to a method of manufacturing an electrostatic clamp configured to electrostatically clamp an article to an article support in a lithographic apparatus. The method includes providing a first layer of material, etching a recess in the first layer of material, and disposing an electrode in the recess of the first layer of material.
US08476163B2	Semiconductor device and manufacturing method therefor A method for manufacturing a semiconductor device includes providing a substrate having a first surface and a second surface, the second surface is on the opposite side of the substrate facing away from the first surface. The method further includes forming a first portion of an opening by etching a portion of the substrate from the first surface, forming a buffer layer on an inner surface of the first portion, etching a bottom of the buffer layer to expose an area of the underlying substrate, and etching the exposed area of the substrate to form a second portion of the opening. The method also includes performing an isotropic etching on the second portion of the opening to obtain a flask-shaped opening and filling the opening with a filling material. The method also includes partially removing a portion of the second surface and the filling material from the second portion of the opening.
US08476162B2	Methods of forming layers on substrates Methods for forming layers on a substrate are provided herein. In some embodiments, methods of forming layers on a substrate disposed in a process chamber may include depositing a barrier layer comprising titanium within one or more features in the substrate; and sputtering a material from a target in the presence of a plasma formed from a process gas by applying a DC power to the target, maintaining a pressure of less than about 500 mTorr within the process chamber, and providing up to about 5000 W of a substrate bias RF power to deposit a seed layer comprising the material atop the barrier layer.
US08476160B2	Sublithographic patterning employing image transfer of a controllably damaged dielectric sidewall A first low dielectric constant (low-k) dielectric material layer is lithographically patterned to form a recessed region having expose substantially vertical sidewalls, which are subsequently damaged to de-carbonize a surface portion at the sidewalls having a sublithographic width. A second low-k dielectric material layer is deposited to fill the recessed region and planarized to exposed top surfaces of the damaged low-k dielectric material portion. The damaged low-k dielectric material portion is removed selective to the first and second low-k dielectric material layers to form a trench with a sublithographic width. A portion of the pattern of the sublithographic-width trench is transferred into a metallic layer and optionally to an underlying dielectric masking material layer to define a trench with a sublithographic width, which can be employed as a template to confine the widths of via holes and line trenches to be subsequently formed in an interconnect-level dielectric material layer.
US08476158B2	Method of preparing and storing GaN substrate, prepared and stored GaN substrate, and semiconductor device and method of its manufacture A GaN substrate storage method of storing, within an atmosphere in which the oxygen concentration is not greater than 15 vol. % and the water-vapor concentration is not greater than 20 g/m3, a GaN substrate (1) having a planar first principal face (1m), and whose plane orientation in an arbitrary point (P) along the first principal face (1m) and separated 3 mm or more from the outer edge thereof has an off-inclination angle Δα of −10° or more, 10° or less with respect to the plane orientation of an arbitrarily designated crystalline plane (1a) that is inclined 50° or more, 90° or less with respect to a plane (1c), being either the (0001) plane or the (000 1) plane, through the arbitrary point. In this way a method of storing GaN substrates whose principal-face plane orientation is other than (0001) or (000 1), with which semiconductor devices of favorable properties can be manufactured is made available.
US08476152B2	N-type carrier enhancement in semiconductors A method includes epitaxially growing a germanium (Ge) layer onto a Ge substrate and incorporating a compensating species with a compensating atomic radius into the Ge layer. The method includes implanting an n-type dopant species with a dopant atomic radius into the Ge layer. The method includes selecting the n-type dopant species and the compensating species in such manner that the size of the Ge atomic radius is inbetween the n-type dopant atomic radius and the compensating atomic radius.
US08476151B2	Method for manufacturing nitride semiconductor crystal layer According to one embodiment, a method is disclosed for manufacturing a nitride semiconductor crystal layer. The method can include forming the nitride semiconductor crystal layer having a first thickness on a silicon crystal layer. The silicon crystal layer is provided on a base body. The silicon crystal layer has a second thickness before the forming the nitride semiconductor crystal layer. The second thickness is thinner than the first thickness. The forming the nitride semiconductor crystal layer includes making at least a portion of the silicon crystal layer incorporated into the nitride semiconductor crystal layer to reduce a thickness of the silicon crystal layer from the second thickness.
US08476150B2	Methods of forming a semiconductor device A method and structure for a semiconductor device, the device including a handle wafer, a diamond layer formed directly on a front side of the handle wafer, and a thick oxide layer formed directly on a back side of the handle wafer, the oxide of a thickness to counteract tensile stresses of the diamond layer. Nitride layers are formed on the outer surfaces of the diamond layer and thick oxide layer and a polysilicon is formed on outer surfaces of the nitride layers. A device wafer is bonded to the handle wafer to form the semiconductor device.
US08476147B2	SOI substrate and manufacturing method thereof A bond substrate is irradiated with ions, so that an embrittlement layer is formed, then, the bond substrate is bonded to a base substrate. Next, a part of a region of the bonded bond substrate is heated at a temperature higher than a temperature of the other part of the region of the bond substrate, or alternatively, a first heat treatment is performed on the bonded bond substrate as a whole at a first temperature; and a second heat treatment is performed on a part of a region of the bonded bond substrate at a second temperature higher than the first temperature, so that separation of the bond substrate proceeds from the part of the region of the bond substrate to the other part of the region of the bond substrate in the embrittlement layer. Accordingly, a semiconductor layer is formed over the base substrate.
US08476141B2	High performance dielectric stack for DRAM capacitor A method for fabricating a DRAM capacitor stack is described wherein the dielectric material is a multi-layer stack formed from a highly-doped material combined with a lightly or non-doped material. The highly-doped material remains amorphous with a crystalline content of less than 30% after an annealing step. The lightly or non-doped material becomes crystalline with a crystalline content of equal to or greater than 30% after an annealing step. The dielectric multi-layer stack maintains a high k-value while minimizing the leakage current and the EOT value.
US08476140B2	High-performance diode device structure and materials used for the same A diode and memory device including the diode, where the diode includes a conductive portion and another portion formed of a first material that has characteristics allowing a first decrease in a resistivity of the material upon application of a voltage to the material, thereby allowing current to flow there through, and has further characteristics allowing a second decrease in the resistivity of the first material in response to an increase in temperature of the first material.
US08476135B2	Integrated circuit packaging system with vertical interconnects and method of manufacture thereof A method of manufacture of an integrated circuit packaging system includes: providing a base carrier having a base carrier hole from a base carrier interconnection side to a base carrier device side; mounting a base integrated circuit over the base carrier; forming an encapsulation over the base carrier covering the base integrated circuit, the encapsulation having an encapsulation top side and having an encapsulation hole directly over the base carrier hole; and forming an interconnection structure as a single integral structure through the base carrier hole and the encapsulation hole, the interconnection structure directly on the encapsulation top side and directly on the base carrier interconnection side.
US08476134B2	Method of manufacturing super-junction semiconductor device A method of manufacturing a super-junction semiconductor device includes growing an alternating conductivity type layer epitaxially on a heavily doped n-type semiconductor substrate, the alternating conductivity type layer including n-type and p-type semiconductor regions arranged alternately and repeated such that n-type and p-type regions are adjoining each other, and arranged to extend perpendicular to the substrate's major surface. The method includes forming a first trench having a predetermined depth in the surface portion of n-type semiconductor region; forming an n-type thin layer on the inner surface of the first trench; and burying gate electrode in the space surrounded by the n-type thin layer with a gate insulator film interposed between a gate electrode and the n-type thin layer.
US08476133B2	Method of manufacture and structure for a trench transistor having a heavy body region A trenched field effect transistor is provided that includes (a) a semiconductor substrate, (b) a trench extending a predetermined depth into the semiconductor substrate, (c) a pair of doped source junctions, positioned on opposite sides of the trench, (d) a doped heavy body positioned adjacent each source junction on the opposite side of the source junction from the trench, the deepest portion of the heavy body extending less deeply into said semiconductor substrate than the predetermined depth of the trench, and (e) a doped well surrounding the heavy body beneath the heavy body.
US08476132B2	Production method for semiconductor device It is intended to provide a method of producing a semiconductor device, comprising the steps of: providing a substrate on one side of which at least one semiconductor pillar stands; forming a first dielectric film to at least partially cover a surface of the at least one semiconductor pillar; forming a conductive film on the first dielectric film; removing by etching a portion of the conductive film located on a top surface and along an upper portion of a side surface of the semiconductor pillar; forming a protective film on at least a part of the top surface and the upper portion of the side surface of the semiconductor pillar; etching back the protective film to form a protective film-based sidewall on respective top surfaces of the conductive film and the first dielectric film each located along the side surface of the semiconductor pillar; forming a resist pattern for forming a gate line in such a manner that at least a portion of the resist pattern is formed on the top surface of the semiconductor pillar by applying a resist and using lithography; and partially removing by etching the conductive film using the resist pattern as a mask while protecting, by the protective film-based sidewall, the portions of the conductive film and the first dielectric film each located along the side surface of the semiconductor pillar, to form a gate electrode and a gate line extending from the gate electrode.
US08476131B2	Methods of forming a semiconductor device with recessed source/design regions, and a semiconductor device comprising same In one example, a method disclosed herein includes forming a gate electrode structure for a PMOS transistor and a gate electrode structure for a NMOS transistor, forming a plurality of cavities in the substrate proximate the gate electrode structure of the PMOS transistor and performing an epitaxial deposition process to form raised silicon-germanium regions is the cavities. The method concludes with the step of performing a common etching process on the PMOS transistor and the NMOS transistor to define recessed regions in the substrate proximate the gate electrode structure of the NMOS transistor and to reduce the amount of the silicon-germanium material positioned above the surface of the substrate for the PMOS transistor.
US08476128B2	Semiconductor device having insulated gate field effect transistors and method of fabricating the same A CMOSFET is composed of a P-channel MOSFET and an N-channel MOSFET formed on a silicon substrate. The P-channel MOSFET is formed a first gate insulating film, a first hafnium layer and a first gate electrode which are stacked on the silicon substrate. The N-channel MOSFET is formed a second gate insulating film, a second hafnium layer and a second gate electrode which are stacked on the silicon substrate. A surface density of the second hafnium layer is lower than a surface density of the first hafnium layer.
US08476123B2	Method for manufacturing thin film transistor array panel A method for manufacturing a thin film transistor array panel includes forming a gate line; forming an insulating layer on the gate line; forming first and second silicon layers first and second metal layers; forming a photoresist pattern having first and second portions; forming first and second metal patterns by etching the first and second metal layers; processing the first metal pattern with SF6 or SF6/He; forming silicon and semiconductor patterns by etching the second and first silicon layers; removing the first portion of the photoresist pattern; forming an upper layer of a data wire by wet etching the second metal pattern; forming a lower layer of the data wire and an ohmic contact by etching the first metal and amorphous silicon patterns; forming a passivation layer including a contact hole on the upper layer; and forming a pixel electrode on the passivation layer.
US08476121B2	Organic thin film transistors and methods of making them The present invention provides a method of manufacturing an organic thin film transistor (TFT), comprising: providing a substrate layer; providing a gate electrode layer; providing a dielectric material layer; providing an organic semiconductor (OSC) material layer; providing a source and drain electrode layer; and wherein one or more of the layers is deposited using a laser induced thermal imaging (LITI) process. Preferably the organic TFT is a bottom gate device and the source and drain electrodes are deposited on an organic semiconductor layer, or over a dielectric material layer using LITI. Further preferably a dopant material may be provided between the OSC material and the source and drain electrode layer, wherein the dopant material may also be deposited using LITI. Also preferably, wherein the dopant may be a charge neutral dopant such as substituted TCNQ or F4TCNQ.
US08476120B2	Semiconductor device and method of forming three-dimensional vertically oriented integrated capacitors A semiconductor device includes conductive pillars disposed vertically over a seed layer, a conformal insulating layer formed over the conductive pillars, and a conformal conductive layer formed over the conformal insulating layer. A first conductive pillar, the conformal insulating layer, and the conformal conductive layer constitute a vertically oriented integrated capacitor. The semiconductor device further includes a semiconductor die or component mounted over the seed layer, an encapsulant deposited over the semiconductor die or component and around the conformal conductive layer, and a first interconnect structure formed over a first side of the encapsulant. The first interconnect structure is electrically connected to a second conductive pillar, and includes an integrated passive device. The semiconductor device further includes a second interconnect structure formed over a second side of the encapsulant opposite the first side of the encapsulant.
US08476117B2	Methods and apparatus for a stacked-die interposer An improved stacked-die package includes an interposer which improves the manufacturability of the package. A semiconductor package includes a package substrate having a plurality of bond pads; a first semiconductor device mounted on the package substrate, the first semiconductor device having a plurality of bond pads provided thereon; an interposer mounted on the first semiconductor device, the interposer having a first interposer bond pad and a second interposer bond pad, wherein the first and second interposer bond pads are electrically coupled; a second semiconductor device mounted on the interposer, the second semiconductor device having a plurality of bond pads provided thereon; a first bond wire connected to one of the plurality of bond pads on said first semiconductor and to the first interposer bond pad; and a second bond wire connected to the second interposer bond pad and to one of the plurality of bond pads on the semiconductor device.
US08476114B2	Housing for an optoelectronic component, optoelectronic component, and method for producing a housing for an optoelectronic component A method for making a housing for an optoelectronic component is disclosed. The housing has a plastic base body that has a front side with an assembly region for at least one radiation emitting or radiation detecting body. The plastic base body is formed from at least one first plastic component and at least one second plastic component. The second plastic component is disposed on the front side of the plastic base body, and is formed from a material that differs from the first plastic component in at least one optical property, and forms an optically functional region of the plastic base body.
US08476111B2	Integrated circuit packaging system with intra substrate die and method of manufacture thereof A method of manufacture of an integrated circuit packaging system includes: providing a substrate having a through hole; mounting an integrated circuit in the through hole, the integrated circuit having an inactive side and a vertical side; connecting a first interconnect in direct contact with the integrated circuit and the substrate; applying a wire-in-film adhesive around and above the integrated circuit leaving a portion of the vertical side and the inactive side exposed and covering a portion of the first interconnect; and mounting a chip above the integrated circuit and in direct contact with the wire-in-film adhesive.
US08476104B1	Sodium species surface treatment of thin film photovoltaic cell and manufacturing method A method for forming a thin film photovoltaic device. The method includes providing a transparent substrate comprising a surface region, forming a first electrode layer overlying the surface region, forming a copper layer overlying the first electrode layer and forming an indium layer overlying the copper layer to form a multi-layered structure. The multi-layered structure is subjected to a thermal treatment process in an environment containing a sulfur bearing species to forming a copper indium disulfide material. The copper indium disulfide material comprising a copper-to-indium atomic ratio ranging from about 1.2:1 to about 2:1 and a thickness of substantially copper sulfide material having a copper sulfide surface region. The thickness of the copper sulfide material is selectively removed to expose a surface region having a copper poor surface comprising a copper to indium atomic ratio of less than about 0.95:1. The method subjects the copper poor surface to a sodium species to convert the copper poor surface from an n-type semiconductor characteristic to a p-type semiconductor characteristic. A window layer is formed overlying the copper indium disulfide material.
US08476103B2	Methods of fabricating organic thin film transistors Disclosed is a method for forming banks during the fabrication of electronic devices incorporating an organic semiconductor material that includes preparing an aqueous coating composition having at least a water-soluble polymer, a UV curing agent and a water-soluble fluorine compound. This coating composition is applied to a substrate, exposed using UV radiation and then developed using an aqueous developing composition to form the bank pattern. Because the coating composition can be developed using an aqueous composition rather than an organic solvent or solvent system, the method tends to preserve the integrity of other organic structures present on the substrate. Further, the incorporation of the fluorine compound in the aqueous solution provides a degree of control over the contact angles exhibited on the surface of the bank pattern and thereby can avoid or reduce subsequent surface treatments.
US08476100B2	Method of forming thin film solar cell and structure thereof A method of forming thin film solar cell includes the following steps. A substrate is provided, and a plurality of first electrodes are formed on the substrate. A printing process is performed to print a light-absorbing material on the substrate and the first electrodes to form a plurality of light-absorbing patterns. Each of the light-absorbing patterns corresponds to two adjacent first electrodes, partially covers the two adjacent first electrodes, and partially exposes the two adjacent first electrodes. A plurality of second electrodes are formed on the light-absorbing patterns.
US08476099B2	Methods for improved adhesion of protective layers of imager microlens structures by forming an interfacial region Methods, structures, and design structures for improved adhesion of protective layers of imager microlens structures are disclosed. A method of fabricating a semiconductor structure includes forming an interfacial region between a microlens and a protective oxide layer. The interfacial region has a lower concentration of oxygen than the protective oxide layer.
US08476095B2	Diode energy converter for chemical kinetic electron energy transfer An improved diode energy converter for chemical kinetic electron energy transfer is formed using nanostructures and includes identifiable regions associated with chemical reactions isolated chemically from other regions in the converter, a region associated with an area that forms energy barriers of the desired height, a region associated with tailoring the boundary between semiconductor material and metal materials so that the junction does not tear apart, and a region associated with removing heat from the semiconductor.
US08476093B2	Method of manufacturing a display substrate A method of manufacturing a display substrate includes forming a common electrode line, a gate line, a data line and a switching element connected to the gate and data lines on an insulation substrate. A first pixel electrode and an insulation layer are sequentially formed on the insulation substrate. A first photoresist pattern having a first hole and a second hole is formed from a first photoresist layer on the insulation substrate. A first transparent electrode layer is coated on the insulation substrate. A second photoresist layer is coated on the insulation substrate. The second photoresist layer is exposed and developed to form a second photoresist pattern remaining in the first hole and the second hole. The first transparent electrode layer is patterned using the second photoresist pattern, to form a second pixel electrode.
US08476092B2	Fabricating method of a thin film transistor substrate for liquid crystal display device of minimizing defects due to static electricity According to an embodiment, there is provided a fabricating method for a thin film transistor substrate divided into a display area displaying images and a non-display area beside the display area, the fabricating method comprising: forming a gate wire in the display area, a common voltage line for a MPS (mass production system) test in the non-display area, and a grounding line for the MPS test in the non-display area with same material at the same time; forming a gate insulating layer covering the gate wire and a first insulating layer covering the common voltage line for the MPS test and the grounding line for the MPS test with same material at the same time; forming a data wire crossing the gate wire and defining a pixel area in the display area; and forming a pixel electrode in the pixel area and an electrode layer on the first insulating layer corresponding to the common voltage line for the MPS test and the grounding line for the MPS test with same material at the same time.
US08476089B2	Method for manufacturing light emitting diode package A method for manufacturing an LED package, comprising steps of: providing a substrate, the substrate forming a plurality of spaced rough areas on a surface thereof, each of the rough areas forming a rough structure thereon, a block layer being provided on a remaining part of the surface of the substrate relative to the rough areas; forming a metal layer on a top surface of each rough structure; forming a reflector on the substrate, the reflector defining a cavity and surrounding two adjacent metal layers; arranging an LED chip in the cavity, the LED chip electrically connecting to the two adjacent metal layers; forming an encapsulation layer in the cavity to seal the LED; and separating the substrate from the metal layers, the encapsulation layer and the reflector.
US08476088B2	Light emitting diode having improved light emission efficiency and method for fabricating the same Provided is a light emitting diode (LED) having improved light emission efficiency, which can effectively overcome a technical limit of the related art by implementing a surface plasma resonance effect as well as reducing a layer defect such as threading dislocations in an LED structure.
US08476086B2	Semiconductor device and method of its manufacture Method of high-yield manufacturing superior semiconductor devices includes: a step of preparing a GaN substrate having a ratio St/S—of collective area (St cm2) of inversion domains in, to total area (S cm2) of the principal face of, the GaN substrate—of no more than 0.5, with the density along the (0001) Ga face, being the substrate principal face, of inversion domains whose surface area where the polarity in the [0001] direction is inverted with respect to the principal domain (matrix) is 1 μm2 or more being D cm−2; and a step of growing on the GaN substrate principal face an at least single-lamina semiconductor layer to form semiconductor devices in which the product Sc×D of the area Sc of the device principal faces, and the density D of the inversion domains is made less than 2.3.
US08476081B2	Assay for evaluating affinity and specificity of ligand-albumin binding A method for identifying a ligand or compound which binds to albumin comprises the steps of contacting a reaction mixture comprising a site-specific probe and albumin in the presence and the absence of the ligand or compound and measuring either dissociation constant KD, inhibitor concentration IC50 or fluorescence displacement; whereby a change in KD, IC50 and/or fluorescence in the presence of the ligand or compound is indicative of the ligand or compound binds to albumin.
US08476079B2	Reagents for reducing leukocyte interference in immunoassays Methods and devices for reducing interference from leukocytes in an analyte immunoassay are provided. In one embodiment, a method is provided comprising the steps of amending a biological sample such as a whole blood sample with one or more leukocidal reagents that reduce or eliminate the metabolic activity of leukocytes, and performing an immunoassay on the amended sample to determine the concentration of analyte in the sample. Preferably, the sample is amended with one or more enzymes and optionally one or more enzyme substrates and cofactors.
US08476078B2	Cassette for sample preparation A cassette for preparing a sample is disclosed herein. The cassette includes a housing, which encloses the structures and the processes used to prepare the sample.
US08476077B2	Urine and serum biomarkers associated with diabetic nephropathy Disclosed is use of urine and serum biomarkers in diagnosing diabetic nephropathy, staging diabetic nephropathy, monitoring diabetic nephropathy progress, and assessing efficacy of diabetic nephropathy treatments. These biomarkers include urine precursor alpha-2-HS-glycoprotein, urine alpha-1 antitrypsin, urine alpha-1 acid glycoprotein, urine osteopontin, serum osteopontin, their fragments, and combinations thereof.
US08476075B2	Analytical technique for measuring bound glycerides in a biodiesel composition A method of estimating the amount of unreacted starting materials (glycerides, methyl esters, etc.) and the composition of a biodiesel using TLC in conjunction with a lipophilic dye, Nile Red is described herein. The dye based TLC method of the present invention is convenient and provides significant advantages over existing methods for estimating the purity of a biodiesel composition.
US08476073B2	Automatic analyzing apparatus and quality control method for analysis supporting liquid in the same An automatic analyzing apparatus can properly determine a quality of an analysis supporting liquid, after being supplied to the automatic analyzing apparatus, which supports an analysis performed in the automatic analyzing apparatus and can properly maintain an accuracy of the analysis. The analysis supporting liquid which supports an analysis of a specimen is dispensed into a reaction vessel by using a specimen dispensing unit which dispenses the specimen, a reagent dispensing unit which dispenses a reagent, a cleaning unit which cleans the reaction vessel, or a diluted solution dispensing unit which dispenses a diluted solution. An optical measurement is performed with respect to a liquid including the dispensed analysis supporting liquid in the reaction vessel. Analysis data of the analysis supporting liquid is generated by using the measured result. The quality of the analysis supporting liquid is determined by comparing the generated analysis data with reference data.
US08476070B2	Media for culturing stem cells Well-defined, xeno-free culture media which comprise a TGF-beta isoform or the chimera formed between IL6 and the soluble IL6 receptor (IL6RIL6), which are capable of maintaining stem cells, and particularly, human embryonic stem cells, in an undifferentiated state are provided. Also provided are cell cultures comprising the culture media and the stem cells and methods of expanding and deriving embryonic stem cells in such well-defined, xeno-free culture media. In addition, the present invention provides methods of differentiating ESCs or EBs formed therefrom for the generation of lineage specific cells.
US08476063B2	Microfluidic devices Methods and devices for the interfacing of microchips to various types of modules are disclosed. The technology disclosed can be used as sample preparation and analysis systems for various applications, such as DNA sequencing and genotyping, proteomics, pathogen detection, diagnostics and biodefense.
US08476061B1	Methods for isolation, use and analysis of ferritin This invention provides methods of isolating ferritin from plant and animal material. The isolated ferritin can be administered to humans or animals in need of iron, and can be used to treat or supplement iron deficiency. The isolated ferritin can be used in industrial applications, such as increasing the iron content in heat-processed food or beverages. The methods of the invention also include quantitation of iron derived from plant or animal ferritin.
US08476058B2	Probiotic yeast compositions and methods for inflammatory diseases The invention relates to novel yeast strains, to the yeasts resulting from these strains, to a composition containing at least one Saccharomyces cerevisiae yeast and/or derivatives of a yeast having a particular interest as a food additive and/or probiotic and/or functional food and/or neutraceutic and/or functional ingredient and/or cosmeceutical and/or pharmaceutical active agent. The invention also relates to the use of the same in human and/or animal nutrition, or for the treatment or prevention of inflammatory diseases.
US08476053B2	Stabilized aqueous alpha-galactosidase composition and methods relating thereto The present invention provides an aqueous composition comprising a protein with enzymatic activity of alpha-galactosidase. The present invention further provides a method of stabilizing an aqueous composition comprising a protein with enzymatic activity of alpha-galactosidase, and a method of preparing a purified aqueous composition comprising the protein with enzymatic activity of alpha-galactosidase.
US08476048B2	Xylose utilizing zymomonas mobilis with improved ethanol production in biomass hydrolysate medium Xylose-utilizing, ethanol producing strains of Zymomonas mobilis with improved performance in medium comprising biomass hydrolysate were isolated using an adaptation process. Independently isolated strains were found to have independent mutations in the same coding region. Mutation in this coding may be engineered to confer the improved phenotype.
US08476046B2	Method of pre-treating and saccharifying algae biomass Disclosed is a method of pre-treating and saccharifying an algae biomass, by dehydrating the algae biomass to have a water content of about 10% to about 70% by weight, cutting the algae biomass having a water content of about 10% to about 70% by weight to a predetermined size, and saccharifying the cut algae biomass using a hydrolysis catalyst and/or a hydrolase to yield a monosaccharide.
US08476041B2	Glucose transport mutants for production of biomaterial A method is disclosed for restoring a Glu+ phenotype to a PTS−/Glu− bacterial cell which was originally capable of utilizing a phosphotransferase transport system (PTS) for carbohydrate transport. Bacterial cells comprising the Glu+ phenotype have modified endogenous chromosomal regulatory regions which are operably linked to polynucleotides encoding galactose permeases and glucokinases.
US08476037B2	Method for screening of antiviral agents A method for screening for an antiviral agent capable of blocking a viral viroporin by determining whether a test agent can rescue expression of a fragment of a viral viroporin in a Single Protein Production system of Escherichia coli is provided.
US08476032B2	Complement factor H-based assays for serum bactericidal activity against Neisseria meningitidis Assays for detection of bactericidal anti-Neisserial antibodies using a factor H polypeptide having a human amino acid sequence that mediates binding to Neisserial factor H binding protein (fHBp) are provided, as well as non-human animal models of Neisserial infection.
US08476026B2	Biomarkers of ovarian cancer The invention is directed to assays for biomarkers associated with ovarian cancer that can be used diagnostically. It includes glass or plastic plates or slides on which the biomarkers have been immobilized and kits containing these plates or slides.
US08476024B2	Botulinum neurotoxin a protein receptor and uses thereof The invention relates to an isolated polypeptide of the luminal domain of synaptic vesicle glycoprotein 2C of Homo sapiens wherein at least 70 percent of the amino acid sequence is identical to the amino acid sequence of the SV2C of Homo sapiens. The polypeptide binds the HC fragment of botulinum neurotoxin A provided that the polypeptide is not the synaptic vesicle glycoprotein 2C of Homo sapiens.
US08476020B1	BRCA2 mutations and use thereof Genetic variants in the BRCA2 gene are disclosed which are useful as diagnosis biomarkers.
US08476013B2	Processes and compositions for methylation-based acid enrichment of fetal nucleic acid from a maternal sample useful for non-invasive prenatal diagnoses Provided are compositions and processes that utilize genomic regions differentially methylated between a mother and her fetus to separate, isolate or enrich fetal nucleic acid from a maternal sample. The compositions and processes described herein are useful for non-invasive prenatal diagnostics, including the detection of chromosomal aneuplodies.
US08476012B2	Physiogenomic method for predicting metabolic and cardiovascular side effects of thiazolidinediones Disclosed herein are genetic markers related to the efficacy and/or safety of thiazolidinedione therapy identified by a physiogenomic methodology that correlates the genetic markers with a physiological response. The genetic markers described herein were not previously associated with the efficacy and/or safety of thiazolidinedione therapy. The markers related to safety are those associated with the important side effects of BMI increase and development of edema. In one embodiment, markers related to efficacy of thiazolidinedione therapy are associated with glycosylated hemoglobin. Method of assessing an individual for markers associated with the safety and/or efficacy of thiazolidinedione therapy are described.
US08476010B2	Propofol formulations with non-reactive container closures A sterile pharmaceutical composition for parenteral administration of propofol, said composition comprising propofol, optionally albumin, and less than about 10% by weight solvent for propofol, wherein said composition is stored in a container having a closure wherein said closure is inert to propofol.
US08476009B2	Methods for detecting enveloped virus infections by measuring cell surface TSG101 The invention involves the detection of virally infected cells by antibodies or antibody fragments which selectively bind to TSG101. TSG101 is on the surface of mammalian cells, and thus available for detection by antibodies, during viral budding—a phenomenon wherein viral particles escape a virally infected cell after propagation in that cell, so as to infect other cells. To achieve budding, a protein, TSG101 is “hijacked” and misdirected to, or mis-expressed on, the surface of the infected cell. Antibodies can be used to selectively detect such infected cells. Certain TSG101 antibodies may provide therapeutic benefit when administered to infected mammals.
US08476004B2	Method for forming photoresist patterns A method for forming photoresist patterns includes providing a substrate, forming a bi-layered photoresist on the substrate, and performing a photolithography process to pattern the bi-layered photoresist. The bi-layered photoresist includes a first photoresist layer and a second photoresist layer positioned between the first photoresist layer and the substrate. The first photoresist layer has a first refraction index and the second photoresist layer has a second refraction index, and the second refraction index is larger than the first refraction index.
US08476003B2	Iterative rinse for semiconductor fabrication An iterative rinse for fabrication of semiconductor devices is described. The iterative rinse includes a plurality of rinse cycles, wherein each of the plurality of rinse cycles has a different resistivity. The plurality of rinse cycles may include a first rinse of a semiconductor substrate with de-ionized (DI) water and carbon dioxide (CO2), followed by a second rinse the semiconductor substrate with DI water and CO2. The first rinse has a first resistivity; the second rinse has a second resistivity lower than the first resistivity.
US08476002B2	Methods of forming patterned masks Some embodiments include methods in which spaced-apart first features are formed from a first material having a reflow temperature. Second material is formed along sidewalls of the first features, and third material is formed over the second material and the first features. The third material may be formed at a temperature above the reflow temperature of the first material, and the second material may support the first features so that the first features do not collapse even though they are exposed to such temperature. In some embodiments the third material has an undulating topography. Fourth material may be formed within the valleys of the undulating topography, and subsequently the first features may be removed together with at least some of the third material to leave a pattern comprising second features formed from the second material and pedestals formed from the fourth material.
US08476000B2	Method of producing a relief image from a liquid photopolymer resin A method of producing a relief image from a liquid photopolymerizable resin, said method comprising the steps of: a) placing a coverfilm onto an exposure glass; b) casting a liquid photopolymerizable resin layer onto the coverfilm; c) laminating a substrate to a backside of the liquid photopolymerizable resin layer as the liquid photopolymerizable resin layer is being cast onto the coverfilm; d) placing an image or film negative on top of the substrate; and e) exposing the liquid photopolymerizable resin layer through the image or film negative from the backside of the liquid photopolymerizable resin layer to selectively crosslink and cure the photopolymerizable resin layer and form a cured relief image, wherein said depth of the cured relief image is less than the height of the cast liquid photopolymerizable resin.
US08475999B2	Compound and photoresist composition containing the same The present invention provides a compound represented by the formula (C1): wherein Rc2 represents a C6-C10 aromatic hydrocarbon group having at least one nitro group and Rc1 represents a group represented by the formula (1): wherein Rc4 represents a hydrogen atom etc., Rc5 represents a C1-C30 divalent hydrocarbon group, and Rc3 represents a group represented by the formula (3-1), (3-2) or (3-3): wherein Rc6, Rc7, Rc8, Rc9, Rc10, Rc11, Rc12, Rc13 and Rc14 each independently represent a C1-C30 hydrocarbon group, and a photoresist composition comprising a resin, an acid generator and the compound represented by the formula (C1).
US08475998B2	Compound synthesis method, microarray, acid-transfer composition, and biochip composition A compound synthesis method includes bonding a first compound to a substrate to form a first film. A second film is formed on the first film using an acid-transfer composition including (A) a polymer that includes a structural unit shown by a following formula (1) and a structural unit shown by a following formula (2), (B) a photoacid generator shown by a following formula (3), and (C) a sensitizer shown by a following formula (4). The second film is exposed to remove the protecting group from the first compound under an exposed area of the second film. An acid generated in the exposed area of the second film is transferred to the first film. The second film after being exposed is removed. A second compound is bonded to the first compound from which the protecting group has been removed.
US08475997B2	Resist composition for immersion exposure, method of forming resist pattern, and fluorine-containing polymeric compound A resist composition for immersion exposure including: a fluorine-containing polymeric compound (F) containing a structural unit (f1) having a base dissociable group and a structural unit (f2) represented by general formula (f2-1) (wherein R represents a hydrogen atom, a lower alkyl group or a halogenated lower alkyl group; and W is a group represented by any one of general formulas (w-1) to (w-4)); a base component (A) that exhibits changed solubility in an alkali developing solution under the action of acid; and an acid generator component (B) that generates acid upon exposure.
US08475995B2	Toner having core-shell structure and method of preparing the same A toner has a core-shell structure including a toner core portion having a resin with an active hydrogenactive hydrogen containing group, a colorant and at least one additive, and a toner shell portion surrounding the toner core portion, wherein the toner shell portion includes a cross-linked resin prepared by reaction of at least a portion of the active hydrogen containing group and the cross-linking agent.
US08475991B2	Transparent toner and image forming method A transparent toner for forming a glossy surface is disclosed, wherein a critical surface tension of a glossy surface formed by the transparent toner at 20° C. is at least 50 mN/m, and the transparent toner comprises a resin composed of a polymer formed by employing at least a polymerizable monomer containing a carboxylic group (—COOH). An image forming method employing the transparent tone is also disclosed.
US08475988B2	Resin-filled ferrite carrier core material for electrophotographic developer, ferrite carrier and electrophotographic developer using the ferrite carrier Disclosed are a resin-filled ferrite carrier core material for an electrophotographic developer, including a porous ferrite particle, wherein the composition of the porous ferrite particle is represented by the following formula (1), and part of (MgO) and/or (Fe2O3) in the following formula (1) is replaced with SrO; a ferrite carrier obtained by filling a resin in the voids of the ferrite carrier core material; and an electrophotographic developer using the ferrite carrier: ( MgO ) ⁢ x ⁡ ( Fe 2 ⁢ O 3 ) ⁢ y ⁢ ( x = 10 ⁢ ⁢ mol ⁢ ⁢ % ⁢ ⁢ or ⁢ ⁢ more ⁢ ⁢ and ⁢ ⁢ less ⁢ ⁢ than ⁢ ⁢ 25 ⁢ ⁢ mol ⁢ ⁢ % y = exceeding ⁢ ⁢ 75 ⁢ ⁢ mol ⁢ ⁢ % ⁢ ⁢ and ⁢ ⁢ 90 ⁢ ⁢ mol ⁢ ⁢ % ⁢ ⁢ or ⁢ ⁢ less x + y = 100 ⁢ ⁢ mol ⁢ ⁢ % ) . ( 1 )
US08475972B2	Fuel cell A fuel cell stack comprising a second metal separator set to have an external dimension larger than a first metal separator, wherein the second metal separator comprises, formed integrally, a first seal member in contact with the peripheral edge of a first electrolyte membrane/electrode structure, a second seal member in contact with the peripheral edge of the first metal separator, and a third seal member in contact with the peripheral edge of an adjoining fourth metal separator. Since the first seal member, the second seal member and the third seal member are integrally formed on one surface of the second separator or one surface of the first separator, a seal-forming step can be carried out at one effort, simply and economically. In addition, use of a triple seal structure containing the first through the third seal members can favorably improve the sealing feature of reaction gas and minimize reaction gas leakage.
US08475970B2	Fluoroesin-coated polymer film for reinforcing polymer electrolyte membrane, reinforced polymer electrolyte membrane, and membrane electrode assembly Disclosed is a fluororesin-coated polymer film for reinforcing a polymer electrolyte membrane, wherein the fluororesin-coated polymer film is fabricated by forming on at least one side of a polymer film a coating of a reaction product of (A) a fluorine-containing copolymer composed of a fluoroolefin, a cyclohexyl group-containing acrylic ester, and a hydroxyl group-containing vinyl ether, and (B) a crosslinking agent having two or more isocyanate groups. The polymer film according to the present invention not only exhibits sufficiently high initial adhesion strength, with respect to the polymer electrolyte membrane, but also retains thereafter high adhesion strength in actual operating environments.
US08475967B2	Membrane/electrode assembly for polymer electrolyte fuel cell and process for producing cathode for polymer electrolyte fuel cell To provide a membrane/electrode assembly for polymer electrolyte fuel cells, capable of achieving high power generation performance under low or no humidity operation conditions, and a process for producing a cathode for polymer electrolyte fuel cells. A membrane/electrode assembly 10, comprising: an anode 20 having a catalyst layer 22 and a gas diffusion layer 28, a cathode 30 having a catalyst layer 32 and a gas diffusion layer 38, and a polymer electrolyte membrane 40 interposed between the catalyst layer 22 of the anode 20 and the catalyst layer 32 of the cathode, wherein the cathode 30 has, between the catalyst layer 32 and the gas diffusion layer 38, a first interlayer 36 comprising carbon fibers (C1) and a fluorinated ion exchange resin (F1), and a second interlayer 34 comprising carbon fibers (C2) and a fluorinated ion exchange resin (F2), in this order from the gas diffusion layer 38 side.
US08475966B2	Apparatus and method of recovering vapors An apparatus and method is disclosed for recovering a flammable vapor emanating from a vent of a tank. The apparatus comprises an input conduit for connecting to the vent of the tank. An input manifold connects the input conduit to an input of a compressor with an output manifold connecting an output of the compressor to an input of a storage tank. An output conduit connects an output of the storage tank to the turbine generator for generating electrical power by processing the flammable vapor. An electrical connector directs electrical power from the turbine generator to drive the apparatus as well as to supply surplus power to an external load.
US08475965B2	Fuel cell power generation system with valve on raw material gas supply passage and valve downstream of carbon monoxide decreasing unit, and method for operating fuel cell power generation system The fuel cell power generation system includes a fuel cell, a reformer, a carbon monoxide decreasing unit, a first raw material supply source, a first valve which is provided to a first raw material flow passage, a second valve which is provided downstream of the carbon monoxide decreasing unit, a second raw material supply source which supplies a raw material to the inside of a flow passage which is closed by the first valve and the second valve from downstream of the carbon monoxide decreasing unit, and a control unit which controls the first valve and the second valve, wherein the control unit, after the first valve and the second valve are closed, supplies the raw material fed from the second raw material supply source to the inside of the flow passage closed by the first valve and the second valve at the time of stopping the system.
US08475963B2	Lithium microbattery and fabrication method thereof The microbattery is formed by a stack of solid thin layers on a substrate which, starting from the substrate, successively comprises a first electrode, a solid electrolyte and a second electrode/current collector assembly. A first surface and a second surface of the electrolyte are respectively in contact with a main surface of the first electrode and a main surface of the second electrode/current collector assembly. The dimensions of the main surface of the first electrode are smaller than the dimensions of the main surface of said assembly, and the dimensions of the first surface of the solid electrolyte are smaller than the dimensions of the second surface of the solid electrolyte. The solid electrolyte is furthermore not in contact with the substrate.
US08475960B2	Anode material for lithium-ion chemical power sources and method of obtaining thereof An anode material is based on lithium-titanium spinel that contains doping components, chromium and vanadium, in equivalent quantities, of the chemical formula Li4Ti5-2y(CryVy)O12-x, where x is the deviation from stoichiometry within the limits 0.02
US08475956B2	Polyradical compound-conductive material composite, method for producing the same, and battery using the same An exemplary embodiment provides: a composite of an electrode active material and an electric conductivity-imparting agent, which has a high capacity density and can produce a large current; a method for producing it; and a battery which has a high energy density and can produce a large output. Specifically, a polyradical compound as the electrode active material and a conductive material are heated and mixed at a temperature of not less than the softening temperature of the polyradical compound and less than the decomposition temperature thereof to form a composite of the polyradical compound and the conductive material. Fabricating an electrode using the composite can provide a novel battery having a high energy density and a large output.
US08475954B2	Flexible voltage nested battery module design Exemplary embodiments of the present invention provide flexible, multi-voltage battery modules having multiple cells that are nested together. The cells can be, for example, cylindrical lithium ion cells. To increase cell package density, the cells can be disposed in a nested configuration so that adjacent cell centers form equilateral triangles. The cells can be placed in a housing or case with interlocking tabs that allow multiple modules to be connected together. Within a module, the cells can be connected in different configurations by buss bars at the top and the bottom of the battery cells. The different configurations may provide different voltages for the module.
US08475953B2	Energy storage unit for a motor vehicle An energy store for a motor vehicle for storage and emission of electrical energy as required, having a multiplicity of cells which are positioned one above the other and/or alongside one another like an array, wherein each cell is surrounded by a first material, wherein a second material is positioned between the cells which are surrounded by the first material and form a cell array, and wherein heat exchanging ribs are positioned at edges of the cell array.
US08475952B2	Battery module and battery pack using the same The battery module includes: a plurality of batteries; a housing 50 in which the plurality of batteries are aligned and stored; and a cooling pipe 70 provided along the plurality of batteries in the housing 50, the cooling pipe 70 being filled with a cooling medium, wherein the cooling pipe 70 is made of a material which melts when the temperature of the battery reaches or exceeds a predetermined temperature.
US08475949B2	Method for manufacturing magnetic recording medium and magnetic recording medium A magnetic recording medium is presented that includes protruded magnetic patterns formed on a substrate, and a nonmagnetic material filled in recesses between the magnetic patterns in which an oxygen concentration thereof is higher at a surface side than at a substrate side. The nonmagnetic material is at least one selected from the group consisting of Si, SiC, SiC—C, SiOC, SiON, Si3N4, Al, AlxOy, Ti and TiOx.
US08475948B2	Magnetic recording medium for thermally assisted recording A magnetic recording medium suppresses an anticipated decline in performance due to heating of the lubricant layer and protective layer in thermally assisted recording, and has superior durability and reliability. The magnetic recording medium comprises a layer stack comprising, in order on a nonmagnetic substrate, at least a magnetic recording layer, adiabatic layer, carbon-based protective layer, and lubricant layer.
US08475947B2	Perpendicular magnetic recording medium A perpendicular magnetic recording medium, which includes a first magnetic recording layer, a second magnetic recording layer, and a third magnetic recording layer disposed sequentially on a nonmagnetic substrate, and a coupling layer formed between the first and second magnetic recording layers. The first, second and third magnetic recording layers have an easy axis of magnetization in a direction perpendicular to a film plane of the nonmagnetic substrate. The first and second magnetic recording layers are ferromagnetically coupled via the coupling layer.
US08475945B2	Composite article including silicon oxycarbide layer A composite article includes a substrate, at least one protective layer on the substrate and an intermediate layer between the at least one protective layer and the substrate. The intermediate layer includes dense silicon oxycarbide.
US08475942B2	Hard-coating-coated member, tool, and target A member covered with a hard coating having good wear resistance, a tool using the member, and a target for forming the hard coating are provided. A hard-coating-coated member has a hard coating on a substrate, in which the hard coating has a composition of (TiaCrbAlcSidYeRf)(CyNz), the R being at least one element selected from Ho, Sm, Dy and La, and when the subscripts a, b, c, d, e, f, y and z denote atomic ratios respectively, 0.05≦a≦0.3, 0.05≦b≦0.3, 0.4≦c≦0.65, 0≦d≦0.05, 0≦e≦0.05, 0.005≦f≦0.05, a+b+c+d+e+f=1, 0≦y≦0.3, 0.7≦z≦1, and y+z=1 are satisfied.
US08475934B2	Flame-retardant timber materials The present invention relates to timber materials rendered flame-retardant by using halogen-free organophosphorus compounds, to means and processes for producing these materials, and also to their use.
US08475929B2	Barrier film and laminated material, container for wrapping and image display medium using the same, and manufacturing method for barrier film A laminated material having a barrier film containing a barrier layer on at least one surface of a substrate film that is a silicon oxide film having an atomic ratio in a range of Si:O:C=100:140 to 167:20 to 40, peak position of infrared-ray absorption due to Si—O—Si stretching vibration between 1060 to 1090 cm−1, a film density in a range of 2.6 to 2.8 g/cm3, and a distance between grains of 30 nm or shorter.
US08475927B2	Tin-doped indium oxide fine particle dispersion, method for manufacturing the same, interlayer film for laminated glass with heat ray blocking properties formed by using said dispersion, and laminated glass therewith A dispersion of tin-doped indium oxide fine particles has tin-doped indium oxide fine particles, a plasticizer for an interlayer film, an organic solvent containing alcohols as a main component, and a dispersion stabilizer, wherein under measuring conditions of a concentration of tin-doped indium oxide fine particles of 0.7% by weight and an optical path length of a glass cell of 1 mm, a visible light transmittance is 80% or more, a solar radiation transmittance at a wavelength within a range from 300 nm to 2100 nm is ¾ or less of the visible light transmittance, a haze value is 1.0% or less, and a reflection yellow index is −20 or more.
US08475921B2	Composite material, composite material substrate, composite material dispersed fluid, and manufacturing methods thereof A composite material includes an aggregate which contains a first metal particle constituting a core and second metal oxide particulates surrounding the first metal particle and having an average primary particle diameter ranging from 1 to 100 nm.
US08475912B2	Coating composition for forming low-refractive-index layer, antireflective film using the same, and image display device including the antireflective film A coating composition for forming a low-refractive-index layer includes a first fluorine compound represented by Formula 1 below, (CH2═CR1COO)2Rf Formula 1 and a reactive silicon compound, a (meth)acrylate compound, a polymerization initiator, and a solvent. The first fluorine compound represented by Formula 1, the reactive silicon compound, the (meth)acrylate compound, the polymerization initiator, and the solvent may each be different from one another, and in Formula 1, Rf may be a C1-19 perfluoro group, and R1 may be a hydrogen atom or a methyl group.
US08475910B2	Edge stiffened polymeric corrugated sheet material Edge stiffened corrugated polymeric sheet material can be utilized as storm panels for mounting about a perimeter surface of an opening so as to protect the opening from wind and impact loads. The panels can include a corrugated sheet material having a corrugated contiguous band horizontally extending at about an end of the top and the bottom, wherein the corrugated contiguous band is complementary and contiguous to the plurality of corrugations of the corrugated sheet panel. The complementary and contiguous corrugated band can be configured to sandwich the sheet material. The panel may also include, individually or in combination, a contiguous band sandwiching the polymeric sheet material at a terminal end of each side and extending vertically from the top to the bottom. The panels provide wind and impact load protection for the opening.
US08475908B2	3D embossing An embossing roll for producing fibrous products, has a structurized embossing surface suitable to run against an anvil roll. The structurized embossing surface includes male protrusions or female depressions starting from a base circumferential surface of the roll. The embossing pattern is characterized by the following features: the base areas of selected male protrusions or female depressions in the base circumferential surface are different; the heights or depths of selected male protrusions or selected female depressions in a radial direction of the roll and starting from the base circumferential surface are different; and the angles between sidewall sections and the adjacent base circumferential surface of selected male protrusions and/or female depressions are different.
US08475902B2	Optical recording medium A multilayer optical recording medium in which, as a recording layer is located farther from a surface of incidence of a light beam for reading, the amount of light that reaches the surface of incidence after being reflected off the recording layer is smaller.
US08475898B2	Polyolefin resin blends for crack-resistant pipe Resin blends useful for pipe and blow-molded articles are disclosed. The blends comprise a low-molecular-weight, high-density polyethylene and a high-molecular-weight, low-density ethylene copolymer. The high-molecular-weight component is made with a bridged indenoindolyl Group 4 metal complex having open architecture. Blends of the invention uniquely have high molecular weight (Mw>200,000) and low levels of long-chain branching. A quick, convenient approach for estimating levels of long-chain branching in polyethylenes from gel permeation chromatography and dynamic oscillatory rheometry (“viscosity enhancement factor”) is disclosed.
US08475891B2	Embossed release paper and process for producing the same This invention provides an embossed release paper that has high heat resistance and embossing properties. The embossed release paper comprises a paper base material, an ionizing radiation-cured resin layer, and a heat-cured silicone layer stacked in that order, the embossed release paper having embosses. The embossed release paper has high heat resistance and thus is suitable for use in synthetic leather production and melamine decorative sheet production that involve surface emboss pattern formation.
US08475890B2	Colored material coated transparent chip for artificial stone, method of preparing same, and artificial stone including same The present invention provides transparent chips with natural metal-like texture by coating silica-containing transparent chips with colored material, such as a metal powder, in a transparent resin as a base resin. The present invention also provides artificial stone with natural metal-like texture and patterns by mixing the colored material coated transparent chips and inorganic filler with a matrix resin. The artificial stone of the present invention can be prepared by mixing about 4 to about 24 parts by weight of inorganic filler and about 0.1 to about 5.0 parts by weight of the colored material coated transparent chips, per about 1 part by weight of the matrix resin. The colored material coated transparent chips can have a specific gravity of about 2.0 to about 2.65, while the matrix resin can have a specific gravity of about 2.2 to about 2.8, and the specific gravity of the transparent chips can be equal to or lower than the specific gravity of the matrix resin in promote uniform distribution of the transparent chips in the matrix resin.
US08475887B2	Optically isotropic liquid crystal medium, and optical device A liquid crystal medium having a wide temperature range of a liquid crystal phase, a large optical anisotropy, and a large dielectric anisotropy and having an optically isotropic liquid crystal phase is provided. The liquid crystal medium is characterized by containing a liquid crystal compound having a pyrimidine ring and a linking group —CF2O— and a chiral dopant, and exhibiting an optically isotropic liquid crystal phase.
US08475885B2	Method of forming organic film, and organic film, nozzle plate, inkjet head and electronic device The method of forming an organic film, includes: an organic film formation step of forming an organic film on a surface of a base member using a silane coupling agent; and a post-processing step including a water vapor introduction step of holding the base member on which the organic film has been formed in an atmosphere containing at least water vapor, and a dehydration processing step of holding the base member in an atmosphere having a smaller presence of water vapor than the atmosphere in the water vapor introduction step.
US08475879B1	Polymer nanocomposites with improved resistance to ionizing radiation Polymer nanocomposites with improved resistance to high energy ionizing radiation. Certain embodiments involve methods for providing a nanocomposite material with resistance to high energy ionizing radiation using nanodiamond, zinc oxide and mixtures of these nanoparticles with other nanoparticles dispersed within the matrix. Other embodiments relate to methods of delivering and dispersing the nanoparticles through the material or a surface layer. Other embodiments include methods of forming chemical bonds between the nanoparticles and the material. This abstract is not to be considered limiting, since other embodiments may deviate from the features described in this abstract.
US08475872B2	Patterning of thin film layers Simplified patterning of layers of a thin film is disclosed. In some embodiments, the patterning can include patterning a first conductive layer using a patterned dielectric layer as a mask and patterning a second conductive layer using a patterned passivation layer as another mask. In other embodiments, the patterning can include patterning a first conductive layer using a removable photosensitive layer as a mask, patterning a black mask layer using a removable photo mask, and patterning a second conductive layer using a patterned passivation layer as another mask. In still other embodiments, the patterning can include patterning a first conductive layer using a patterned black mask layer as a mask and patterning a second conductive layer using a patterned passivation layer as another mask. An exemplary device utilizing the thin film so patterned can include a touch sensor panel.
US08475869B2	Selective nanoparticle assembly systems and methods Disclosed are methods and systems for transferring dry or semi-dry nanoparticles onto a substrate. In one embodiment, this includes the steps of providing a roller comprising an elastomeric stamp; transferring nanoparticles in a dry or semi-dry state, and which contact the surface of a donor substrate, from the donor substrate onto the elastomeric stamp; and depositing the dry or semi-dry nanoparticles from the elastomeric stamp onto a receiver substrate by rolling the elastomeric stamp onto the receiver substrate. The substrate, in other embodiments, can have a relief structure.
US08475864B1	Method for removing an oxidized off-flavor from milk A method of reversing the formation of an oxidized off-flavor in milk that includes providing milk, and heating the milk to a temperature between approximately 70° C. and approximately 90° C. for a period of between approximately 25 seconds and approximately 60 seconds.
US08475862B2	Isothiocyanate preservatives and methods of their use A composition for preserving solid food products comprising a moisture-sensitive isothiocyanate compound and a hygroscopic carrier, wherein the composition is substantially free of sorbic acid, benzoic acid, and salts thereof. Also disclosed is a solid food product containing the aforementioned preservative composition and a method for preserving solid food products including the steps of adding a moisture-sensitive isothiocyanate to the solid food product and storing the resulting product at a reduced temperature.
US08475861B2	Process and installation for making a restructured meat article, device for compacting meat fragments and device for compressing an unfinished meat article In the process, at least one piece of meat is destructured by fragmenting it, and the meat fragments are transformed into a restructured meat article. The fragments are transformed into a restructured meat article by: forming a block of meat fragments by cohesive compaction of the meat fragments; removing at least a portion of the block, termed a preform; and compressing the preform between complementary surfaces for molding the preform. The meat fragment compacting device comprises two conveyor belts for cohesive compaction of the meat fragments, the belts converging from upstream to downstream relative to a direction of movement of the meat fragments. The device for compressing a preform for a meat article comprises pistons having surfaces for molding the preform, which surfaces vary from one piston to another.
US08475860B2	Method and system for preparing a liquid extract from a cell using centrifugal forces A method for preparing a liquid comestible from a cell by passing liquid through the substance using centrifugal forces, wherein gas contained in the cell is controllably purged from the cell as liquid fills the cell. In one embodiment, the method includes prewetting the substance in the cell by filling liquid in the cell and rotating the cell at a first rotational speed; and then extracting the liquid comestible from the cell in an extraction phase which comprises continuing to fill liquid into the cell and rotating the cell at a second rotational speed that is higher than the first rotational speed. The invention also discloses a cell for use in these methods which cell includes a filter for preventing solids from being carried by gas during the gas purge.
US08475859B2	Coffee dispensing device and method A coffee dispensing device is provided with a transport device that couples various components for the processing of unroasted coffee beans together. For example a roaster may be coupled to a grinding and brewing device to enable the transfer of roasted coffee beans between the roaster and grinder/brewer. Also, the transport device may transfer the roasted coffee beans from a roaster to an output port so that roasted coffee beans may be obtained. An automated coffee transaction device (ACTD) is also provided to automate aspects of the purchasing of coffee. A service delay projection calculator is also provided to estimate the expected wait time of a customer entering a queue.
US08475856B2	OTG (on the go) specialty multi-beverage container systems A multi-beverage container and mixing system to increase the convenience of mixing and transporting a variety of powder-based beverages in a single unit. The multi-beverage container employs a lid equipped with compartments designed to house multiple powder drink mixes and a container housing designed to accommodate water for mixing. At user activation, powder drink mix is released from a compartment and is mixed with the water to create the desired beverage for instant consumption by the user.
US08475853B2	Colour reduction in canola protein isolate In the recovery of canola protein isolates from canola oil seeds steps are taken to inhibit the formation of coloring components and to reduce the presence of materials tending to form coloring components, to obtain a lighter and less yellow canola protein isolate.
US08475851B2	Preparations with wood extracts of locust trees The present invention relates primarily to the use of locust tree (Gleditsia) wood or heartwood extracts as anti-cellulite active substances. The present invention further relates to certain locust-tree wood extracts and mixtures containing locust-tree wood extracts and corresponding cosmetic, dermatological or pharmaceutical preparations, which are suitable in particular for the prevention and treatment of cellulite in humans.
US08475846B2	Colored micaceous pigments having bismuth oxychloride appearance and performance effects A combination pigment having a mica and/or metal oxide-coated mica substrate, an absorption colorant coating, and a waxy film bonding the absorption colorant coating to the substrate.
US08475844B2	Fluoropolymer-based medical implant coating compositions Polymers of fluorinated monomers and acrylate and alkyl acrylates are disclosed which demonstrate improved performance as coatings for implantable devices. Such coatings may, for example, be used to release a bioactive agent from the medical device. One specific application lies in drug-eluting coatings for stents.
US08475843B2	Silyl ether-modified hydrophilic polymers and uses for medical articles Silane-functionalized hydrophilic polymers and polymeric matrices are described. Hydrophilic matrices can be formed from the polymers, and can be used in association with the preparation of implantable and injectable medical devices. Exemplary devices include those having a durable lubricious coating formed from the hydrophilic polymers.
US08475836B2	Topical patch for pain relief using cooling agent Topical patch preparations that contain an odorless physiological cooling agent, and methods for using the same are provided. The subject topical patch preparations are made up of an adhesive gel composition that is present on a support, where the adhesive gel composition includes the odorless physiological cooling agent, a water-soluble polymer gel, water and a water holding agent. In using the subject topical patch preparations, the topical patch preparations are applied to a skin surface of a subject and maintained at the site of application for a period of time sufficient for an effective amount of the an odorless physiological cooling agent to be administered to the subject. The subject invention finds use in a variety of applications.
US08475835B2	Transdermal preparation Provided is a transdermal preparation, which is capable of long-term (1-day to 7-day) release of a basic drug from a preparation, continuously and at a consistent concentration; shows little reduction over time in the drug content, even if multiple drugs are contained in the preparation; and is produced by a simple process. The transdermal preparation comprises a substrate, and an adhesive layer containing a basic drug and a water-soluble polymer.
US08475834B2	Method of improving absorption of vitamin E by a pet animal A method of providing a pet with a benefit relating to effective assimilation of a lipid is described wherein the pet is administered, as a part of, or in addition to its regular diet, an edible composition that contains an ingredient that maintains, promotes or enhances the capacity of the pet to digest lipid efficiently. The invention extends to compositions for use in promoting lipid assimilation in pets, particularly senior or elderly pets. The compositions include pancreatic, liver and intestinal mucosa function-promoters. In embodiments, the liver function-promoter may be selected from taurine, emulsifiers, vitamins, minerals, glutathione and glutathione promoters.
US08475833B2	Jelly-form preparation and method for producing jelly-form preparation Provided is a jelly preparation which enables easy intraoral dissolution thereof, easy adjustment of the dissolution time, and stable containment of a drug therein. The jelly preparation of the present invention is a jelly preparation including water, a gelatin, a drug, and a trivalent metal ion.
US08475831B2	Treatment of ophthalmic conditions Ophthalmic conditions such as presbyopia, myopia, and astigmatism can be corrected by the use of a molding contact lens in combination with a pharmaceutical composition suitable for delivery to the eye. The molding contact lenses are preferably commercially available and are not specifically designed for orthokeratology. The agents in the pharmaceutical compositions such as hyaluronase allow the cornea of the eye to be molded in order to correct the refractive error of the eye. The contact lenses and the pharmaceutical composition induce a change in the radius of curvature of the anterior surface of the cornea, thereby correcting the refractive error of the eye. One advantage of the inventive technique is that the patient with his or her own individual visual needs guides the treatment until the patient near and far visual needs are met. The present invention also provides for kits, which contain molding contact lenses, pharmaceutical composition suitable for delivery to the eye, and instructions, useful in the inventive system.
US08475829B2	Implants for the treatment of dopamine associated states Biodegradable implants comprising dopamine modulating compounds are described.
US08475826B2	Titanium oxide-organic polymer conjunction suitable for artificial bone The titanium oxide-organic polymer composite material for artificial bone obtained by forming titania gel on the surface of said base material by titania solution treatment to dip into a solution of 0° C. to 50° C. temperature for from several seconds to 1 week obtained by adding a solution consisting of acidic alcohol and water into alcohol solution of titaniumtetraalcoxide to a base material composed of a polymer compound selected from a group consisting of polyolefin, polyester and nylon, and modifying to a titanium oxide membrane which forms apatite having similar Ca/P atom ratio to an apatite of mammalian's bone in supersaturated aqueous solution to apatite or from a body fluid of mammalian by dipping said base material on the surface of which titania gel is formed into hot water of. 50° C. to 95° C. or solution of room temperature to 95° C. to which acid is added.
US08475825B2	Cyanoacrylate initiator system The present invention is directed to curable compositions that comprise a non-porous substrate, one or more cyanoacrylate polymerization initiators and a prepolymer composition comprising at least one liquid cyanoacrylate monomer or mixture of such monomers (solid or liquid) and/or cyanoacrylate oligomers. The non-porous substrate is a collection of individual particulates that are not bound, bonded or fixed to one another. At least one initiator is deposited on the surface of the individual particulates to form a plurality of initiator carriers. The prepolymer composition receives the plurality of initiator carriers to begin a controlled and consistent polymerization or curing of the liquid cyanoacrylate monomer in order to produce a biocompatible adhesive composition for use on living tissue. The present invention also provides for methods of making and using and devices for such a curable compositions, particularly in treating living tissue by applying to living tissue a biocompatible adhesive composition.
US08475823B2	Baclofen formulation in a polyorthoester carrier Effective treatments of pain for extended periods of time are provided. The treatments include the administration of one or more drug depots intraspinally wherein the drug depots include an effective amount of baclofen formulated within a polyorthoester. By administration of one or more drug depots, one can relieve pain caused by diverse sources, including but not limited to chronic pelvic pain syndromes, spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discongenic back pain and joint pain, as well as pain that is incidental to surgery. In some embodiments, the relief can be for at least thirty days, at least sixty days, at least one hundred days or at least one hundred and thirty-five days.
US08475821B2	Bone prosthetic material and method of manufacturing the same A method of manufacturing a bone prosthetic material, includes by forming tricalcium phosphate (TCP) particle precursor particles; by performing preliminary sintering on the TCP precursor particles at a temperature in a first temperature range to produce TCP particles of diameters in a predetermined diameter range; by granulating the TCP particles to produce granulated bodies; and by performing sintering on the granulated bodies at a temperature in a second temperature range to generate sinter assemblies. The second temperature range is higher than the first temperature range. In the bone prosthetic material manufactured thus, a first space in a range of 100 to 400 μm is formed between adjacent two of a plurality of sintered assemblies. Each of the plurality of sintered assemblies includes tricalcium phosphate (TCP) particles which are subjected to sintering, and a second space in a range of 5 to 100 μm is formed between adjacent two of the TCP particles. The second space communicates with the first space. Each of the plurality of sintered assemblies has a connection portion connecting the TCP particles, and the connection portion has a width in a range of 5 to 20 μm.
US08475819B2	Cyano anthranilamide insecticides This invention provides compounds of Formula 1, N-oxides and suitable salts thereof wherein R1 is Me, Cl, Br or F; R2 is F, Cl, Br, C1-C4 haloalkyl or C1-C4 haloalkoxy; R3 is F, Cl or Br; R4 is H; C1-C4 alkyl, C3-C4 alkenyl, C3-C4 alkynyl, C3-C5 cycloalkyl, or C4-C6 cycloalkylalkyl, each optionally substituted with one substituent selected from the group consisting of halogen, CN, SMe, S(O)Me, S(O)2Me, and OMe; R5 is H or Me; R6 is H, F or Cl; and R7 is H, F or Cl. Also disclosed are methods for controlling an invertebrate pest comprising contacting the invertebrate pest or its environment with a biologically effective amount of a compound of Formula 1, an N-oxide thereof or a suitable salt of the compound (e.g., as a composition described herein). This invention also pertains to a composition for controlling an invertebrate pest comprising a biologically effective amount of a compound of Formula 1, an N-oxide thereof or a suitable salt of the compound and at least one additional component selected from the group consisting of a surfactant, a solid diluent and a liquid diluent.
US08475815B2	Alloplastic injectable dermal filler and methods of use thereof A composition comprising an alloplastic injectable suspension for use as a dermal filler comprising a biocompatible and pliable material and a physiologically acceptable suspending agent comprising particles of the unsubstituted acrylate/substituted acrylate copolymer with a diameter of less than about 100μ. Methods for making a composition comprising an alloplastic injectable suspension for use as a dermal filler are provided. Methods of augmenting soft tissue to provide long-term reduction of a skin defect and the stimulation of collagen production are also provided.
US08475813B2	Methods of treatment using a gastric retained gabapentin dosage A method of treatment for epilepsy and other disease states is described, which comprises delivery of gabapentin in a gastric retained dosage form.
US08475812B2	Gelatin sponge comprising an active ingredient, its preparation and use The present invention is directed to a method for manufacturing a cross-linked gelatin sponge having a surface by providing a cross-linked gelatin sponge, wetting the surface of the sponge by applying a sufficient amount of liquid comprising a protein or peptide active ingredient, wherein a sufficient amount of liquid is one that retains the flexibility of the sponge even after drying. The sponge is then dried the sponge to obtain a flexible, dry and ready to use cross linked gelatin sponge having a layer of protein or peptide active ingredient on the surface thereof.
US08475810B2	Attenuated Salmonella enterica serovar paratyphi a and uses thereof The present invention is drawn to a live, attenuated S. Paratyphi A strain, a live, attenuated S. Paratyphi A strain comprising a stabilized plasmid expression system, and methods of using these strains.
US08475809B2	Composition comprising sortase anchored surface proteins of Streptococcus uberis The present invention provides an immunogenic composition comprising one or more Streptococcus uberis sortase-anchored surface proteins, or an immunogenic part thereof, wherein the composition is capable of eliciting an immune response, when administered to a subject.
US08475805B2	Methods of reducing concomitant infections in pigs with a PCV2 antigen The present invention relates to a method for reducing the percentage of concomitant infections in pigs or a herd of pigs caused by pathogens other than PCV2 comprising the step administering to said pig(s) an effective amount of PCV2 antigen or an immunogenic composition comprising PCV2 antigen. It also refers to a method for improving the resistance of pigs against concomitant infections with pathogens other than PCV2, comprising the step administering to said pig(s) an effective amount of PCV2 antigen or an immunogenic composition comprising PCV2 antigen.
US08475802B2	Peptide sequences and compositions Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3DLIFLARSALILRGSVAHKSC SEQ ID 4PGIADIEDLTLLARSMVVVRP SEQ ID 5LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
US08475801B2	IgE CH3 peptide vaccine The present invention relates to the provision of novel immunogens comprising an antigenic IgE peptide preferably linked to an immunogenic carrier for the prevention, treatment or alleviation of IgE-mediated disorders. The invention further relates to methods for production of these medicaments, immunogenic compositions and pharmaceutical compositing thereof and their use in medicine.
US08475800B2	Phosphorylated derivatives of a U1-70K peptide and their use in the treatment of autoimmune pathologies Derivatives of the peptide corresponding to the sequence RIHMVYSKRSGKPRGYAFIEY (SEQ ID NO: 1), pharmaceutical compositions, and methods of use thereof are provided.
US08475795B2	Anti-folate receptor alpha antibodies and uses thereof Described herein are antibodies, and antigen-binding fragments thereof, that are specific for folate receptor alpha, related polynucleotides, expression vectors, and cells that express the described antibodies. Also provided are methods of using the described antibodies, and antigen-binding fragments thereof, and related kits. Provided herein are also methods for diagnosing cancers, such as breast cancer, thyroid cancer, colorectal cancer, endometrial cancer, fallopian tube cancer, ovarian cancer, or lung cancer, using the described antibodies, and antigen-binding fragments thereof. The methods involve determining the amount of folate receptor alpha in a sample derived from a subject and comparing this level with the level of folate receptor alpha in a control sample or reference sample.
US08475794B2	Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases Disclosed herein are compositions and methods of use comprising combinations of anti-CD74 antibodies with a therapeutic agent. The therapeutic agent may be attached to the anti-CD74 antibody or may be separately administered, either before, simultaneously with or after the anti-CD74 antibody. In preferred embodiments, the therapeutic agent is an antibody or fragment thereof that binds to an antigen different from CD74, such as CD19, CD20, CD21, CD22, CD23, CD37, CD40, CD40L, CD52, CD80, IL-6, CXCR4 and HLA-DR. However, the therapeutic agent may an immunomodulator, a cytokine, a toxin or other therapeutic agent known in the art. More preferably, the anti-CD74 antibody is part of a DNL complex, such as a hexavalent DNL complex. Most preferably, combination therapy with the anti-CD74 antibody or fragment and the therapeutic agent is more effective than the antibody alone, the therapeutic agent alone, or the combination of anti-CD74 antibody and therapeutic agent that are not conjugated to each other. Administration of the anti-CD74 antibody and therapeutic agent induces apoptosis and cell death of target cells in diseases in which CD74 is overexpressed, such as solid tumors, B-cell lymphomas or leukemias, autoimmune disease, immune dysfunction disease, type 1 or type 2 diabetes.
US08475792B2	Molecules with extended half-lives, compositions and uses thereof The present invention provides molecules, including IgGs, non-IgG immunoglobulins, proteins and non-protein agents, that have increased in vivo half-lives due to the presence of an IgG constant domain, or a portion thereof that binds the FcRn, having one or more amino acid modifications that increase the affinity of the constant domain or fragment for FcRn. Such proteins and molecules with increased half-lives have the advantage that smaller amounts and or less frequent dosing is required in the therapeutic, prophylactic or diagnostic use of such molecules.
US08475789B2	Products and methods to prevent infections The present invention relates to products and methods for preventing, ameliorating and/or treating infections and other diseases. In one aspect, the products of the present invention relates to compositions comprising germ free colostrum. In another aspect, the products of the present invention relates to compositions comprising synthetically multimerised immunoglobulins. In a third aspect, the products of the present invention relates to compositions comprising germ free colostrum enriched with synthetically multimerised immunoglobulins. The invention also relates to use of said compositions as a pharmaceutical e.g. for prophylactic or ameliorating treatment of infections and other diseases. In addition the invention comprises methods for production of said compositions.
US08475787B2	Beneficial effects of bacteriophage treatments The invention relates to use of one or more bacteriophages in vivo in a human or animal in order to induce sensitivity to chemical antibiotics in bacterial cells, where such susceptibility is heritable, independent of continuing bacteriophage metabolism within those cells, and does not relate to the destruction of a biofilm to induce such sensitivity.
US08475785B2	Allogeneic cancer cell-based immunotherapy Cell-based immunotherapy (e.g., immunization or vaccination) may be improved by frequent administration to a human subject of allogeneic cancer cells secreting a modified heat shock protein (e.g., gp96), depletion of B cells in the subject, or both. Antigen (e.g., epitope derived from neoantigen or tumor antigen of allogeneic or syngeneic cancer cells) may induce a specific immune response in the subject. For example, the epitope bound in an immunogenic complex with the secreted heat shock protein may be obtained from allogeneic cancer cells coexpressing both secreted gp96 and antigen, or from syngeneic cancer cells of the subject expressing only antigen.
US08475780B2	Ion binding polymers and uses thereof The present invention provides methods and compositions for the treatment of ion imbalances. In particular, the invention provides compositions comprising potassium binding polymers and pharmaceutical compositions thereof. Methods of use of the polymeric and pharmaceutical compositions for therapeutic and/or prophylactic benefits are disclosed herein. Examples of these methods include the treatment of hyperkalemia, such as hyperkalemia caused by renal failure and/or the use of hyperkalemia causing drugs.
US08475777B2	Silicone emulsions, and methods for the production thereof Emulsions of high viscosity silicones are prepared by emulsifying a lower viscosity condensable silicone with a partial phosphate ester surfactant, and ripening the emulsion to obtain a higher viscosity silicone dispersed phase without generation of objectional amounts of octaorganocyclotetrasiloxanes. The emulsions are well suited for body care products.
US08475775B1	Retinoids and use thereof The present invention provides new retinoid compounds and uses of the compounds in humans and animals for non-neoplastic dermal or inflammatory conditions or disorders.
US08475768B2	Paramagnetic chelates thereof and their use as contrast agents in magnetic resonance imaging (MRI) The present invention relates to chelators, in particular to chelators which are capable of forming complexes, i.e. paramagnetic chelates, with paramagnetic metal ions. The invention also relates to said paramagnetic chelates, said paramagnetic chelates linked to other molecules and their use as contrast agents in magnetic resonance imaging (MRI).
US08475767B2	Anti-trypanosomal peptides and uses thereof The present invention provides methods of killing, inhibiting the growth, and/or inhibiting the reproduction of kinetoplastid protozoan with hydrophobic signal sequence peptides and compositions including such hydrophobic signal sequence peptides.
US08475763B2	Method of determining the course of treatment for a patient having adenocarcinoma A method for detecting antigen associated with adenocarcinoma commences by forming a 124I conjugate of a preferential locator, such as an antibody, and introducing the conjugate into a patient suspected of having adenocarcinoma. Positron emission tomography (PET) scanning of the patient reveals sites of accumulated conjugate, such sites including lymph nodes. The course of treatment of the patient then is determined by the amount of revealed lymph nodes.
US08475762B2	Method and apparatus to minimize air-slurry separation during gypsum slurry flow A method and apparatus for providing an evenly mixed additive enhanced gypsum slurry to a web. Calcined gypsum and water are inserted into a mixer through at least one inlet of the mixer. The contents are agitated to form a slurry. The slurry is passed from an outlet of the mixer into a conduit. An additive is introduced into the slurry along a length of the conduit to achieve a flow stream of a slurry/additive mixture. A cross section of the flow stream is expanded in the conduit while not changing direction of the flow stream and a direction of the flow stream is changed while not expanding the cross section of the flow stream and conduit, all prior to the flow steam exiting from an outlet of the conduit.
US08475756B1	Method for the production of uranium chloride salt A method for the production of UCl3 salt without the use of hazardous chemicals or multiple apparatuses for synthesis and purification is provided. Uranium metal is combined in a reaction vessel with a metal chloride and a eutectic salt- and heated to a first temperature under vacuum conditions to promote reaction of the uranium metal with the metal chloride for the production of a UCl3 salt. After the reaction has run substantially to completion, the furnace is heated to a second temperature under vacuum conditions. The second temperature is sufficiently high to selectively vaporize the chloride salts and distill them into a condenser region.
US08475748B2	Metal solvent extraction reagents and use thereof Reagent compositions, methods for their manufacture and methods of their use are described. In particular, provided are reagent compositions comprising an aldoxime and ketoxime with an alkyl substituent. Also provided are methods of metal recovery using these reagent compositions.
US08475744B2	Solution bag for apparatus for chemically analyzing blood The present invention provides a solution bag that is used for medical treatment and stores solution used for an apparatus for analyzing blood chemistry that measures and analyzes the concentrations of electrolytes, the partial pressures of gases, and the concentrations of metabolites or the volume ratio of red blood cells contained in blood. The solution bag for an apparatus for analyzing blood chemistry of the present invention includes: a receptacle that contains a solution; a valve body that is attached to the receptacle and has a through-hole longitudinally formed therein; a valve spool that is disposed in the through-hole of the valve body; and a solution leakage preventing unit that is disposed in the valve spool, in which the valve body has a flow channel and a solution discharging pipe spaced at a predetermined distance from each other.
US08475738B2	Photocatalytic apparatus and method for injecting microfluidic volumes Provided is a microfluidic injection device and a method for injecting microfluidic. The microfluidic injection device includes a fluid injection chamber, a gas generation chamber applying pressure to the fluid injection chamber, and a channel connecting the fluid injection chamber to the gas generation chamber.
US08475735B2	Disposable immunodiagnostic test system A disposable immunodiagnostic test system tests for marker proteins in a sample and includes intimately contacting passage, protein, and absorbent layers. The passage layer is non-porous and has an aperture therethrough. The protein layer is porous, has combinable proteins immobilized thereon, and enables passage of the sample therethrough. The protein layer has an active surface aligned with the passage layer aperture. The sample is introduced onto the protein layer through the passage layer aperture. In positive results, the marker proteins are bound to the combinable proteins and immobilized relative to the protein layer. In negative results, the sample passes through the protein layer, and is absorbed by the absorbent layer. A housing may also be provided, as may a wash structure. The system may be constructed of combustible materials that produce non-toxic by-products upon incineration, preferably enabling ecologically responsible disposal after diagnostic use of the system.
US08475730B2	Apparatus for single cell separation and position fixing The present invention relates to an apparatus for single cell trap and position fixing of the trapped cell thereof, and specifically, it induces cell movement from where fluid flows strongly to where the fluid flows weakly, by injecting pressed air to an air channel to modify a thin film of a vibrator, and therefore to induce the fluid flow. Further, the present invention relates to an apparatus which can fix the cell position as well as minimizing the external stimulation to the cells, wherein single cells are trapped in a region wherein the fluid flows are minimized and their positions are fixed using the effect that the fluid flows induced by the vibrators are offset one another because the vibrators are formed symmetrically one another.
US08475729B2	Methods for forming honeycomb minireactors and systems A method of forming a honeycomb reactor or reactor component is disclosed, including the steps of providing a honeycomb structure having cells divided by cell walls, providing an array of cutting tools arrayed in a pattern so as to be able to simultaneously align with a first plurality of the cell walls at a first end of the structure, and cutting the walls of the first plurality, reducing their height. Systems utilizing the reactors or reactor components thus formed are also disclosed.
US08475726B2	Reactor and apparatus for pyrolyzing waste, especially tyre A reactor (6) for pyrolysing waste, in particular rubber tires, said reactor comprising a pyrolysis space (68), an inlet port (63) and an outlet port (64) enabling a flow across the pyrolysis space (68) of a heating medium for transferring heat required for the pyrolysis, and a lower discharge port (62) for discharging solid residues of the pyrolysis. The invention is, characterized in that—it comprises a baffle means (65) made of a plate material and enabling a gravitational slipping of the solid residues towards the discharge port (62), which baffle means (65) has openings (66) allowing the flow of the heating medium and is arranged to divide the inner space of the reactor (6) to form an upper pyrolysis space (68) and a lower space and—one of the inlet and outlet ports (63, 64) is in connection with the pyrolysis space (68) and the other one with the lower space. The invention is also an apparatus comprising the above reactor (6).
US08475725B1	System and method for liquid treatment A method and energy-efficient apparatus for the treatment of liquids through the joint use of a gas mixture-oxidizing agent and UV radiation. This method uses an excimer UV lamp performing two actions affecting the liquid and changing its properties with UV radiation and the generation of a gas mixture containing strong oxidizing agents for influence on the liquid, disinfection and purification of the liquid being treated from contaminants. The apparatus incorporates energy efficient design features to reduce energy consumption and operational costs, as well as an excimer lamp design that improves performance parameters to surpass and outlast existing devices. Unique electrode designs, cleaning systems, and materials combine to create a state-of-the-art liquid treatment apparatus that exceeds existing industrial analogs and norms.
US08475721B2	Holding sealer and exhaust gas processing device A holding sealer for keeping a exhaust gas processing device, in which comprises a sheet member including inorganic fibers, the inorganic fibers are oriented in a predetermined angle except parallel against a direction of a thickness of a sheet member within at least a portion of the sheet member.
US08475720B2	Method for improving a polymerization reaction by taking out and analysing a sample The disclosure relates to a device for removing and analyzing a sample from a polymerization reactor including one or more sample conduits for removing a sample from the reactor and transferring the sample to a sample flash tank, whereby the conduits are in communication with the reactor and are provided with at least two sampling valves; a sample flash tank for separating said solid particles and evaporated gas, whereby the sample flash tanks are connected to the conduits and provided with a device for analyzing evaporated gas, and including a sample receiver for purifying the solid particles. The receivers are connected to the sample flash tanks and provided with an apparatus for analyzing the solid particles. The disclosure includes a method for improving a polymerization reaction.
US08475719B1	Electric censer An electric censer includes a censer body, a receiving unit and an incense branch. The censer body is a hollow container with an opening defined at a top thereof. The receiving unit is received in the censer body and includes a hollow tube communicating with the opening of the censer body. The incense branch includes a light guiding bar and a light emitting unit positioned on a bottom end the light guiding bar. A top end of the light guiding bar extends outwardly from the opening of the censer body and act as a light outputting side of the incense branch. The position of the light emitting unit is adjustable by pressing or pulling the light guiding bar.
US08475718B2	Method and apparatus for controlling fecal odors Methods and apparatus for controlling fecal odors in an enclosed space, such as a pit latrine, include providing an oxidizer, such as a catalytic heater and an optional mechanical ventilation unit, such as an inline fan, both flow connected to a vault (pit) of the latrine. The heater is also connected to a source of fuel, for example, propane. Fresh air is drawn through vents in the latrine housing and thereafter through toilets in the latrine and through the vault, providing oxygen for the reaction. The fan and/or oxidation process draws both fresh air and accompanying odorous compounds directly from the latrine and into the oxidizer wherein the odorous components are substantially destroyed.
US08475717B2	Explosive or drug detection reporting system A police tester to detect the presence of a target substance includes a housing adapted to be mounted in a police cruiser; a chemical reservoir insertable into the housing; a test swipe in a disc or an automated cartridge, the test swipe adapted to receive a chemical from the chemical reservoir, the test swipe including one or more chemically treated pads; a camera to capture an image from the test swipe; a processor coupled to the camera to process the image to detect the target substance; and a transmitter coupled to the processor to transmit a test result to a remote computer at a police headquarter.
US08475712B2	Arrangement for neutralisation or microorganisms An arrangement for the exposure of a pumpable medium to an electric field. The arrangement comprises, at least two power supplies (100) for the generation of electrical voltage, at least one non-conducting chamber (102) for pumping said pumpable medium, which said at least one chamber (102) is provided with a first (106) and a second electrode plate (108), a control means (104) for controlling said at least two power supplies (100). During control the control means (104), by synchronous control, establishes a series connection between at least two of said at least two power supplies (100), the first electrode plate (106) and the second electrode plate (108). A resulting composite voltage arises between the first (106) and the second electrode plate (108), which resulting composite voltage will result in an electric field between the first (106) and the second electrode plate (108). The pumpable medium is exposed to the electric field. A method for the exposure of a pumpable medium to an electric field is also provided.
US08475710B2	Cemented carbide body and method A method of producing a cemented carbide body provides: (1) a grain refiner compound comprising a grain refiner and carbon and/or nitrogen, and, (2) a grain growth promoter, on at least one portion of the surface of a compact of a WC-based starting material comprising one or more hard-phase components and a binder, and then sinters the compact. The invention also relates to a cemented carbide body comprising a WC-based hard phase and a binder phase, wherein at least one part of an intermediate surface zone has a lower average binder content than a part further into the body, and at least one part of an upper surface zone has in average a larger average WC grain size than the intermediate surface zone. The cemented carbide body can be used as a cutting tool insert for metal machining, an insert for a mining tool, or a coldforming tool.
US08475708B2	Support post clamps for molten metal pumps An improved post clamp for a molten metal pump includes a support post clamp that supports the weight of a pump superstructure on the top of the support posts. The clamp preferably includes (a) a bottom flange for connecting to the pump superstructure, (b) a cavity for receiving an end of a support post, wherein the end has a top surface, and (c) a top flange for being positioned above the top surface. In operation the top flange rests on the top surface of the support post thereby supporting at least part of the weight of the superstructure. It is preferred that a plurality of support posts and post clamps according to the invention be used with a molten metal pump wherein the top surface of each support post supports some of the weight of the superstructure. Also disclosed are novel support posts that may be used with the post clamp, and a pump in which the post clamp and/or support posts may be used.
US08475707B2	Method of manufacturing direct reduction iron and reduction firing apparatus An apparatus and a method of manufacturing direct reduction iron and a reduction firing apparatus. The apparatus has a reduction furnace including a left chamber, a right chamber, a material containing device, a step mechanism, a slag distributing device, a charging device, heating burners, a fume extraction path, a charging device, a material receiving tank and a slag discharging path. The method includes the following steps: distributing and charging the slag in the material containing device; carrying and sending the material containing device through a preheating station, a heating station and a reduction station sequentially. Meanwhile, heating the material to be reduced by a combustion of fuel with the heating burners; discharging the reduced material into the material receiving tank; placing the material device from which the material is discharged into the feeding side of the other chamber, then a next work circulation begins.
US08475704B2	Fabrication of printhead nozzle plate coating with self cleaning and high drool pressure by electrospinning technique Exemplary embodiments provide materials and methods for ink jet printhead nozzle plate and related printing apparatus, wherein the ink jet printhead nozzle plate can include a coaxially electrospun layer to provide a low adhesion oleophobic textile surface exhibiting a low sliding angle and a high contact angle with ultra-violet gel ink and/or solid ink.
US08475703B2	Method of orientating fillers in composite materials A method is provided of fabricating a composite incorporating fillers. The method includes the steps of depositing the fillers in a matrix material either in a rapid prototyping device or prior to inserting the matrix material into a mold. The mold is positioned at a desired location with respect to an electrical field such that at least a portion of the fillers in the matrix material align in a first direction in response thereto. For producing a heterogeneous composite through a rapid prototyping process, the electrodes are positioned at a desired orientation to align the fillers. Thereafter, at least a portion of the matrix material is cured with desirable filler orientation. The procedure is repeated with the desired filler orientation and distribution being introduced layer by layer within the composite.
US08475702B2	Imprint device and imprint method According to one embodiment, first image information of a mold is acquired by irradiating the mold with first light, the mold having an uneven pattern with a shape corresponding to a pattern to be transferred onto a substrate to be processed. The position of the uneven pattern of the mold is adjusted by applying stress to the mold. Second image information is acquired by irradiating the mold whose position is adjusted with the first light. Stress information of the mold whose position is adjusted is measured by comparing the first image information with the second image information. The position adjustment is repeated until the measurement result satisfies a desired condition, and a pattern is formed on the substrate by using the mold whose position is adjusted.
US08475699B2	Method for rounding edges of openings in a tubular body and a product thereof A method for rounding at least a part of an edge of an opening in a tubular body formed of thermo-formable material, wherein a mandrel is brought into contact with the edge and the mandrel has a temperature that allows it to permanently deform the material of the tubular body and a product thereof.
US08475696B2	Method for packaging light emitting diode A method for packaging a light emitting diode is provided. The steps comprise: providing a material; drying the material; feeding the material into a feeding inlet; and providing a mold with pre-embedded light diodes. The material enters the feeding inlet and is injected into the mold by pressing a screw, allowing the material to combine with the light emitting diode.
US08475695B2	Ceramic composite with integrated compliance/wear layer The integral layer provides a ductile interface for attachment locations of a turbine engine component where a metallic surface is adjacent the attachment location. The ductile layer provides a favorable load distribution through the composite at the attachment location, and eliminates the need for a metallic shim.
US08475693B2	Methods of making substrate structures having a weakened intermediate layer This invention provides composite semiconductor substrates and methods for fabricating such substrates. The composite structures include a semiconductor substrate, a semiconductor superstrate and an intermediate layer interposed between the substrate and the superstrate that comprises a material that undergoes a structural transformation when subject to a suitable heat treatment. The methods provide such a heat treatment so that the intermediate layer becomes spongy or porous, being filled with numerous micro-bubbles or micro-cavities containing a gaseous phase. The composite semiconductor substrates with structurally-transformed intermediate layers have numerous applications.
US08475690B2	Diffusing agent composition, method of forming impurity diffusion layer, and solar battery An embodiment of the present invention relates to a diffusing agent composition used in printing an impurity-diffusing component onto a semiconductor substrate, wherein the diffusing agent composition contains: a hydrolysis product of alkoxysilane (A); a component (B) containing at least one selected from the group consisting of a hydrolysis product of alkoxy titanium, a hydrolysis product of alkoxy zirconium, titania fine particle, and zirconia fine particle; an impurity-diffusing component (C); and an organic solvent (D).
US08475689B2	Topical composition containing galvanic particulates A topical composition containing galvanic particulates consisting of a first conductive material that is zinc and a second conductive material that is copper is provided.
US08475683B2	Yellow-green to yellow-emitting phosphors based on halogenated-aluminates Disclosed herein are yellow-green and yellow-emitting aluminate based phosphors for use in white LEDs, general lighting, and LED and backlighting displays. In one embodiment of the present invention, the cerium-activated, yellow-green to yellow-emitting aluminate phosphor comprises the rare earth lutetium, at least one alkaline earth metal, aluminum, oxygen, at least one halogen, and at least one rare earth element other than lutetium, wherein the phosphor is configured to absorb excitation radiation having a wavelength ranging from about 380 nm to about 480 nm, and to emit light having a peak emission wavelength ranging from about 550 nm to about 600 nm.
US08475681B2	Neutron scintillating materials Neutron scintillating materials are provided, including boron substitution scintillation materials, boron and Li substitution scintillation materials, and Gd-based substitution scintillation materials.
US08475677B2	Etchant gas An etchant gas and a method for removing at least a portion of a late transition metal structure. The etchant gas includes PF3 and at least one oxidizing agent, such as at least one of oxygen, ozone, nitrous oxide, nitric oxide and hydrogen peroxide. The etchant gas provides a method of uniformly removing the late transition metal structure or a portion thereof. Moreover, the etchant gas facilitates removing a late transition metal structure with an increased etch rate and at a decreased etch temperature. A method of removing a late transition metal without removing more reactive materials proximate the late transition metal and exposed to the etchant gas is also disclosed.
US08475673B2	Method and apparatus for high aspect ratio dielectric etch An apparatus for etching high aspect ratio features is provided. A plasma processing chamber is provided, comprising a chamber wall forming a plasma processing chamber enclosure, a lower electrode, an upper electrode, a gas inlet, and a gas outlet. A high frequency radio frequency (RF) power source is electrically connected to at least one of the upper electrode or lower electrode. A bias power system is electrically connected to both the upper electrode and the lower electrode, wherein the bias power system is able to provide a bias to the upper and lower electrodes with a magnitude of at least 500 volts, and wherein the bias to the lower electrode is pulsed to intermittently. A gas source is in fluid connection with the gas inlet. A controller is controllably connected to the gas source, the high frequency RF power source, and the bias power system.
US08475672B2	Plasma processing device, plasma processing method and method of manufacturing element including substrate to be processed The present invention provides a plasma processing device and a plasma processing method that can easily adjust plasma density distribution while making the plasma density uniform, and a method of manufacturing an element including a substrate to be processed. In an embodiment of the present invention, the inside of a vacuum vessel (1) is divided by a grid (4) having communication holes into a plasma generation chamber (2) and a plasma processing chamber (5). On the upper wall (26) of the plasma generation chamber (2), magnetic coils (12) are arranged such that magnetic field lines within the vacuum vessel (1) point from the center of the vacuum vessel (1) to a side wall (27), and, outside the side wall (27) of the plasma generation chamber (2), ring-shaped permanent magnets (13) are arranged such that a polarity pointing to the inside of the vacuum vessel (1) is a north pole and a polarity pointing to the outside of the vacuum vessel (1) is a south pole.
US08475669B2	System, method and apparatus for master pattern generation, including servo patterns, for ultra-high density discrete track media using e-beam and self-assembly of block copolymer microdomains A system, method, and apparatus for forming a high quality master pattern for patterned media, including features to support servo patterns, is disclosed. Block copolymer self-assembly is used to facilitate the formation of a track pattern with narrower tracks. E-beam lithography forms a chemical contrast pattern of concentric rings, where the spacing of the rings is equal to an integral multiple of the target track pitch. The rings include regions within each servo sector header where the rings are offset radially by a fraction of a track pitch. Self-assembly is performed to form a new ring pattern at the target track pitch on top of the chemical contrast pattern, including the radial offsets in the servo sector headers. When this pattern is transferred to disks via nanoimprinting and etching, it creates tracks separated by nonmagnetic grooves, with the grooves and tracks including the radial offset regions.
US08475668B2	Substrate liquid processing apparatus, substrate liquid processing method, and storage medium having substrate liquid processing program stored therein Provided are a substrate liquid processing apparatus, a substrate liquid processing method, and a computer readable storage medium having a substrate liquid processing program stored therein that can prevent the occurrence of the electrostatic breakdown caused by the discharge of electric charges in a substrate. The substrate liquid processing apparatus processes a circuit-forming surface of the substrate with a chemical liquid. Furthermore, prior to processing the substrate with the chemical liquid, the substrate liquid processing apparatus performs an anti-static process for an surface opposite to the circuit-forming surface of the substrate by an anti-static liquid, thereby emitting the electric charges on the substrate.
US08475665B2	Nanoparticle filter Technologies are generally described for a nanoparticle filter and system effective to move a nanoparticle from a fluid to a location. In some examples, the method includes providing the fluid including the nanoparticles. In some examples, the method further includes applying a first light to the fluid to create a first plasmon. In some examples, the first plasmon is effective to aggregate the nanoparticles to generate a nanoparticle aggregation. In some examples, the method includes applying a second light to the fluid to create a second plasmon. In some examples, the second plasmon is effective to move the nanoparticle aggregation to a location.
US08475663B2	Vessel and method for treating contaminated water A method for removing immiscible fluid from contaminated water includes at least one chamber; an injection line in fluid communication with an inlet of the one chamber; bubble generation means in fluid communication with the injection line for injecting gas bubbles into the injection line and allowing mixing in the injection line of the gas bubbles and the contaminated water to form an inlet fluid; an inlet weir within the chamber adjacent the inlet; an immiscible fluid weir within the chamber; a trough for collecting the immiscible fluid and allowing the immiscible fluid to flow out of the at least one chamber through an immiscible fluid outlet; and a cleaned water outlet generally at the bottom of the chamber.
US08475661B2	Asymmetric nanotube containing membranes This invention relates to heterogenous pore polymer nanotube membranes useful in filtration, such as reverse osmosis desalination, nanofiltration, ultrafiltration and gas separation.
US08475659B2	Strainers for emergency core cooling systems—ECCS A strainer wall structure that removes foreign substances from a fluid suctioned into a pipe and a re-circulation pump that is part of an emergency core cooling system (ECCS). The strainer wall structure has an inlet side and an outlet side through which cooling water is introduced and discharged, respectively, and includes a body having an opening in a direction of the inlet side, closed side surfaces, and an outlet port disposed at one of the closed side surfaces. The strainer includes a punched plate filter screen inserted into the opening. A modular cassette apparatus including grooved first filter plates is inserted into the body, and second filter plates having second grooves is inserted into the first grooves.
US08475657B2	Method and device for filtering liquid in an aquarium The method and device for filtering liquid in an aquarium, the filtration device made by the liquid filtration method comprises a box-shaped casing, the filtration bodies and filtration materials are set inside the casing, wherein the casing includes a water inlet set around the casing and grid panels set inside both sides of the casing; the filtration bodies include an inner filtration body set inside the grid panels and an outer filtration body set outside the grid panels; the filtration materials are filled inside the casing, between the inner filtration body and grid panels; in this way, the liquid to be filtered enters into the casing through the water inlet and flows out from the grid panels, and proceeds further from the casing via the inner filtration body, filtration materials and outer filtration body treatment. The liquid filtration device has the advantages of being an integrated replacement as a filtration consumable, good universality, convenient installation and maintenance, large filtration area and effective prevention of dirt left after filtration from a backflow.
US08475654B1	Downspout drain connection and filter Included in this disclosure is a downspout drain filter for rain gutter downspouts. The downspout drain filer comprises elongated housing having an axis, a top portion, and a bottom portion. A transition portion connects the top portion to the bottom portion. The top portion includes an intake opening, a top portion perimeter, a debris opening, a filter attachment location, and a downspout attachment location. The downspout attachment location includes a flexible collar that defines a downspout attachment location perimeter that is less than the top portion perimeter. The bottom portion includes a flexible collapsible body that extends from the transition portion. A connection end is positioned opposite the transition portion as a part of the bottom portion. A filter is positioned in the top portion to direct debris out the debris opening and to permit liquid to pass to the bottom portion.
US08475653B2	Water treatment apparatus having meshed tubes provided with cilia and water treatment method using the same A water treatment apparatus includes a plurality of meshed tubes made of synthetic yarn and provided with cilia; a plurality of tube stack cages containing the meshed tubes; and an aeration diffuser positioned between the tube stack cages and configured to provide air so that to-be-treated influent water moves to the tube stack cages. The hollow interior of the filter media, i.e. meshed tubes, enables water to move in any direction, and the high porosity maximizes the area for filtering of suspended solids and attachment of microorganisms. The resulting efficiency of removal of suspended solids and soluble organic material is far greater than conventional methods. Arrangement of diffusers in the middle of the reaction tank and between the tube stack cages and aeration by them result in perfect mixing in the reaction tank. The load of suspended solids and soluble organic materials is evenly distributed over the entire filer media.
US08475639B2	Titration device and method A titration apparatus comprising a titration reservoir for a non-flowing sample solution to be titrated; an ion source reservoir comprising an ion source solution of selected ions; an ion exchange membrane barrier capable of passing ions from the ion source solution to the titration reservoir, but of blocking bulk liquid flow; a first electrode in electrical communication with the ion source reservoir; and a second electrode in electrical communication with the titration reservoir. Also, an electrolytic titrant generator for use in the titration apparatus.
US08475638B2	Biosensor In a biosensor that detects introduction of a sample liquid into a specimen supply path using a detecting electrode, a means of improving accuracy of detection is provided. The biosensor has: an electrode system including measuring electrode, counter electrode, and detecting electrode on first electrically insulating support; specimen supply path for introducing the sample liquid; and reagent layer used for quantifying a substrate contained in the sample liquid. The means is characterized in that detecting electrode is spaced from measuring electrode by a distance sufficient for the sample liquid to sufficiently cover measuring electrode before the sample liquid reaches detecting electrode.
US08475636B2	Method and apparatus for electroplating An apparatus for electroplating a layer of metal onto the surface of a wafer includes an ionically resistive ionically permeable element located in close proximity of the wafer and an auxiliary cathode located between the anode and the ionically resistive ionically permeable element. The ionically resistive ionically permeable element serves to modulate ionic current at the wafer surface. The auxiliary cathode is configured to shape the current distribution from the anode. The provided configuration effectively redistributes ionic current in the plating system allowing plating of uniform metal layers and mitigating the terminal effect.
US08475634B2	Application of HIPIMS to through silicon via metallization in three-dimensional wafer packaging A method of magnetically enhanced sputtering an electrically-conductive material onto interior surfaces of a trench described herein includes providing a magnetic field adjacent to a target formed at least in part from the electrically-conductive material, and applying a DC voltage between an anode and the target as a plurality of pulses. A high-frequency signal is applied to the pedestal supporting the semiconductor substrate to generate a self-bias field adjacent to the semiconductor substrate. The high-frequency signal is applied to the pedestal in pulses, during periods of time that overlap with the periods during which the DC voltage pulses are applied. The periods of time that the high-frequency signals are applied include a duration that extends beyond termination of the DC voltage pulse applied between the anode and the target. During each DC voltage pulse the electrically-conductive material is sputter deposited onto the side walls of the trench formed in the semiconductor substrate.
US08475632B2	Method for recycling cutting fluid A method for recycling cutting fluid includes preparing and processing a cutting fluid of silicon including a silicon mixture and a cutting fluid at an anoxic circumstance of 150° C. to 350° C. in a container, to obtain a vaporized cutting fluid and a silicon slurry; and condensing the vaporized cutting fluid to obtain a recycling cutting fluid.
US08475631B2	Reduction of fiber knots of cellulose crosslinked fibers by using plasma pre-treated pulpsheets The process of making crosslinked cellulose pulp fiber comprising plasma treating a sheet of cellulose pulp fiber before the sheet is impregnated with a crosslinking formulation which comprises a crosslinking agent and a catalyst, then defiberizing the treated cellulose pulp sheet to form treated defiberized cellulose pulp, then heating and curing the treated defiberized cellulose pulp to form intrafiber crosslinked cellulose pulp fibers.
US08475628B1	Process and apparatus for orienting bast stalks for decortication A process and apparatus for orienting a plurality of bast stalks for decortication includes receiving a plurality of harvested bast stalks onto a moving belt. The belt has a longitudinal axis in the direction the belt is moving. The process and apparatus orients a substantial portion of the plurality of harvested bast stalks on the belt so that the harvested bast stalks are generally parallel to the longitudinal axis of the belt. The oriented plurality of bast stalks may be collected for decortication.
US08475626B2	Multiple connected channel micro evaporator An evaporator for evaporating a liquid containing fluid, having an inlet and an outlet connected to an evaporation volume with an internal structure, the inlet and the outlet defining a main flow path there between and the cross-section of the evaporation volume is substantially constant along the main flow path is described. A method method for evaporating a liquid containing fluid by providing an evaporator supplying a liquid containing feed stream to the inlet; exerting heat; choosing the operating conditions so that an annular flow is created.
US08475624B2	Method and system for distributing gas for a bevel edge etcher A plasma etch processing chamber configured to clean a bevel edge of a substrate is provided. The chamber includes a bottom edge electrode and a top edge electrode defined over the bottom edge electrode. The top edge electrode and the bottom edge electrode are configured to generate a cleaning plasma to clean the bevel edge of the substrate. The chamber includes a gas feed defined through a top surface of the processing chamber. The gas feed introduces a processing gas for striking the cleaning plasma at a location in the processing chamber that is between an axis of the substrate and the top edge electrode. A pump out port is defined through the top surface of the chamber and the pump out port located along a center axis of the substrate. A method for cleaning a bevel edge of a substrate is also provided.
US08475618B2	Manufacturing method of hermetic container A manufacturing method of a hermetic container includes an assembling step of assembling the hermetic container and a sealing step of sealing by first and second sealing materials. Thus, in a case where local heating light is scanned toward an already-sealed portion of the second sealing material, since a separation portion of an unsealed state is located between the already-sealed portion and a downstream end of scanning, a load due to expansion/contraction of a frame body is applied to the first sealing material which is present in the separation portion of the unsealed state. After then, since the local heating light is irradiated to the first sealing material to which the load has been applied so as to heat and melt it, the load is relieved, whereby it is possible to suppress deterioration of joining strength and airtightness of the hermetic container.
US08475615B2	Method for repairing a wall consisting of a plurality of layers The invention relates to a method for repairing a wall (1), including a plurality of layers (2), each layer including fibers (3) extending in a main direction (4), and having a damaged area (5) over a plurality layers (2). The repair method includes a material removal step comprising making a recessed area (6) encircling the damaged area (5) and comprising a peripheral area (7) including steps (8) and adapted such that each step defines an interface area (9) having a width (10), the dimension of which in the main direction of the fibers of the lower layer adjoining the interface area (9) is greater than the dimension of said width in directions other than the main direction (4), a step of producing a replacement part (12) suitable for obstructing the recessed area, and a step of assembling the replacement part (12) onto the wall.
US08475614B2	Method for producing a fuel tank provided with internal accessories Method for producing a fuel tank provided with internal accessories and having a wall made of plastic made in a single piece by moulding a split parison or a parison in at least two parts, said method comprising the following steps: a) the parison is introduced in the heat-softened state into a mould comprising dies; b) a core on which the accessories are placed is introduced inside the parison; c) the parison is pressed onto the dies of the mould; d) the accessories are fastened to the parison with the aid of the core in an ideal layout; e) the core is withdrawn and the mould is closed; f) the tank is moulded from the parison; and g) the tank is removed from the mould.
US08475610B2	Induction hardening system and method A system and method of induction heat treating a gear includes a workstation. The workstation has a power source, an inductor coil, and a rotational mechanism. The gear is induction heat treated at a first portion of the gear and a second portion of the gear remains untreated by induction hardening. The gear has an inner surface. The inner surface includes the first portion and the second portion. The first portion has a first width. The second portion has a second width. The inductor coil includes at least one heating loop and at least one non-heating loop. The inductor coil is energized to a predetermined frequency to create an alternating magnetic field, where the alternating magnetic field developed in the heating loop induces an eddy current in the first portion of the gear.
US08475609B2	Treating Al/Zn-based alloy coated products A method of treating an Al/Zn-based alloy coated product that includes an Al/Zn-based alloy coating on a substrate is disclosed. The method includes the steps of rapid intense heating of the alloy coating for a very short duration, and rapid cooling of the alloy coating, and forming a modified crystalline microstructure of the alloy coating.
US08475608B2	Magnesium-based hydrogen storage alloys Magnesium-based hydrogen storage alloys having metallic magnesium (Mg) and a magnesium-containing intermetallic compound (MgxMy wherein y is 1−x) and containing not less than 60 mass-% of magnesium in total, and having a phase of a primarily crystallized magnesium-containing intermetallic compound in its solidification structure.
US08475603B2	Self-sanitizing automated condensate drain cleaner and related method of use The invention is directed toward a system and method for sanitizing a condensate drain to reduce sludge and related pathogens. The system is directed to a sanitizing assembly having a treatment chamber connected to the condensate drain, where the treatment chamber includes a top end and a shaft. A spray assembly is positioned proximate to the top end of the treatment chamber. This spray assembly has a nozzle spray connected to a hot water source. A spray controller within the spray assembly helps disperse a sufficient quantity and pressure of hot water within the shaft to dislodge sludge, when necessary.
US08475602B2	Substrate cleaning method and apparatus A substrate cleaning method for cleaning and removing foreign materials adhered to a surface of a substrate includes heating the substrate to peel off the foreign materials from the surface of the substrate by a thermal stress, removing the foreign materials from the surface of the substrate by a temperature gradient created in a proximity of the surface of the substrate, and collecting the foreign materials removed from the surface of the substrate by a collecting unit facing the substrate.
US08475600B2	Cleaning sheet, transfer member provided with cleaning function, and method for cleaning substrate processing apparatus A cleaning sheet including a cleaning layer which has a microasperity shape having an arithmetic average roughness Ra of 0.05 μm or less and a maximum height Rz of 1.0 μm or less. Preferably, a substantial surface area of the cleaning layer per a flat surface of 1 mm2 is 150% or more of a substantial surface area of a silicon wafer mirror surface per a flat area of 1 mm2. The cleaning sheet may be provided on at least one surface of a transfer member so that the transfer member has a cleaning function. When the cleaning sheet or the transfer member having a cleaning function is transferred in a substrate processing apparatus in place of a substrate to be processed therein, the cleaning sheet contacts and cleans a site of the substrate processing apparatus.
US08475599B2	Substrate preparation using stabilized fluid solutions and methods for making stable fluid solutions A method for making a solution for use in preparing a surface of a substrate is provided. The method includes providing a continuous medium that adds a polymer material to the continuous medium. A fatty acid is adding to the continuous medium having the polymer material, and the polymer material defines a physical network that exerts forces in the solution that overcome buoyancy forces experienced by the fatty acid, thus preventing the fatty acids from moving within the solution until a yield stress of the polymer material is exceeded by an applied agitation. The applied agitation is from transporting the solution from a container to a preparation station that applies the solution to the surface of the substrate.
US08475593B2	Crystal preparing device, crystal preparing method, and crystal In a crystal preparing device, a crucible holds a mixed molten metal containing alkali metal and group III metal. A container has a container space contacting the mixed molten metal and holds a molten alkali metal between the container space and an outside of the container, the molten alkali metal contacting the container space. A gas supply device supplies nitrogen gas to the container space. A heating device heats the crucible to a crystal growth temperature. The crystal preparing device is provided so that a vapor pressure of the alkali metal which evaporates from the molten alkali metal is substantially equal to a vapor pressure of the alkali metal which evaporates from the mixed molten metal.
US08475592B2	Method for producing a single crystal of semiconductor material A single crystal of semiconductor material is produced by a method of melting semiconductor material granules by means of a first induction heating coil on a dish with a run-off tube consisting of the semiconductor material, forming a melt of molten granules which extends from the run-off tube in the form of a melt neck and a melt waist to a phase boundary, delivering heat to the melt by means of a second induction heating coil which has an opening through which the melt neck passes, crystallizing the melt at the phase boundary, and delivering a cooling gas to the run-off tube and to the melt neck in order to control the axial position of an interface between the run-off tube and the melt neck.
US08475591B2	Method of controlling a thickness of a sheet formed from a melt A method and apparatus for forming a sheet are disclosed. A melt is cooled and a sheet is formed on the melt. This sheet has a first thickness. The sheet is then thinned from the first thickness to a second thickness using, for example, a heater or the melt. The cooling may be configured to allow solutes to be trapped in a region of the sheet and this particular sheet may be thinned and the solutes removed. The melt may be, for example, silicon, silicon and germanium, gallium, or gallium nitride.
US08475590B2	Method and apparatus for the production of crystalline silicon substrates An apparatus and method for producing a crystalline ribbon continuously from a melt pool of liquid feed material, e.g. silicon. The silicon is melted and flowed into a growth tray to provide a melt pool of liquid silicon. Heat is passively extracted by allowing heat to flow from the melt pool up through a chimney. Heat is simultaneously applied to the growth tray to keep the silicon in its liquid phase while heat loss is occurring through the chimney. A template is placed in contact with the melt pool as heat is lost through the chimney so that the silicon starts to “freeze” (i.e. solidify) and adheres to the template. The template is then pulled from the melt pool thereby producing a continuous ribbon of crystalline silicon.
US08475586B2	Structural composite having novel organic components and method of manufacture Various methods for forming structural composites are disclosed. For example, a particular method may include adding an effective amount of algae extract to an aggregate mixture so as to provide a plasticizer to the aggregate mixture, and processing the aggregate mixture to form a hardened composite.
US08475583B2	Dry amorphous silica product with inert carrier A dry product that permanently removes oil and oil stains from liquid or dry surfaces and is environmentally safe. The dry product is formed by mixing efficacious proportions of untreated amorphous silica with a dry, inert organic, inorganic or synthetic carrier, or combinations of said carriers. Suitable inert carriers include, but are not limited to, (a) inert inorganic carriers including, but not limited to, clays, perlite, vermiculite, crushed glass, volcanic ash and sand; (b) inert organic carriers, including, but not limited to, peat moss, straw, hay, sawdust, ground corncobs, flours, and coconut coir, and (c) inert synthetic carriers, including, but not limited to, polyurethane, polyethylene and polypropylene. The dry product can be applied directly to oil stains either on a hard surface, such as concrete or asphalt, or to oil spills on water.
US08475581B2	De-polluting and self-cleaning epoxy siloxane coating De-polluting, self-cleaning coating compositions are disclosed which comprise photocatalytic titanium dioxide and a binder comprising an epoxy siloxane polymer. The compositions produce durable, self-cleaning coatings with photocatalytic activity against pollutants in the air, such as NOx compounds.
US08475580B2	Ink, ink cartridge, ink jet recording method and ink jet recording apparatus An ink jet ink including a self-dispersible pigment, a salt, a polyoxyethylene alkyl ether and a water-soluble organic solvent. The self-dispersible pigment is a pigment to a surface of a particle of which a functional group containing at least a phosphonic acid group is bonded, the introduced amount of the functional group bonded to the self-dispersible pigment is 0.10 to 0.33 mmol/g. The salt is constituted by combining a specific cation with a specific anion. The value (Concentration of anion)×(Valence number of anion) of the salt in the ink is 0.005 to 0.06 mol/L. The water-soluble organic solvent includes glycerol, the content of which in the ink is 35% to 78% by mass based on the total content of the water-soluble organic solvent in the ink.
US08475579B2	Black ink composition A black ink composition is provided. The black ink composition includes a dispersive black colorant; less than 1 wt % of a glycol ether compound based on total weight of the black ink composition; a solvent; and water. The black ink composition of the present invention is free of surfactants and has excellent compatibility with a nozzle, and thus provides good smoothness in printing and high-quality image.
US08475578B2	Magenta inks and ink sets for ink-jet imaging The present invention is directed to magenta inks and ink sets for ink-jet printing. The inks and ink sets provide exceptional ozone fastness, particularly when printed on porous media or plain paper. The inks of the ink sets are formulated to be compatible with each other and are capable of producing high quality printed images.
US08475573B2	System and method for protection of SCR catalyst The present invention relates generally to the field of emission control equipment for boilers, heaters, kilns, or other flue gas-, or combustion gas-, generating devices (e.g., those located at power plants, processing plants, etc.) and, in particular to a new and useful method and apparatus for preventing the plugging, blockage and/or contamination of an SCR catalyst. In another embodiment, the method and apparatus of the present invention is designed to protect an SCR catalyst from plugging and/or blockage from large particle ash that may be generated during combustion.
US08475572B2	Method of removing and solidifying carbon dioxide from a fluid stream and fluid separation assembly The invention relates to a method of removing carbon dioxide from a fluid stream by a fluid separation assembly. The fluid separation assembly has a cyclonic fluid separator with a tubular throat portion arranged between a converging fluid inlet section and a diverging fluid outlet section and a swirl creating device. The separation vessel has a tubular section positioned on and in connection with a collecting tank. In the method, a fluid stream with carbon dioxide is provided. Subsequently, a swirling motion is imparted to the fluid stream so as to induce outward movement. The swirling fluid stream is then expanded such that components of carbon dioxide in a meta-stable state within the fluid stream are formed. Subsequently, the outward fluid stream with the components of carbon dioxide is extracted from the cyclonic fluid separator and provided as a mixture to the separation vessel. The mixture is then guided through the tubular section towards the collecting tank while providing processing conditions such that solid carbon dioxide is formed. Finally, solidified carbon dioxide is extracted.
US08475571B2	System for gas purification and recovery with multiple solvents In one embodiment, a gas purification system is provided. The system includes a first solvent section having a first carbon dioxide (CO2) absorber, a hydrogen sulfide (H2S) absorber, and a first solvent path that routes a first solvent through the first CO2 absorber and the H2S absorber. The gas purification system also includes a second solvent section having a second carbon dioxide (CO2) absorber and a second solvent path that flows a second solvent through the second CO2 absorber. The gas purification system has a gas path though the first and second solvent sections, wherein the first and second solvent paths are separate from one another, and the first and second solvents are different from one another.
US08475562B2	Gas purification apparatus and method A gas purification apparatus capable of removing fine particles of substantially any size without lowering the efficiency of gas supply. A loader module of a substrate processing apparatus includes a fan filter unit for producing a downward flow of atmospheric air in the internal space of a transfer chamber. The fan filter unit includes a fan for generating an atmospheric air flow, a filter of mesh structure for trapping and removing particles mixed in the atmospheric air flow, an irradiation heater disposed between the fan and the filter, and a high temperature part disposed in the atmospheric air flow and higher in temperature than the filter.
US08475554B2	Permeable member, and permeable casing and electrical component using the same The present invention provides a permeable member which can attain both a pullout strength and following property (sealing property) and provides a permeable casing and an electrical component using the permeable member. The present invention includes a permeable film through which a gas passing an opening passes when the permeable film is fixed to the opening of a casing, and a tubular support that supports the permeable film. The support includes a first resin part that contacts the casing with the support fixed to the opening, and a second resin part composed of a material having a higher elastic modulus than that of a material constituting the first resin part, and the first resin part and the second resin part are laminated at least partly in a transverse section of the support.
US08475552B2	System for pressurizing feedstock for fixed bed reactor In accordance with one embodiment, a system includes a posimetric pump configured to increase pressure of a feedstock to provide a pressurized feedstock. The system also includes a fixed bed gasifier configured to gasify the pressurized feedstock, wherein the fixed bed gasifier comprises an enclosure, a feedstock inlet configured to receive the pressurized feedstock, at least one agent inlet configured to receive at least one gasification agent, a syngas outlet configured to output a syngas, an ash outlet configured to output ash, and a fixed bed configured to support the pressurized feedstock while allowing flow of the at least one gasification agent through the pressurized feedstock.
US08475551B2	Gas reformulating system using plasma torch heat A method and apparatus is described for reformulating of an input gas from a gasification reaction into a reformulated gas. More specifically, a gas reformulating system having a gas reformulating chamber, one or more plasma torches, one or more oxygen source(s) inputs and control system is provided thereby allowing for the conversion of an input gas from a gasification reaction into a gas of desired composition.
US08475547B2	Entrained-flow gasifier with cooling screen and sliding seal In a reactor for gasification of entrained solid and liquid fuels at temperatures between 1,200 and 1,900° C. and at pressures between ambient pressure and 10 MPa using an oxidizing agent containing free oxygen, the cooling screen is connected to the pressure shell in a gastight manner via a sliding seal in order to allow length changes. Continuous gas purging of the annular gap between pressure shell and cooling screen is unnecessary and gasification gas is prevented from flowing behind.
US08475545B2	Methods and apparatus for use in cooling an injector tip A method of assembling a feed injector is provided. The method includes providing a feed injector tip that includes an inlet, a tip end, a flow passage that extends longitudinally through the feed injector tip from the inlet to the tip end, an annular cooling channel that substantially circumscribes the flow passage, and a buffer region that separates the annular cooling channel from the flow passage. The method further includes coupling the feed injector tip to the feed injector to enable a fluid to be channeled through the flow passage, such that the fluid flows past the inlet, at which the buffer region has a first width, before flowing past the tip end, at which the buffer region has a second width, the first width wider than the second width, and coupling a cooling assembly to the feed injector to enable a flow of cooling fluid to be channeled into the annular cooling channel.
US08475541B2	Diesel fuel additive A diesel fuel additive composition, a fuel containing the fuel additive, a method for improving diesel engine performance using the additive and a method for making the additive for diesel engines having a high pressure fuel injection system. The fuel additive has a number average molecular weight (Mn) of from about 500 to about 10,000 and is selected from a hydrocarbyl-substituted succinic acid or anhydride or derivative thereof and a hydrocarbyl-substituted Mannich base. The additive has a molecular weight distribution such that less than about 25 wt. % of the additive has a molecular weight of 400 or less as measured by gel permeation chromatography (GPC) based on a polystyrene calibration curve.
US08475539B2	Additive composition for textile auxiliaries The present disclosure relates to compositions for preparing textile auxiliaries, which are used in particular to enhance the dyeing affinity of textile fibers. The disclosure concerns a composition in the form of an aqueous emulsion or solution which comprises (a) one or more hydroxyalkylamines of formula: NX1X2(CnH2nOH), where X1 and X2 are, independently of one other, either hydrogen or hydroxyalkyl radicals of respective formulae Cn1H2n1OH and Cn2H2n2OH, and n, n1 and n2 are integers from 2 to 6, and (b) one or more anionic surfactants selected from alkyl sulphates, alkylsulphonates such as paraffinsulphonates, alkylarylsulphonates, alkyl ether phosphates, and alkyl carboxylates, and at least one compound (c) and/or (d), where (c) is selected from one or more thioureas (thiocarbamides) of formula R1R2N(CS)NR3R4, where R1, R2, R3 and R4 are independently either hydrogen or hydrocarbon radicals having 1 to 5 carbon atoms, and (d) is selected from one or more dialkyl sulphosuccinates in combination with one or more anti-freeze agents selected from methanol, isopropanol, glycols, preferably glycerol, ethylene glycol, propylene glycol or glycol ethers, preferably ethers of ethylene glycol or of propylene glycol.
US08475534B2	Canine elbow repair and instrumentation Methods and instrumentation for arthroscopic elbow surgery which include a humeral component. The humeral component is installed in a trough formed in the humeral condyle. The trough may be formed by using a plurality of drill pins and a plurality of corresponding cutters (and optionally a template). The two drill pins are passed through the template and drilled into the humerus, and cutters are advanced over the corresponding drill pins to form the trough. The humeral component may be employed in conjunction with an ulnar implant.
US08475530B2	Middle ear direct action improved hearing aid and related installation method A middle ear prosthesis device and corresponding implantation procedure are described. A sensing microphone converts an acoustic audio signal into a corresponding electrical audio signal. A sensing amplifier amplifies the electrical audio signal. An audio transducer converts the amplified electrical audio signal into a corresponding amplified acoustic audio signal. An acoustic waveguide conducts the amplified acoustic audio signal from the audio transducer to the middle ear and includes: i. a main tubular portion having an outer end for placement in the outer ear canal and an inner end for placement in the middle ear, and ii. an extension portion having an outer end coupleable to the audio transducer and an inner end coupleable to the outer end of the main tubular portion.
US08475523B2	Distal tip assembly for a heart valve delivery catheter A catheter assembly according to the present invention includes a handle assembly, an introducer sheath, and a distal tip assembly. The distal tip assembly can include first and second retaining sleeves and a slotted tip with a non-traumatic tip guard positioned at the proximal end of the slotted tip. The handle assembly can include a fixed main handle and two or more rotating handles that allow a user to control the distal tip assembly of the catheter. Each control knob on the handle assembly controls a portion of the components on the distal tip of the catheter by allowing for precise manipulation of various delivery shafts. Each delivery shaft extends from the handle assembly to respective positions towards the distal end of the catheter.
US08475520B2	Stenting ring with marker A stenting ring made of a tube or rolled-up sheet that has a characteristic wall thickness. The ring defines a lumen and is equipped with at least one marker made of a material different from that of the ring. The ring is expansible from a radially compact disposition with a relatively small circumference to a radially expanded disposition with a relatively large circumference. The ring exhibits in the compact disposition a serpentine arrangement of succeeding struts lying in alternate opposite directions to the longitudinal axis of the lumen. The marker has a thickness in the radial direction of the ring that is less than the characteristic wall thickness, and has a width that extends circumferentially around an arc of the ring. The marker is attached to the ring at a zone located at a point intermediate in the extent of said arc. The marker overlaps with a respective one of said struts, at each end of its circumferential arc, when the ring is in the compact disposition, the respective struts moving away from each other, and from the marker, when the ring expands towards said radially expanded disposition.
US08475519B2	X-ray visibility and corrosion resistance of niti stents using markers made of sandwich material A bodily implant, in particular a stent, for insertion or implantation into a living body, having a marker element for increasing X-ray visibility, which is at least partially insertable into a cut-out in an implant structure and which has a coated material comprising at least two layers. A corresponding method for manufacturing a marker element from a coated material, and a corresponding method for manufacturing a bodily implant, in particular a stent, having a marker element which is visible to X-rays, is disclosed.
US08475514B2	Deployment device A stent graft deployment device (10) has a tubular fixed handle (34, 36) to be gripped and held by a user and an elongate release handle (30) extending through the fixed handle so that the release handle can be moved through the fixed handle. The deployment device assembly has a pusher (38) and a sheath (18) to cover a stent graft (64) on the pusher. The pusher is connected to the fixed handle and the sheath is connected to the release handle so that retraction of the release handle through the fixed handle causes the sheath to be retracted from the stent graft on the pusher. The fixed handle includes a grip component (34) that grips the pusher and a rotator component (36) that grips a release clamp (48) on the pusher. The release clamp has trigger wires for the release of the stent graft attached to it. The rotator component has a screw thread (54) with a portion (52) of the release clamp engaged into the screw thread so that rotation of the rotator component causes longitudinal movement of the release clamp on the pusher which pulls the trigger wires.
US08475512B2	Prosthetic valve devices and methods of making and using such devices The present invention relates to medical devices and in particular to frameless grafting prostheses and methods of making and using such devices. The frameless grafting prostheses include a stiffening member useful in the attachment of the frameless grafting prostheses to a wall of a body lumen.
US08475511B2	Device for applying cold therapy to feet A device for applying cold therapy to the foot of a wearer is disclosed. The device comprises a foot pad having a premolded configuration for directly contacting the bottom of the foot and surrounding heel area. The foot pad includes a heel portion sized to receive and surround the heel of the foot and a raised and contoured arch portion positioned to place localized pressure on the arch of the foot. The entire foot pad is formed of an ice pack that includes a container or shell for receiving and containing a substance capable of maintaining an extremely low temperature for an extended period of time during application to the foot. The device also includes a securement mechanism that is arranged for engaging the foot pad to the bottom of the wearer's foot.
US08475510B2	Airflow applicators and related treatment methods Disclosed are embodiments of airflow applicators used for delivering directional, heated air to, for example, the scalp and hair of humans and/or animals to eliminate ectoparasites, such as lice and lice eggs. In preferred embodiments, the applicators are configured to deliver heated airflow (from a separate device, or from another portion of a single device, that generates heated airflow) efficiently right to where ectoparasites and their eggs most frequently reside. Also disclosed are treatment methods, including preferred treatment patterns, for delivering heated airflows for use in eliminating ectoparasites and their eggs on an animal.
US08475508B2	Therapeutic cooling system A therapeutic cooling system used to remove trapped heat from between a person and an object pressed against the person. Such objects would include: beds, chairs and protective clothing such as body armor. A thin bladder encapsulating a liquid placed between the person and heat trapping object absorbs heat produced by the person. Increased heat transferred to the liquid causes it to expand, become less dense and thus more buoyant than the cooler liquid in the bladder. Convection moves heated liquid upwards towards a thermoelectrically driven cooling unit. When the warmed liquid reaches the cooling unit thermoelectric devices pull heat from the liquid and push it in to a heat sink where is it can expelled from the system. The cooled liquid, now denser, flows back down the bladder by gravity.
US08475506B1	VCSEL array stimulator apparatus and method for light stimulation of bodily tissues An apparatus and method using an array of VCSELs operable to emit light at one or more wavelengths, pulse-repetition rates, pulse durations, pulse powers, pulse energies, and/or light-distribution spatial and/or temporal patterns, that are effective to stimulate or photostimulate human or other animal tissue, and in particular, nerve tissue. In some embodiments, the invention provides an implantable device that includes an array having a plurality of VCSELs in a spatial pattern suitable to stimulate or photostimulate a plurality of different areas of tissue (e.g., a plurality of different nerves). In some embodiments, the device is instead partially implantable. In some embodiments, the device is instead external to the body of the animal.
US08475505B2	Orthopaedic screws An orthopaedic screw having a plurality of regions, at least one of which may be porous. The orthopaedic screw includes a head, a tip and at least one thread. The porosity of the screw of the present invention can vary within the part or region, including changes in pore shape, size and density. These characteristics can vary along the length of the screw axis and/or radially (from the outer diameter to the axis). The orthopaedic screw may further include at least one solid region formed of any implantable polymer, reinforced polymer or metal.
US08475501B2	Polyaxial bone screw with split retainer ring A polyaxial bone screw includes a head member and a shank member. The shank has a capture end and an opposite threaded end for threaded insertion into a vertebra. The head has a U-shaped cradle for receiving a spinal fixation rod and a central bore for receiving the capture end of the shank. An expandible retainer ring with a radial split is snapped onto the capture end of the shank to retain it within the head. The retainer ring has a spherical outer surface which forms a ball joint with a spherical socket cavity within the head to enable the head to be angled relative to the shank. A threaded closure plug is tightened within the cradle to clamp the rod into engagement with a knurled dome on the capture end of the shank to secure the rod relative to the vertebra.
US08475500B2	Multi-axial spinal fixation system A spinal fixation system includes a rod and anchor devices that include a bone engaging fastener having a head defining a spherical socket. A ball insert is placed within the socket and rotated so that the ball insert is juxtaposed with the socket. The anchor device further includes a yoke defining a yoke channel for receiving the rod and a stem engaged to the ball insert captured within the socket. A sleeve disposed between the yoke channel and the fastener head supports the rod. A set screw is operable to clamp the rod against the sleeve and draw the insert into engagement within the socket. A releasable detent defined between the yoke and the fastener head is configured to releasably retain the yoke in at least one discrete position relative to the fastener. Portions of the releasable detent may also exert a frictional retention force against the fastener head.
US08475497B2	Spinous process plate and connector assembly and method A spinal implant that includes plates and at least one connector for attachment to spinous processes. The plates may be sized to extend along opposing lateral sides of spinous processes. Connectors may be attached to the plates and extend across the spinous processes. Each of the connectors may be sized and shaped to extend over and across a spinous process and connect the opposing plates together. The connectors may be constructed from a shape-memory material to facilitate attachment with the plates and attachment of the assembly to the spinous processes.
US08475493B2	Surgical staple for anastomosis A surgical staple for connecting two tubular tissue structures may include a substantially rectangular base having a first edge and a second edge substantially parallel to one another, and a third edge substantially perpendicular to the first and said second edges; and may also include at least three deformable tines extending from the first and second edges of said base; where no tine that extends from the first edge may be positioned at substantially the same distance from the third edge as any said tine that extends from the second edge; and where deformation of the tines secures the tubular tissue structures together.
US08475491B2	Surgical stapling systems Interengaging surgical staples (11, 31, 51, 71) are provided that are useful in systems for the surgical correction of defects in cardiac valves and/or supporting weaknesses in abdominal regions. The staples are constructed with at least one ring (21, 41, 61, 81) extending laterally from the upper end of one staple leg (15, 35, 55, 75), which once implanted provides for interengagement with the next staple by passage of the other leg (13, 33, 53, 73) of it therethrough. Either shape-memory staple design or an implantation tool causes the two staple legs to curve respectively toward each other once having penetrated the tissue, thus gathering and constricting the tissue in a region below the surface thereof. Elastic sections (67, 83) may be provided in the crown connectors to allow flex in the plane thereof.
US08475488B2	Retrievable blood clot filter A compact retrievable blood clot filter has a filter section, a releasable lock and an alignment section connected to the filter section. Alignment ribs of the alignment section have releasable upstream ends that are locked to the filter by the releasable lock. The releasable upstream ends of the alignment ribs are capable of being released from the releasable lock so that during retrieval of the filter, the alignment ribs can slide through the endothelial tissue that may have grown around the alignment ribs.
US08475487B2	Cross stream thrombectomy catheter with flexible and expandable cage A cross stream thrombectomy catheter with a flexible and expandable cage preferably formed of nitinol for removal of hardened and aged thrombotic material stubbornly attached to the interior of a blood vessel. The cage, which can be mesh or of straight or spiral filament design, is located close to inflow and outflow orifices at the distal portion of a catheter tube and is deployed and extended at a thrombus site for intimate contact therewith and for action of a positionable assembly and subsequent rotation and lineal actuation to abrade, grate, scrape, or otherwise loosen and dislodge difficult to remove thrombus which can interact with cross stream flows to exhaust free and loosened thrombotic particulate through the catheter tube. An alternative embodiment discloses a mechanism involving a threaded tube in rotatable engagement with an internally threaded sleeve to incrementally control the deployment and expansion of the flexible and expandable cages.
US08475484B2	Liquid seal assembly for a rotating torque tube A sealing assembly hinders or prevents air or other fluid from seeping between various components of a medical device by use of a liquid seal. An infusion port is for introducing a sealing liquid to immerse a flood space between a liner that surrounds a torque tube and/or within the torque tube, thereby creating a liquid seal around the torque tube and lubricating the torque tube. The length of the liner and the cross sectional space of the flood space are adjusted to control flow rate. An aspiration port may force suction pressure into a lumen extending along the length of the medical device in a distal direction. The liquid seal also prevents diluting of the suction pressure by stopping ingress of air.
US08475483B2	Selective tissue removal tool for use in medical applications and methods for making and using The present disclosure relates generally to the field of tissue removal and more particularly to methods and devices for use in medical applications involving selective tissue removal. One exemplary method includes the steps of providing a tissue cutting instrument capable of distinguishing between target tissue to be removed and non-target tissue, urging the instrument against the target tissue and the non-target tissue, and allowing the instrument to cut the target tissue while automatically avoiding cutting of non-target tissue. Various tools for carrying out this method are also described.
US08475482B2	Surgical instrument with distal suction capability A surgical instrument includes a main unit and a suction conduit. The main unit includes at least one tubular body having a distal end, a proximal end, and an inlet disposed near the distal end. The suction conduit is slidably disposed over the main unit, and is slidably movable along the main unit between a retracted position, at which the suction conduit does not cover the inlet of the main unit, and an extended position at which the suction conduit covers the inlet of the main unit and a suction inlet of the suction conduit is placed in fluid-communication with the main unit inlet. The surgical instrument can be used as a suction tool by placing the suction conduit in the extended position and applying a vacuum through the inlet of the main unit and the suction inlet.
US08475479B2	Surgical probe An exemplary surgical probe and methods of making the same are disclosed. An exemplary surgical probe may include a tubular body and a scissor assembly received at least partially within the body. The scissor assembly may include a first blade fixed to the tubular body that includes a body portion and an end portion. The scissor assembly may further include a second blade that is configured to move longitudinally within the tubular body. The body portions of the first and second blades may each define respective cross sections normal to a longitudinal axis of the tubular body. The cross sections may each define centrally disposed edges adjacent one another, and the cross sections may each be asymmetrical about a line substantially parallel to the centrally disposed edges.
US08475477B2	Vascular graft A vascular graft for anastomosis of blood vessels or ducts comprises piercing means (3) for engaging an end portion (8/8′) of a blood vessel or prosthesis and means (6, 6′) for precisely guiding one or more piercing elements (3) to pierce the wall of the vessel or prosthesis to a predetermined depth and in a predetermined direction.
US08475475B2	Remote contol mechanism for an atraumatic surgical needle The invention is a device for performing remote suturing operations with an atraumatic needle when there is distance between the hand and the place to be sutured. The device, which is adaptable to needles of different sizes used for surgical suturing, utilizes needle thrusting and needle capture mechanisms. These mechanisms allow the needle to pass through the tissue (flesh) and to be captured and released with a single stitch movement.
US08475473B2	Convertible surgical clip applier system A surgical clip applier includes a handle assembly, a first clip assembly, and a second clip assembly. The first clip assembly is adapted to receive only a single clip while the second clip assembly is adapted to receive multiple clips. The handle assembly is sized and configured to receive the first clip assembly or the second clip assembly. A jaw assembly includes a pair of jaws each with an elongate support arm, and a bridge holding the jaws in an aligned relationship. A housing has a fixed relationship with the bridge while permitting movement of the jaws between an open and a closed state. A coupling attaches the housing to the handle assembly. An associated method of operation includes the step of removing one of the single clip jaw assembly and the multiple clip-jaw assembly, disposing of the one jaw assembly while mounting the other jaw assembly on the handle.
US08475472B2	Single catheter mitral valve repair device and method for use A single catheter valve repair device for stabilizing a tissue portion and selectively applying a tissue fastener thereto. The single catheter valve repair device of the present invention includes an extendable engagement tip having at least one vacuum port formed thereon, at least one deployable fastener in communication with the engagement tip, and at least one actuator member in communication with the port. The deployable fastener is capable of controllably engaging and fastening a tissue segment located proximal to the engagement tip.
US08475471B2	Organopexy tool and organopexy kit Organopexy tool set (S) is comprised of suturing tool (30) comprised of rod-shaped securing section (31) and suture (32), puncture needle (10) for insertion that accommodates plural securing sections with the ends of sutures protruding to the outside, and extruding device (20) that is arranged at the base end of puncture needle for insertion and can extrude the securing section accommodated in puncture needle for insertion from an opening at the tip of puncture needle for insertion. Also, plural suture exiting holes (24) are formed at intervals around the axis on extruding device, and the ends of sutures connected to plural securing sections protrude from different suture exiting holes. In addition, extruding device (20) is equipped with extruding rod (22), friction member (29), attachment/detachment pressing section (23), and coil spring (28).
US08475470B2	Percutaneous registration apparatus and method for use in surgical navigation A percutaneous registration apparatus and method for use in minimally invasive spinal surgery. The apparatus including a holding member, first and second clamping members, first and second gripping members, and an adjustment mechanism for closing and opening the first and second gripping members.
US08475469B2	Medical instrument for manipulation of an uterus A medical instrument has a rod-shaped body which has a distal end section which can be inserted through a vagina into an uterus. A bell-shaped element is mounted on the rod-shaped body. The bell-shaped element being slidingly displaceable along said rod-shaped body at least between an axial position on said rod-shaped body close to a proximal end thereof and up to said distal end section inserted in an uterus.
US08475465B2	Acetabular shell removal tool A tool for separating an acetabular shell of a hip prosthesis from the surrounding pelvic bone includes a fixture which attaches to the acetabular shell and has a chisel guide mounted on it. A chisel associated with the chisel guide is curved to conform to the outer periphery of the acetabular shell, and the chisel guide causes the chisel to circumscribe the acetabular shell as the chisel is inserted between the acetabular shell and the pelvis.
US08475455B2	Fluid-assisted electrosurgical scissors and methods An electrosurgical scissors comprising an end effector comprising a first blade member and a second blade member, the first blade member and the second blade member pivotally connected; an electrical connector configured to couple the scissors to a power source; and a fluid passage in fluid communication with at least one fluid outlet.
US08475448B2	Catheter with multiple microfabricated temperature sensors A catheter with temperature sensing has a catheter body and a tip section with integrated thermoresistive temperature sensors on its outer surface. The temperature sensor includes a microfabricated thin film assembly of which one layer is a sensor layer of thermoresistive material. In one embodiment, the tip section has a flexible tubing on whose outer surface circumferential temperature sensors are integrated. In another embodiment, the tip section has a tip electrode on whose outer surface a tip temperature sensor is integrated. In yet another embodiment, the tip section has a tip temperature sensor integrated on its tip electrode and multiple circumferential temperature sensors distal of the tip temperature sensor.
US08475445B2	Spectral analysis of intracardiac electrograms to predict identification of radiofrequency ablation sites A method and system for choosing suitable sites for catheter delivery ablative energy is provided that includes a catheter/ablation structure that is positioned on a potential ablation site on a heart. The catheter/ablation structure produces one or more electrograms recorded at the potential ablation site. A signal processing unit receives from the catheter/ablation structure the recorded one or more intercardiac electrograms from the potential ablation site and performing Fast Fourier Transform (FFT) on the recorded one or more intercardiac electrograms as so to produce one or more spectral power distributions of the potential ablation site. A display unit displays the one or more spectral power distributions so as to determine whether the potential RF ablation site exhibit necessary spectral properties for the delivery of the ablative energy. A ablative energy generator unit provides the ablative energy to the potential ablation site using the catheter/ablation structure.
US08475441B2	Isotherm-based tissue ablation control system A system and method for use with at least one cryoprobe for the treatment of biological tissue controls the energy applied to the tissue. The invention receives live procedure data such as temperature information from locations along the pathway of the cryogenic liquids, and calculates a procedure signature or profile based on the procedure data. In one embodiment, volumetric isotherms are calculated. The procedure signature is compared to a planning signature based on previously acquired image data and estimates of the thermal gradients from models. The system and method are further configured to automatically regulate the application of power based on analysis of the planning data to the procedure data.
US08475438B2	Method and apparatus for non- or minimally disruptive photomanipulation of an eye The invention related to a method and a system for non- or minimally disruptive photomanipulation of the lens and/or its constituents collectively or selectively of an animal or human eye, comprising focusing a treatment laser beam into a selected part of the lens and/or its constituents collectively or selectively where treatment is intended to occur, pulsing of said treatment laser beam, scanning the beam over at least a part of the lens, measuring one or more types of radiation from the said selected part and utilizing this measurement to decide to stop the said treatment laser beam or to adjust at least one of the parameters: focus, intensity, wavelength, pulse length, repetition frequency, pulse train length, scan velocity, size of scanned volume, scan repetitions, and scan pattern of said treatment laser beam.
US08475437B2	Radiation system for opthalmological applications An irradiation system for opthalmological applications includes: a radiation source (1) for changing the biomechanical properties of the cornea; an optical system for directing the radiation towards the tissue; a beam-splitter (3) which couples out a part of the radiation directed towards the tissue for measuring or monitoring purposes; the beam-splitter also being set up in order to combine a further radiation of a different wavelength with the first-mentioned radiation; a controller for controlling the system, including a sensor; a mechanical stand (16) for supporting an irradiation unit (17); and interfaces for exchange of data.
US08475430B2	Catheter assembly and method for internally anchoring a catheter in a patient A catheter assembly and method for internally anchoring a catheter in a patient. According to one embodiment, the catheter assembly includes a catheter, a tubular fitting coupled to one end of the catheter, and an internal bolster coaxially mounted around the tubular fitting. The tubular fitting has a waist portion, and the internal bolster is secured thereto by a snap-fit. To internally anchor the catheter in a patient, one inserts the end of the catheter to which the fitting is coupled into the patient and then, while the fitting and its coupled end of the catheter are within the patient, inserts the internal bolster over the fitting until it snap-fits into place over the waist portion, thereby internally anchoring the catheter within the patient.
US08475428B2	Belted absorbent article A belted absorbent article includes an absorbent structure extending about a first longitudinal axis, the absorbent structure including a topsheet, a backsheet and an absorbent batt disposed between the topsheet and the backsheet, the absorbent structure having a transverse axis dividing the absorbent structure into a front panel terminating in a front end region and a rear panel terminating in a rear end region, the absorbent structure being delimited by opposed longitudinal edges and opposed transverse edges, and a pair of opposed belt halves including nonwoven material attached to the absorbent structure at the rear end region of the rear panel, each of the belt halves being attached by a respective joint, each belt half extending about a longitudinal axis of the belt such that each belt half extends outwardly from a respective longitudinal edge of the absorbent structure.
US08475427B2	Disposable absorbent article designed to facilitate an easy change A disposable absorbent article to be worn about the lower torso of a wearer that facilitates an easy, intuitive change is provided. The disposable absorbent article includes at least one serviceable indicium that facilitates an easy change by providing alignment of the article relative to an anatomical feature of the wearer or by externally highlighting one or more components of the article thereby indicating alignment and fit about the wearer's lower torso.
US08475424B2	Disposable pull-on garment The disposable pull-on garment has a longitudinal centerline, a front region, a crotch region, and a back region. The front and back regions are joined at seams to form a waist opening and leg openings. The pull-on garment comprises a main portion, a side portion, and a waist portion. The side portion is disposed transversely outboard of the main portion. The waist portion comprises a center waist portion, an outer side waist portion, and an inner side waist portion. The contraction rate of the inner side waist portion is less than that of the center waist portion, and the contraction rate of the side portion longitudinally inboard of the inner side waist portion is greater than that of the inner side waist portion.
US08475421B2	Shield especially adapted for use in connection with changing an ostomy pouching system A shield that is useful in connection with an ostomy pouching system when changing a wafer or changing a collection pouch. The shield includes a plate adapted to be disposed over the stoma and at least a portion of the ostomy pouching system, an absorbent material adapted to absorb body waste flowing from the stoma, which absorbent material is disposed adjacent to a portion of the plate, and an adhesive or other mechanism for selectively securing the plate and the absorbent material proximate to the stoma such that the plate is disposed over the stoma when portions of the ostomy pouching system are changed. Also disclosed is the combination of an animal body and the shield, as well as a method of containing the flow of body waste from a stoma.
US08475418B2	Closed system for surgical limb prep A closed system for surgical limb prep has: a two-layered construction, including an inner layer and a top layer; or a three-layered construction, including an inner layer, an intermediate layer, and a top layer. The inner layer fits over and engages the limb of the patient, and the inner layer also serves as a storage medium for a topical antiseptic or other prep fluid. The intermediate layer, if present, is positioned over the inner layer and is preferably made of a substantially waterproof or fluid-resistant material. The top layer covers the other layer(s) and includes one or more strips of adhesive that can be used to secure the top layer to the limb of the patient, effectively sealing and closing the system about the limb of the patient.
US08475417B2	Assemblies for identifying a power injectable access port Assemblies for identifying a power injectable vascular access port are described. One assembly includes a vascular access port, a first identifiable feature, a second identifiable feature, and a third identifiable feature. The first identifiable feature is incorporated into the access port and identifies the access port as suitable for flowing fluid at a fluid flow rate of at least 1 milliliter per second through the access port. The second identifiable feature is incorporated into the access port and identifies the access port as suitable for accommodating a pressure within the cavity of at least 35 psi. The third identifiable feature is separated from the access port and confirms that the implanted access port is both suitable for flowing fluid at a rate of at least 1 milliliter per second through the access port and for accommodating a pressure within the cavity of at least 35 psi.
US08475416B2	Luer receiver and method for fluid transfer An improved luer lock receiving septum having a configuration which provides rapid and tight resealing and yet allows penetration of the septum by the luer tip with a low penetration force. The elongated septum includes an upper portion of enlarged diameter having a target surface, a central slit, and a central, lower septum extension projecting about the slit below the upper portion and into a housing so that following luer insertion there is provided sufficient room for both the laterally displaced extension of the septum, the luer taper, and the housing to be received into a conventional luer lock connector. The septum is further preferably configured to minimize or eliminate the negative pressure deflection normally associated with the withdrawal of the large diameter luer cannula from an enclosed fluid filled lumen or chamber, by substantially isolating the lumen or chamber from the septum material displacement resultant from luer insertion. In an exemplary embodiment, the luer receiving septum is provided at a port of a stop cock.
US08475415B2	Positive displacement stopper for a pre-filled syringe A stopper adapted for attachment with a plunger rod for use within a syringe barrel is disclosed. The stopper includes a main body defining an open rearward end and a closed front end. The open rearward end is adapted to receive a front forward end attachment portion of the plunger rod. The stopper also includes a core member integrally formed with said main body adjacent the closed front end. The core member includes a nose portion having a profile adapted to create a positive seal with an outlet opening of such syringe barrel.
US08475414B2	Medication delivery device and method for operating a medication delivery device A medication delivery device (1) comprises a housing (4) having a proximal end (P) and a distal end (D), a cartridge (3) for holding a medication (M), the cartridge (3) having an outlet (2), a moveable piston (5) being retained within the cartridge (3), a drive member (17) moveable in a proximal direction with respect to the housing (4) for setting a dose of medication (M) to be delivered and in the distal direction with respect to the housing (4) for delivering the dose and a piston rod (10) adapted to drive the piston (5) in a distal direction with respect to the cartridge (3) for delivering the dose. The drive member (17) is releasably coupled to the piston rod (10). The medication delivery device (1) further comprises a resilient member (21) which is arranged to move the drive member (17) in the proximal direction with respect to the housing (4) after dose delivery, thereby reducing pressure of the piston rod (10) on the piston (5).
US08475412B2	Needle array assembly and method for delivering therapeutic agents A fluid delivery device includes an array of needles, each in fluid communication with a respective reservoir. Respective actuators are coupled so as to be operable to drive fluid from the reservoirs via needle ports. Each needle can have a plurality of ports, and the ports can be arranged to deliver a substantially equal amount of fluid at any given location along its length. A driver is coupled to the actuators to selectively control the rate, volume, and direction of flow of fluid through the needles. The device can simultaneously deliver a plurality of fluid agents along respective axes in solid tissue in vivo. If thereafter resected, the tissue can be sectioned for evaluation of an effect of each agent on the tissue, and based on the evaluation, candidate agents selected or deselected for clinical trials or therapy, and subjects selected or deselected for clinical trials or therapeutic treatment.
US08475411B2	Systems, kits, and methods for infusing fluids to a patient Systems, kits, and methods for programming infusion systems are disclosed. A system comprises an infusion device and a mock pump set. The infusion device is programmable with at least one infusion protocol. The infusion device includes a pathway adapted to receive a pump set and at least one pump adapted to pump fluid through the pump set when the pump set is received in the pathway. The mock pump set is sized to be received in the pathway of the infusion device, and is not configured to receive fluid from the fluid container. A kit comprises the mock pump set. A method comprises inserting a mock pump set in a pathway of an infusion device and programming the infusion device with at least one infusion protocol while the mock pump set is received in the pathway.
US08475409B2	Infusion pump Described is an infusion pump comprising electronic infusion regulating means with wired or wireless communication means and a power source, a medicament bag (7) and an infusion device, said infusion device being in fluid communication with said medicament bag (7) and comprising two valves (1, 2), a pressure cavity (4) provided between said two valves (1, 2) and a membrane (3) covering said cavity (4), wherein said infusion device comprises at least two active actuators, preferably either made of electroactive polymer so as to form a self actuating membrane (3) or made of shape memory alloy wire, one of said actuators being adapted to apply pressure to said membrane (3) for fluid displacement in said cavity (4), and the other of said actuators being adapted to operate one of said valves which is adapted to passively close in the flow direction of a fluid from said medicament bag (7) through the cavity (4), wherein the other of said valves is adapted to, in particular passively, close in a direction opposite to said flow direction.
US08475404B2	Vial access and injection system A device for mixing and transferring is described. The device comprises a housing having open ends, a container accessing member having at least one fluid conduit therethrough, the container accessing member extending generally outwardly from one end of the housing. The device comprises a fluid delivery device accessing member having at least one fluid conduit therethrough, the fluid delivery device accessing member extending generally outwardly from the other end of the housing having the container accessing member, the fluid delivery device accessing member and the container accessing member in fluid communication therewith.
US08475402B2	Aspiration system for medical devices An aspiration tube has a relatively high fluidic resistance. The tube is coupled to a medical device and a pump of an aspiration system. The tube can be designed to create a pressure drop that at least equals the maximum vacuum pressure of the pump. The fluidic resistance can be accomplished with a tube having an inner diameter less than 0.05 inches. The aspiration tube and an irrigation tube may be coupled to an anterior chamber of a cornea during a phaco procedure. The aspiration tube is sized so that even if a maximum pressure occurs, the resultant aspiration flowrate will be such that the cornea will not be damaged when an occlusion is cleared from the tube. An in-line filter may also be attached to the aspiration tube to filter out particles in the system.
US08475396B2	Method and system of an acoustic scene analyzer for body sounds A system and method for visualizing auditory scene analysis by way of a portable device is provided. In one embodiment, the method steps include capturing multiple sounds from a sensor array of microphones connected to the portable device, performing auditory scene analysis on detected body sounds in accordance with a psychoacoustic representation of body organ functions, and rendering to a display of the portable device a visualization of auditory scene auscultation of the body sounds, including user input functionality for separated sound source tracks, sound source identifier tracks, and sound source location trajectories.
US08475394B1	Pet DNA specimen sampling for transport and long term storage A kit and method for collecting, storing and transporting genetic samples from an animal to a storage facility. The kit comprises at least a collection swab, a protective tube, a follicle sample collection card, and an extraction device. The collection swab is housed within a sterile protective package. The collection swab has a shaft connected at one end by a collection head. The collection swab includes a cap and plug, wherein the cap is encircled around the shaft of the collection swab. The protective tube is adapted to receive the collection head of the collection swab. The follicle sample collection card has a protective backing covering an adhesive strip disposed on the follicle sample collection card. The extraction device is provided to pull at least one hair with follicle from the animal. The kit may also include a specimen storage enrollment card to record pertinent information, and an envelope may be provided for storage and delivery of the protective tube and the follicle sample collection card including the respective genetic samples to a storage facility for processing and storage of the genetic samples at a controlled temperature above freezing.
US08475392B2	Needle for living body, tissue-sampling device and process for sampling tissue This invention provides a needle for a living body and a process for sampling a tissue with the needle. The needle and the process are used for harvesting a tissue sample from a living body with minimal damage. The needle is made of ceramics, and is provided with a sampling hole for aspirating a sample and with a cooling hole for supplying cooling gas. The holes penetrate through in the longitudinal direction, and have openings on a pricking-end surface of the needle. For the purpose of cutting off the tissue sample, the pricking-end surface is provided with a cutting part positioned between the openings. When the needle is pricked into a body, a tissue is aspirated through the sampling hole while cooling gas is being supplied through the cooling hole. Thus, the tissue is partly frozen or semi-frozen and cut off with the cutting part to harvest by aspiration.
US08475391B2	Method and system for quantitative assessment of spatial distractor tasks A method is presented to address quantitative assessment of spatial distractor tasks in a subject, where the method comprises the steps of: (1) presenting at least one scene to a subject on a display, said scene comprising a plurality of elements and a background; (2) modulating the saliency of a predetermined section of the scene; (3) receiving feedback from the subject; (4) superimposing an additional cue onto the scene; (5) generating a shift in attention of the subject; (6) receiving refined feedback from the subject; (7) quantitatively refining the refined feedback; (8) adjusting the motion associated with the scene relative to accuracy of the refined feedback; and (9) calculating a critical threshold parameter for the subject; and (10) recording the critical threshold parameter onto a tangible computer readable medium. An apparatus for quantitative assessment of spatial distractor tasks of a subject comprising a display device, an input device, a control device, and a tangible computer readable medium. In its simplest sense, quantitative assessment profile of spatial distractor tasks by psychophysical responses is generated on a tangible computer readable medium.
US08475387B2	Automatic and ambulatory monitoring of congestive heart failure patients This invention provides methods for non-invasively monitoring patients with congestive heart failure (CHF) and for reporting and/or warning of changes in the patients' status. The methods gather physiological data and combine the data into parameters by which the severity of CHF can be judged. Preferred parameters include periodic breathing and heart rate variability. This invention also provides systems for carrying out these methods which permit patients to engage in their normal daily activities. Preferably, physiological data analysis is performed by a portable electronic unit carried by the patients.
US08475380B2	Reduction of multiline artifacts in doppler imaging Certain embodiments of the present technology provide systems and methods that provide reduction of multiline artifacts in Doppler imaging. Certain embodiments provide for various ensembles of transmit beams at different spatial locations and overlapping receive beams between the locations. Certain embodiments provide for calculating various auto-correlation estimates based on the received beams and then combining the auto-correlation estimates to create an image. In certain embodiments, combining the auto-correlation estimates comprises applying a linear interpolation filter that decreases the weight applied for receive beams that are spatially located further away from the transmit beam.
US08475368B2	Health monitoring appliance A heart monitoring system for a person includes one or more wireless nodes; and a wearable appliance in communication with the one or more wireless nodes, the appliance monitoring vital signs.
US08475367B1	Biometric monitoring device having a body weight sensor, and methods of operating same A biometric monitoring device comprising a platform to support the body weight of the user; a body weight sensor to generate data which is representative of the user's weight, processing circuitry to calculate the user's weight, a user interface (e.g., a visual display, coupled to the processing circuitry, to display the weight of the user); and communication circuitry (implementing, e.g., wired, wireless and/or optical techniques) to: (1) receive user identification data (is any data that identifies a particular user, a particular device and/or from which a particular user or device may be determined) from an external portable activity monitoring device, (2) receive activity data from the external portable activity monitoring device, and (3) transmit the activity data to a data storage which is (i) external to the biometric monitoring device and (ii) associated with the user identification data.
US08475365B2	Hand-held medical device protective sleeve A clear, sealable isolation sleeve for use in a medical environment especially with hand-held electronic devices, for the purpose of reducing the spread of infectious diseases. The sleeve offers an isolated containment for such hand-held medical devices while in patient proximity. The sleeve features a perforated tear zone for easy removal and disposal. Embodiments of the present invention can be manufactured from a clear material that allows the hand-held device to read bar codes through it, while also allowing the clinician to read displayed data and manipulate keypads on the device all while contained within the sleeve.
US08475364B2	Endotracheal intubation system and intubation procedure An endotracheal intubation device includes an inflatable cuff connected to an inflation tube, visualization means, where the visualization means include means to enlighten and an image guide, where the means to enlighten, the image guide, and the inflation tube are associated to a first three ways connector adapted to connect the endotracheal intubation device to a control panel; a packaging is also provided containing the endotracheal intubation device wherein the first three ways connector is placed across the packaging so as to allow checking the endotracheal intubation device without impairing its sterility with an endotracheal intubation device tester; an intubation method is further provided using the packaging, the control panel and the endotracheal intubation device tester.
US08475355B2	Heart help device, system, and method A medical device for assisting in the maintaining of an opening created in the thoracic diaphragm is provided. The medical device comprises a diaphragm contacting part adapted to be placed in contact with the thoracic diaphragm and thereby assist in the maintaining of the opening created in the thoracic diaphragm. A pericardial drainage device for draining a fluid from the pericardium of a patient is further provided. The drainage device comprises a conduit; the conduit comprises a first and second section. At least a portion of the first section is adapted to receive a fluid inside of the pericardium. The second section of the conduit is adapted to be positioned outside of the pericardium of a patient and enable the exhaust of said fluid received from said pericardium through at least a portion of said second section.
US08475353B2	Brachytherapy apparatus, systems, and methods for using them An applicator for delivering brachytherapy includes elongate members movable between collapsed and expanded configurations for delivering brachytherapy within a lumpectomy cavity, a vaginal cavity, or other target region. The elongate members may be expandable into a symmetrical or asymmetrical expanded configuration, e.g., into a generally spherical, pear-shaped, or planar configuration. A system for delivering brachytherapy includes the applicator and an access device for lining and/or dilating a body cavity and/or for receiving the applicator therein. The access device is advanced into a body cavity, an expandable member on the access device is inflated, the applicator is advanced into the access device, and the elongate members are expanded to deliver radiation to the target region. Alternatively, the access device carries an expandable device into the target region, the expandable device is removed after dilating the target region, and the applicator is introduced through the access device to deliver radiation.
US08475351B2	Centrifuge having a seal mechanism The present invention provides a zonal centrifuge which has superior workability and functionality when a sample is filled and extracted. An oil bearing fitted to an outer circumference of a lower tube of a rotor is arranged on an internal face of a bearing housing fixed over a door adapter of the centrifuge. As the oil bearing and the lower tube are lubricated, a vacuum environment in a rotor rotating chamber is maintained. A rotating seal located at an upper leading end of the lower tube of the rotor and a fixing seal facing the rotating seal are arranged and provided in a sealed space formed by a mechanical seal member and the bearing housing, and the fixing seal is so manipulated as to be able to freely join and separate from the rotating seal.
US08475350B2	Technology for continuous folding of sheet materials A machine and method for the continuous folding of sheet material into difference three-dimensional patterns is featured. The innovative machine and method folds sheet material by force converging the sheet to a final stage that imparts a final fold or pattern. Unique programming allows for the change of convergence sequencing and change of materials.
US08475349B2	Method for folding film edges Pre-stretched films may be used to increase the rate at which loads can be wrapped and to minimize the exertion required when using traditional handheld film. However, the edges of pre-stretched films are easily damaged, which may result in tearing or failure of the film during use. The present disclosure describes devices, systems, and methods for folding the edges of the film, resulting in a film that is less susceptible to damage and easier to use.
US08475347B2	Industrial roll with multiple sensor arrays An industrial roll includes: a substantially cylindrical core having an outer surface; a polymeric cover circumferentially overlying the core outer surface; and a sensing system. The sensing system includes: a first signal carrying member serially connecting a first set of sensors; a second signal carrying member serially connecting a second set of sensors; and a signal processing unit operatively associated with the first and second signal carrying members and configured to selectively monitor the signals provided by the first and second set of sensors.
US08475342B2	Infant crawler-walker motor development apparatus This invention relates generally to a portable child development station. More specifically, an infant crawling and walking aid. The invention is collapsible and can be stored in smaller confines. When the invention is set up, it is structurally sound and safe with detachable variations allowing assistance in crawling as well as walking by suspending the infant with variable height adjustments to accommodate infant.
US08475339B2	Apparatus and method for correcting life patterns in real time A method for correcting life patterns for providing feedback for an exercise program periodically or in real time is disclosed. The method of the present invention detects a starting point of a dynamic activity interval periodically or in real time by sensing movement of a user in daily life, and provides an exercise program for filling a deficient amount of activity compared to a target value in the detected activity interval when the starting point is detected. Therefore, the method of the present invention may simply provide feedback for an amount of activity of a pertinent interval at an actual starting point of the dynamic activity interval, and thus the user may effectively follow the provided exercise program for correcting life patterns.
US08475338B2	Linear motor system for an exercise machine Exercise machines and linear motor systems for use in exercise machines are provided herein, where the linear motor provides a resistance force in response to a force generated by a user performing an exercise. The linear motor systems include a programmable logic and force generation control system, which is programmable to control the resistance provided by the linear motor.
US08475337B2	Vehicle heat management device When there is an extremely low ambient temperature, an electronic control unit controls operation of a circulation path for coolant water in such a manner that, after starting of an engine, the coolant water is supplied from the engine first to a throttle valve and an EGR valve and then to an oil warmer for a transmission. This solves a failure problem in the throttle valve and the EGR valve caused by frost formation at an early stage. As a result, desired operating performance of the vehicle is quickly ensured and heat management in the vehicle is carried out in a desired manner when there is an extremely low ambient temperature.
US08475335B2	Method and apparatus for adaptive clutch control for a vehicle having engine start-stop functionality A vehicle includes an engine, torque converter, transmission, accumulator, sensor, and controller. The engine is automatically restarted in response to a start signal during an engine auto-start event. The transmission has a calibrated line pressure and a plurality (n) of clutches. The (n) clutches are engaged to execute the engine auto-start event. The accumulator delivers fluid under pressure to the transmission in response to the start signal. The controller controls (n−1) of the plurality (n) of clutches to the calibrated line pressure in response to detecting the start signal. The controller also modifies clutch fill parameters which control a fill sequence of the remaining clutch, i.e., the designated control clutch, as a function of a deviation of the measured turbine speed from a theoretical no-slip turbine speed. A system includes the transmission, sensor, accumulator, and controller. A method for controlling the designated clutch is also disclosed.
US08475333B2	Method and apparatus for effecting light-off of a catalytic converter in a hybrid powertrain system A powertrain system includes a hybrid transmission and an internal combustion engine coupled to an exhaust aftertreatment device. A method for operating the powertrain system includes operating the hybrid transmission to generate tractive torque responsive to an operator torque request with the internal combustion engine in an engine-off state so long as the tractive torque is less than a threshold. The internal combustion engine is operated in an engine-on state at preferred operating conditions to effect light-off of the exhaust aftertreatment device and the hybrid transmission is coincidentally operated to generate tractive torque responsive to the operator torque request when the operator torque request exceeds the threshold. The internal combustion engine is then operated in the engine-on state to generate tractive torque responsive to the operator torque request.
US08475331B2	Method and device for controlling a creep operation of a vehicle with a hybrid drive The invention relates to a method and device for controlling a creep operation of a vehicle with a hybrid drive (1), comprising a parallel hybrid drivetrain (2), with an internal combustion engine (3), at least one electric motor (5), a first switching element (4) in the form of a friction element between the internal combustion engine (3) and the electric motor (5), a gearbox (7), an output (26) and a second switching element (6) arranged between the electric motor (5) and the output (26). According to the invention, a simple, effective and component-friendly continuous creeping can be achieved without additional constructional or economic costs can be achieved, wherein the creeping operation is carried out with the internal combustion engine (3) running and both switching elements (4,6) simultaneously operating with slip, wherein the total operating power required to generate a required creeping torque is variably distributed over both switching elements (4, 6).
US08475326B2	Outer plate carrier An outer plate carrier, including a cup-shaped embodied carrier plate (110) comprising a cylinder-shell shaped cylindrical section (130) and a circular-disk shaped bottom section (120). The bottom section (120) of the carrier plate (110) carries a cup-shaped hub section (140), arranged centrally. The cup-shaped hub section includes a cylindrical-shell shaped hub jacket (160) and a circular-disk shaped hub bottom (150). The hub bottom (150) has a smaller diameter than the bottom section (120) of the carrier plate (110). The hub bottom (150) is continuous and embodied in one piece with the carrier plate (110).
US08475324B2	Three-end shaft type differential gear set with controllable rotating direction and brake The present invention relates to a speed variable system, and in the first input rotating direction, it is capable of controlling the output shaft to output in normal and reverse rotating directions, and the input shaft is in different speed ratios to the output shaft with respect to the normal and reverse rotation directions.
US08475323B2	Combination brake clutch drive system and rotary-wing aircraft using same A drive system includes a planetary gear system. An input is affixed to a sun gear of the planetary gear system to rotate therewith and an output is affixed to the output ring gear to rotate therewith. A first brake system is selectively operable to rotationally lock an output ring gear of the planetary gear system, and a second brake system is selectively operable to rotationally lock the planet carrier of the planetary gear system. Rotary-wing aircraft implementations of the drive system are also disclosed.
US08475322B2	Automatic transmission An automatic transmission includes a double-pinion planetary gearset and two single-pinion planetary gearsets. A first ring gear is held stationary. A second sun gear and a third ring gear are coupled to a first sun gear and a first carrier respectively, constituting first and second rotor units. An output is coupled to a third carrier. A first clutch selectively couples a second carrier to the first rotor unit. A second clutch selectively couples the second carrier to the second rotor unit. A third clutch selectively couples an input to the second carrier. A fourth clutch selectively couples a second ring gear to a third sun gear. A fifth clutch selectively couples the second ring gear to the third carrier. A sixth clutch selectively couples the input to the third sun gear. Nine forward gear ratios and one reverse gear ratio are obtained by simultaneous application of three of the clutches.
US08475321B2	Differential assembly A differential assembly having a gearset, which has first and second side gears and a plurality of pinion sets, and a case assembly. Each pinion set has a first pinion meshingly engaged to the first side gear, and a second pinion meshingly engaged to both the second side gear and the first pinion gear. The case assembly has a case structure, a case cover and a gearset mount. The case structure defines a cavity into which the gearset mount is received. The gearset mount defines a plurality of first pinion bores into which the first pinions are received, a plurality of second pinion bores into which the second pinions are received and a side gear pocket into which the first side gear is received. The gearset mount is fixedly and non-rotatably coupled to the case cover. The case cover is separately coupled to the case structure.
US08475317B2	Vehicle accessory drive system A vehicle drive system includes a first power path wherein an engine drives an accessory and a starter-alternator at relatively low speed, a second power path wherein the engine drives the accessory and a starter-alternator at relatively high speed, a third power path wherein the starter-alternator drives the accessory while the engine is off, and a fourth power path wherein the starter-alternator cranks the engine before an engine restart.
US08475315B2	Swing internal contact type planetary gear device and rotation drive device An easily structured swing internal contact type planetary gear device is proposed which can achieve a higher meshing ratio when an involute tooth profile is adapted. Each of an internal tooth of an internally toothed gear wheel and an external tooth of an externally toothed gear wheel is formed with an involute tooth profile. Under a driving condition, one of an internal tooth body of the internally toothed gear wheel and an external tooth body of the externally toothed gear wheel is elastically deformed in an extending direction and the other thereof is elastically deformed in a contracting direction so that the number of meshing teeth becomes larger than the number of meshing teeth under a non-driving condition.
US08475312B2	Transmission for hybrid electric vehicle A transmission for a hybrid electric vehicle may include an input element where rotation power may be inputted and an output element from which the rotation power may be outputted, a first motor generator and a second motor generator, a first planetary gear set where the input element, the output element, and the first motor generator may be connected, a second planetary gear set that may be a multiple planetary gear set where the output element and the second motor generator may be connected and that includes at least four or more rotary elements, and a first clutch and a second clutch.
US08475301B1	Portable multi-functional gaming assembly and associated method A multi-functional gaming assembly may include a portable free-standing first section capable of being selectively modified into a baseball batting game, a basketball shooting game, and a tether-ball swinging game assembly respectively. A portable free-standing second section may be removably connected to the portable free-standing first section in such a manner that the portable free-standing first and second sections may cooperate to selectively include a tennis playing game, a badminton playing game, and a volleyball playing game. A plurality of anchor stakes may be removably attached to the portable free-standing first and second sections respectively. The portable free-standing first section may include a mobile primary base which may include a wire frame preferably having a handle and a plurality of rings extending out from a perimeter of the wire frame. The portable free-standing second section may include a mobile auxiliary base spaced apart from the mobile primary base.
US08475297B2	Golf ball with carbon dioxide absorbents This disclosure provides a golf ball that includes carbon dioxide absorbents in order that the golf ball may reduce atmospheric carbon dioxide levels to aid in alleviating global warming. The golf ball may include an intermediate layer that is substantially impermeable to water, in order to ensure that the golf ball's core is not degraded by water produced by the carbon dioxide absorbance reaction. The chemical absorbents may be encapsulated in microcapsules so that carbon dioxide is not absorbed until the golf ball is used by a golfer.
US08475294B2	Golf club head, face of the golf club head, and method of manufacturing the golf club head A golf club head that may increase the degree of freedom in design, a face of the golf club head, and a method of manufacturing the golf club head are provided. At least part of the golf club head includes an alloy, and the alloy includes Co and Fe in a total amount of 33 mass % to 65 mass %, Ni in an amount of 15 mass % to 35 mass %, Cr in an amount of 10 mass % to 25 mass %, Mo in an amount of 3 mass % to 12 mass %, at least one of Nb in an amount of 2 mass % or less and W in an amount of 5 mass % or less, and at least one of Mn in an amount of 2 mass % or less and Ti in an amount of 1 mass % or less.
US08475293B2	Iron golf club head with improved performance An iron type golf club head with improved performance is disclosed herein. More specifically, the present invention discloses an iron type golf club head having a frontal face portion made out of a lightweight material that is separate and distinct from the material used to form the remaining body portion of the iron type golf club head. The thinner material allows the frontal face portion of the iron type golf club head to be made thinner, yielding improved performance characteristics such as a higher Coefficient of Restitution (COR) of greater than about 0.770, a lower Center of Gravity (CG) location of less than about 5.0 mm from a ground, and a lower primary resonant frequency of less than about 5,000 Hertz.
US08475289B2	Launch monitor A launch monitor that includes substantially all of its functional components on or within a housing is disclosed. In one embodiment, the launch monitor is capable of being transported and used in any desired location. One or more camera's, flashes, and triggers may be used to acquire images of a golf club and golf ball. The launch monitor is preferably capable of receiving and transmitting data over a wireless network. Acquired images and other data may be analyzed by a processor, and then displayed using an LED, LCD or other type of display or printer. The launch monitor may “recognize” a plurality of golf clubs and golf balls based on an optical fingerprint. The optical fingerprints, which are preferably stored in a memory, allow the launch monitor to identify a golf club and/or ball substantially soon after they are placed in the field of view of the monitor Optical fingerprinting enables automatic record keeping, and storing performance data and equipment used simultaneously. This feature eliminates tedious record keeping, eliminates data entry errors, and enables rapid equipment optimization.
US08475282B1	Engine agnostic interface for communication between game engines and simulation systems A software architecture is provided that has an agnostic interface mechanism coupled between a simulator and a game engine. The agnostic interface mechanism has an extension interface to translate simulator specific data objects to/from interface objects, a reflector interface to translate interface data objects to/from game specific objects, a launcher interface to translate interface control objects for controlling the game engine into game specific control objects, and a core control coupled between the extension interface and the reflector and launcher interfaces for controlling the communication of objects between the simulator and the game engine. The core control through the reflector and launcher interfaces provides game specific objects to the game engine through direct application programming interface (API) calls.
US08475280B2	Gaming server providing on demand quality of service The present invention teaches methods and systems for providing a gaming server system (Gaming System) for enabling a quality-of-service on-demand (QoS) broadcast system to provide a gaming computer or game console with premium levels of quality-of-service. The gaming server provides premium network connection service levels based upon customer profile, current activity, account status or other criteria.
US08475276B2	Gaming system A method of operating a gaming system including a plurality of gaming machines and at least one server system. The method includes providing at least a first gaming service to each gaming machine by way of one or more first software processes and providing at least one second service common to a subset of the plurality of gaming machines, the second service implemented by one or more second software processes. The method also includes enabling inter-process interaction between at least one software process of the first service and at least one software process of the second service to enable interaction between the services. A server system, gaming machine and gaming system is also disclosed.
US08475272B2	Game program, storage medium, game device and game system In a game program for a multiplayer game, when a player character receives damage and the strength level reaches a certain level, the player character goes into an extension state before death, in which the character is weakened but is able to recover. If a friendly player character performs a recovery action within a certain time from the weakened state having been reached, the player character in the weakened state recovers to a normal state. On the other hand, if the player character in the weakened state is attacked by an enemy character, or if the certain time has elapsed, the player character in the weakened state is caused to die and the game is ended.
US08475260B2	Gaming machine and method for controlling the same N symbol arrays are scrolled in M rows and N columns of display regions. In each of the symbol arrays, a normal symbol same as a certain normal symbol does not exist within (M−1) rows above and below the certain normal symbol. Therefore, two or more of the same normal symbols are not displayed in each column of display regions, and a maximum of N of the same normal symbols are displayed in all the display regions. Further, the same normal symbols as those present within (M−1) rows above and below the special symbol included in one symbol array do not exist within (M−1) rows above and below the special symbols included in the other symbol arrays. Therefore, when N of the same normal symbols are displayed, a maximum of one special symbol is displayed.
US08475257B2	Bingo system with downloadable common patterns Novel methods, devices and systems are described for mapping a variety of Class III game outcomes to a common set of bingo patterns. Each game theme may have a different entertaining display, based upon a corresponding Class III game. Preferably, each game theme will offer game play and paytable percentages closely matching those of the original Class III game. Some implementations provide a system wherein electronic gaming machines presenting entertaining displays of various Class III game themes are linked to a single bingo server. By linking many participating electronic gaming machines to a single server, some implementations of the invention allow all of the progressive contributions to be pooled into one large progressive jackpot, thereby making the game more attractive to players.
US08475252B2	Multi-player games with individual player decks An automatic multiple player gaming machine includes a central game processor and multiple player terminals, wherein each player terminal includes a player input and a player display. The gaming machine also includes a common game display and a game program residing in the processor, wherein the game program executes an interactive multiple player game. The processor further displays individual hands of cards on each player display, wherein each hand of cards is randomly selected from its own set of cards. The operation of such a machine may be effected in a computer-based method as well.
US08475247B1	Threshing bars and combine harvester thresher formed therewith A combine harvester threshing drum threshing bar includes a rigid, integral, unitary threshing fixture having a leading edge and an opposed trailing end, an upstream face and an opposed downstream face formed with an oblique crop deflecting surface, a threshing side and an opposed threshing drum emplacement side. The threshing side includes a trailing threshing face formed toward the trailing end of the threshing fixture, and an inclined leading threshing face extending from the trailing threshing face to the leading edge, and which cooperates with the threshing drum emplacement side and the upstream and downstream faces of the threshing fixture at the leading edge to form a wedge in the threshing fixture. Crop threshing grooves are formed in the trailing threshing face of the top threshing side of the threshing fixture, which extend from the trailing end to the leading threshing face of the threshing fixture.
US08475242B2	Coin sorting plate with recessed coin slots A coin sorting plate for receiving and sorting a stream of coins by the diameter and hence the denomination of the coin has a number of coin recesses that extend along the path of the coin stream. Each coin recess is sized to receive a respective coin diameter. The coin recesses are arranged with the recess openings increasing in size in the downstream direction to progressively remove coins in order of increasing diameter. Each coin recess is bounded by a downstream wall that forces a coin in the recess to move off a peripheral edge of the coin sorting plate for collection or other processing.
US08475234B2	Power tool holding article A power tool holding article is provided and fastened to a power output element by clamping. The power output element has a fastening portion which has at least one protrusive fastening element to hold the holding article. The holding article has an article body and a mating portion connecting to the article body. The mating portion has a plurality of bulged elements spaced from each other to form a plurality of holding spaces. The protrusive fastening element of the fastening portion is engaged with the holding spaces to hold the holding article. Thus no special-shaped drilling openings are needed on the holding article. It can mate power output elements made by varying producers to reduce cost and improve compatibility.
US08475232B2	Grinding machine A grinding machine includes a machine frame with a work piece support surface on which a work piece may be transporter through the machine. A grinding bar arrangement including two grinding shoes positioned in parallel is arranged transversely with respect to a work piece feeding direction across the width of the work piece support surface. The two grinding shoes carry a grinding medium on their surfaces facing the work piece support surface and are suspended via an eccentric drive. The two grinding shoes perform rotary movements in a plane parallel to the work piece support surface achieving a high quality grinding result.
US08475231B2	Carrier head membrane A flexible membrane includes a horizontal central portion, a vertical portion coupled to the central portion, a thick rim portion coupled to the vertical portion, and an extension coupled to the thick rim portion. An outer surface of the horizontal central portion provides a mounting surface configured to receive a substrate. The thick rim portion has a thickness that is greater than a portion directly adjacent to the thick rim portion. The thick rim portion is between the extension and the vertical portion and a greatest dimension of the extension is less than the thickness of the thick rim portion.
US08475221B1	Watercraft speed control device An automatic speed control system that provides desired watercraft velocity over land. The coupled algorithms correct engine speed and torque using inertia based measurements, GPS, and tachometer measurements, and the corrections are augmented and enhanced by velocity/speed and torque/speed relationships that are dynamically and adaptively programmed with real-time data collected during replicated operations of the watercraft in specified conditions.
US08475219B2	Data collecting connection Disclosed herein is an apparatus. The apparatus includes a first body, a second body, and an electronic circuit. The first body includes a first end, a second end, and a middle section. The first body further includes a first conductor receiving area and a recessed cavity. The first receiving area extends from the first end to the second end. The cavity is at the middle section. The second body is adapted to be removably connected to the first body. The second body includes a first end, a second end, and a second conductor receiving area. The second conductor receiving area extends from the first end to the second end. The apparatus is adapted to receive an electrical conductor between the first receiving area and the second receiving area. The electronic circuit is at the cavity. The electronic circuit is configured to receive reference information corresponding to the electrical conductor.
US08475218B2	Sinking electrical connector with an improved mounting member A sinking electrical connector defines a receiving space for receiving a corresponding plug and includes an insulative housing, a plurality of contacts retained on the housing, and a metal shell covering the housing. The shell includes a top wall, a bottom wall opposite to the top wall, a pair of side walls, and at least one mounting member. The mounting member has a first extending plate extending laterally from the side wall, a second extending plate extending backwardly from the first extending plate, a third extending plate extending inwardly toward the side wall from the second plate, and a mounting tail extending downwardly from the second extending plate to be mounted onto a printed circuit board.
US08475215B2	Replaceable connection for portable electronic devices Systems and methods electrically connect a first electronic device or electrical component, having a external electrical connector, to a circuit board of a second electronic device. A low-cost, user-installable connection system isolates mechanical stresses imposed on the external electrical connector to within the user-installable connection system, thereby preventing the mechanical stresses from reaching the circuit board in the second electronic device. If the connection becomes faulty, only the low-cost, user-installable connection system must be replaced.
US08475206B2	Coaxial connector and method for assembling the same A coaxial connecter and a method for assembling the same are provided, in which there is little variation in the amount of holding an inner conductor between connection terminals and the connection between the inner conductor and the connection terminals is achieved with high reliability. The coaxial connector includes a housing, an inner contact, and an outer contact. The inner contact is secured to the housing and includes a conductor mounting portion and a conductor holding arm with a lock. The conductor holding arm is integrally formed with the conductor mounting portion. The outer contact is secured to the housing, as well. Either the housing or the conductor mounting portion is provided with a holding portion into which the lock is press-fitted when the conductor holding arm is folded toward the conductor mounting portion.
US08475200B2	Cable insertion having upstream mounting fixture The present disclosure relates to a cable insertion (1) for connecting a cable (7) to a housing (10). The cable insertion (1) includes a connection device (2) having a cantilever-like element (14) having a mounting fixture (11) on the front end thereof for mounting a mating part (3) attached to a jacket (12) of the cable (7). A securing means (4) secures the fixture.
US08475196B2	Unlubricated bearing structure and IC socket using same An unlubricated bearing structure for supporting a rocking arm of an IC socket includes an arm support as an operating member that supports the rocking arm, a support shaft, made of metal, fitted and fixed to the arm support, and a cylindrical bush, made of metal, mounted to the support shaft so that the cylindrical bush is fitted into a bearing hole formed to the rocking arm. The support shaft, the cylindrical bush and the rocking arm are arranged such that a first clearance is formed between an outer peripheral surface of the support shaft and an inner peripheral surface of the cylindrical bush, and a second clearance is formed between an outer peripheral surface of the cylindrical bush and an inner peripheral surface of the bearing hole.
US08475192B2	Bushing seal for reefer plug A bushing for a reefer plug includes an annular body having proximal and distal ends and an interior conduit for receiving an electrical cable. A distal circumferential seal portion is at the distal end, the distal circumferential seal inclining radially outwardly in the distal to proximal direction. A reefer plug assembly and method for connecting an electrical cable to a reefer plug are also disclosed.
US08475191B2	Electrical terminal having a constantly visible labeling field An electric connection terminal includes a housing having at least one conductor insertion opening. A clamping spring is disposed in the housing. A metal part is disposed in the housing. An actuating element is disposed in the housing and has a handle configured to move the actuating element into an open position and a closed position so as to open and close the connection terminal. A labeling field identifying the connection terminal is disposed so as to be visible to a user at all times.
US08475189B2	Connection unit for fluorescent tubes A connection unit for fluorescent tubes includes a base connected to each of two ends of a light unit and the base has an extension, two conductive plates are connected to two reception areas of the extension, a cover is removably connected to the base and has a room and a recessed area is defined in the top of the cover, a rotatable member is removably connected to the recessed area and has a face board which has a reception hole communicating with the room, a shank is connected to the periphery of the reception hole and the rotatable member is rotatable about an axis of the recessed area, the base and the conductive plates are pulled out from the recessed area and the room respectively.
US08475188B2	Modular multiple-circuit electrical system A multiple circuit duplex module comprising a chassis having an electrical chassis receptacle providing a plurality of connection points for the selection of power from two or more different circuits; a duplex element having at least one electrical duplex receptacle thereon to deliver power from one of the two or more different circuits to an external device in electrical contact with the at least one duplex receptacle; first conductor means for electrically connecting the at least one duplex receptacle to selected connection points in the chassis receptacle; wherein the duplex element is connectable to the chassis in different orientations, the orientation of the duplex element determining which one of the two or more different circuits is electrically connected to the at least one duplex receptacle.
US08475187B2	Electrical charger locking assembly There is provided an electrical charger including a charger assembly and a locking assembly. The charger assembly includes a base unit configured for being electrically coupled to an electronic device, and an adaptor unit configured for being electrically coupled to a power supply. The external surfaces of the base unit and the adaptor unit include co-operating external geometries that provide a visual indication whether the charger assembly is disposed in the locked state or the unlocked state.
US08475185B2	Solar panels grounding clip A grounding clip for electrically bonding at least three objects in one action. In use, the grounding clip is interposed between at least three objects such that the first and second banks of teeth are configured to penetrate the objects to electrically bond them. The grounding clip has a planar body, a pair of opposingly disposed first banks of teeth that extend downwardly and outwardly from the planar body at an angle. There is also a pair of opposingly disposed second banks of teeth formed of a rotatable plate disposed in a plane at an angle and extending downwardly and outwardly from the planar body. The second banks of teeth terminate in a plurality of second teeth disposed upwardly and in an angled plane with respect to the rotatable plate.
US08475182B2	Board-to-board connector A board-to-board connector includes a double plastic pin header connector and a supporting plate. The double plastic pin header connector includes two opposite positioning plates, and a number of pin headers arranged in two rows and extending through the positioning plates. The supporting plate is placed between the two rows of pin headers, with opposite ends of the supporting plate resisting against the corresponding positioning plates.
US08475177B2	Backplane cable interconnection A backplane cabling interconnect scheme is provided that includes a wafer based cable termination and an organizer shroud. The shroud complements existing backplane connectors and provides positioning and polarization for the cable terminated wafer. The wafer cable ends can be stacked or arranged in various arrays and are held in place with an integral latch. A permanent latch is provided for high vibration environments.
US08475176B2	Integrated structural and electrical connector An integrated electrical connector comprises one or more terminals housed within a connector body. The connector body is configured and arranged to structurally join an auxiliary component to a host vehicle to which the integrated electrical connector is mechanically fixed and electrically coupled. The connector body is configured to facilitate electrically coupling electrical circuitry of the auxiliary component to the host vehicle. The connector body is configured to facilitate transmission of information among the auxiliary component and the host vehicle.
US08475172B2	Motor learning and rehabilitation using tactile feedback There is disclosed a process for motor learning, for teaching motion, or for rehabilitation of a student, the student having a motor sensory system. Plural transducers may be coupled around at least one joint of a student, the transducers for providing kinesthetic sensations to the student through its motor sensory system. Tactile control signals may be provided to control operation of the transducers to guide motions of the student.
US08475169B2	Teaching apparatus for enterprise input-output A teaching apparatus for enterprise input-output includes a base, said base defining a market system; a first block body defining a management module; a plurality of bands defining a production system and a product development system module, and a business system module, each band being sandwiched between two adjacent cuboids of the first block body; a vertical column defining a planning system module; a second block body defining a strategy module; a reverse quadrangle cone defining an information processing module; a cuboid vertical column disposed at a top of the reverse quadrangle cone; and a core solid column defining an internal information system, the core solid column penetrating through a center of the first block body, the bands, the vertical column, the second block body, the reverse quadrangle cone, and the cuboid vertical column.
US08475167B2	Magnetically implantable prosthetic device and method to shorten healing time, enhance bone fusion, and retard bacterial growth A prosthetic implant is provided that has an implantable magnetic base structure that supports or couples with a prosthetic superstructure for implantation in a mammal. The implantable base more quickly fuses with surrounding tissue or bone with the aid of a magnetic field. The superstructure abuts and is supported by the implantable base, and each comprises a biocompatible magnetic material to establish a magnetic field in the region of the tissue surrounding the implantable base. An anchoring arrangement may be employed to fasten the superstructure to the base. Together, the magnetic base, superstructure, and/or anchoring arrangement are positioned relative to each other to concentrate a magnetic field in the region of the implant to facilitate fusion of the base structure with surrounding bone or tissue. Advantageously, the magnetic field shortens the healing time and retards bacterial growth to quickly fuse the base structure with the surrounding bone or tissue.
US08475166B1	Upper denture release apparatus and method of use An upper denture release apparatus and method of use. A denture puller has a chin rest, arm attached to the chin rest, and a hook attached to an end of the arm opposite the chin rest. An upper denture has a notch sized and located to admit the hook when a wearer's chin rests on the chin rest. The method includes the steps of resting a wearer's chin on the chin rest, inserting the hook into the upper denture notch, and opening the wearer's mouth, thus pulling the upper denture off the wearer's upper gum. Arm length adjustment is shown, whereby the denture puller may be adjusted to fit differently-sized upper denture wearers. Preferred hook declination, hook toe, arm and notch floor angles are disclosed.
US08475164B2	Apparatus and method for rotating a fire, a flame, a smoke plume, or for circulating heat The invention relates to a device (10) and a method for rotating a flame and/or a plume of smoke, arranged with a heat source (36) in a chamber (16) with at least one gas inlet opening (24, 26, 30) and a gas outlet opening (32). The gas inlet opening (24, 26, 30) and the heat source (36) are located in a lower area (12, 20′) of the chamber (16). The gas outlet opening (32) is located in an upper region (14) of the chamber (1.6). In this way, an ascending gas flow may be generated in the chamber (16). At least one gas inlet channel or nozzle (24, 26, 30, 40) is adapted to direct inflowing gas therethrough into the lower area (12, 20′) of the chamber (16) approximately along an inner wall of the chamber about an at least approximately circular path following along the inner wall in the same rotational sense around the heat source and then is drawn upwardly by a draw of the upwardly flowing heated gases though the gas outlet opening (32). A flame or smoke plume inside the chamber (16) can thereby be placed into a rotary motion.
US08475161B2	Regenerator burner In a high efficiency regenerator burner for heating spaces, the exhaust gas generated by the burner is provided which is conducted alternately through different regenerator cartridges and a partial stream of the exhaust gas is conducted under the control of an orifice plate through a bypass space in which the regenerator cartridges are disposed. A control structure is disposed in a burner head for controlling the exhaust gas bypass flow volume and also to control the main exhaust gas flow as well as the combustion air flow through the regenerator cartridges.
US08475156B2	Injection mold An injection mold for molding a product having a hook portion includes a stationary mold, a return pin, a movable mold, an ejector mechanism and a plurality of ejector pins for ejecting the product out of the injection mold. The movable mold defines an inserting perforation, a receiving groove and a receiving gap. The ejector mechanism includes a slide block located in the receiving groove, a supporting bar stretching into the receiving groove, and an inclined ejector pin having a tail at a top thereof movably inserted in the inserting perforation and fastened on the slide block. The slide block is pressed downward by the return pin when the injection mold is closed. When the injection mold is opened, the slide block drives the inclined ejector pin to move upward and sideward under an upward push of the supporting bar to make the hook portion parted from the tail.
US08475155B2	Injection molding nozzle having a bracing component and a securing component A runnerless nozzle for an injection molding apparatus includes a bracing component having an internal space and a lateral bore, a nozzle tip extending from the internal space through the lateral bore of the bracing component, and a securing component installable in the internal spaced of the bracing component. At least one of the bracing component and the securing component defines a lateral channel in communication with and upstream channel for delivering molding material to the nozzle tip. The securing component includes an angled surface for wedging a likewise angled surface of the nozzle tip to engage the nozzle tip with the bracing component when the securing component is installed in the bracing component.
US08475154B2	Flower pot mold for blow molding The present patent application provides a flower pot mold for blow molding. The mold can reduce the number of the sliding blocks that need to be moved, and utilize the motion of a single sliding block to mold a flower pot so as to improve the manufacturing efficiency and the product quality. The mold includes a flower pot cavity template; a container opening pulling mold; a plurality of opening flanged pulling plates, a blowing tube being disposed in the container opening pulling mold; a fixing plate configured for fixing the mold onto a clamping set; a guiding block configured for guiding the opening flanged pulling plate and a blocking plate; and the blocking plate configured for blocking the plastics. A sliding track is formed on the flower pot cavity template and configured for allowing the blocking plate to move back and forth.
US08475147B2	Gas/fluid inhibitor tube system A pump assembly having an inhibitor tube is provided for lifting produced fluids to the surface. The pump assembly includes a pump and may optionally include a gas separator. The pump assembly includes an inhibitor tube having an outlet configured to be in fluid communication with the suction opening of either the pump or the gas separator. The inhibitor tube allows for the separation of gas from the produced fluid prior to the produced fluid entering the gas separator or the pump.
US08475146B2	Blower adapter and blower using the same An adapter, containing at least an inlet portion, an outlet portion, and a transition portion. The inlet portion, the outlet portion and the transition portion are integrally formed, and the transition portion bends upwards whereby staggering the inlet portion and the outlet portion. The adapter is easy to assemble and disassemble, which makes it easy to connect the blower to an external equipment. Moreover, the adapter is integrally formed, features simple structure and is convenient to cast, all of which reduces time for production and mold opening, and thus decreases production cost.
US08475145B2	Micro-fluidic systems based on actuator elements The present invention provides micro-fluidic systems, a method for the manufacturing of such a micro-fluidic system and a method for controlling or manipulating a fluid flow through micro-channels of a such a micro-fluidic system. Herefore, an inner side of a wall of a microchannel is provided with actuator elements which can change shape and orientation as a response to an external stimulus. Through this change of shape and orientation the flow of a fluid through a microchannel may be controlled and manipulated.
US08475142B2	Pump having a magnetically actuated control valve for suction regulation The invention relates to a pump comprising a pump unit, an intake line, and a valve device associated with same for implementing suction regulation of the pump, and comprising an intake region downstream from the valve device as viewed in the direction of flow of the medium conveyed by the pump.
US08475140B2	Dual volume-ratio scroll machine A compressor may include a shell, first and second scroll members, and a first annular seal. The first scroll member may be supported within the shell and may include a first end plate having a first spiral wrap extending from a first surface thereof and a second surface having an annular groove therein. The annular groove may include a first portion having a first depth and a second portion disposed radially inwardly relative to the first portion and having a second depth that is less than the first depth. The second scroll member may be supported within the shell and may include a second end plate having a second spiral wrap extending therefrom and meshingly engaged with the first spiral wrap. The first annular seal may be positioned within the annular groove.
US08475139B2	Method and apparatus for a jet pump slip joint internal seal A method and apparatus for a Boiling Water Reactor (BWR) jet pump slip joint internal seal for an interface between an inlet mixer and a diffuser of a jet pump assembly. The internal seal effectively mitigates leakage and slip joint flow induced vibration (FIV) between the inlet mixer and diffuser to reduce damage to many of the jet pump assembly components. A metallic seal of the slip joint internal seal flares out to conform the internal seal to a range of gap sizes, and compresses or springs back to nominal dimensions as thermal expansion and contraction occurs. The internal seal is self-expanding/self-tightening, as the internal seal flares further outward as a result of the internal pressure caused by flowing fluids in an operating jet pump assembly.
US08475136B2	Compressor protection and diagnostic system A compressor includes at least one current sensor and processing circuitry in communication with the at least one current sensor. The processing circuitry declares a locked rotor condition when current drawn by the compressor is at least forty percent of peak locked rotor current.
US08475135B2	Wind turbine blade with sufficiently high strength and light weight A wind turbine blade is provided with an outer skin layer formed of fiber-reinforced plastic, and a plurality of main structural members formed of fiber-reinforced plastic integrally with the outer skin layer to extend in a blade length direction. The main structural members include a plurality of main dorsal structural members positioned on a dorsal side of the wind turbine blade, and a plurality of main ventral structural members positioned on a ventral side of the wind turbine blade.
US08475127B2	Method and device for controlling a rotary wing aircraft The invention relates to a method for controlling a rotary wing aircraft with at least one main rotor, comprising a rotor head and rotor blades (12), arranged such that each rotor blade (12) is supported to be able to pivot or twist around the lengthwise axis of its blade on the rotor head and has at least one control flap (14) that can be deflected. According to the invention, the rotary wing aircraft is controlled solely by changing the respective blade pitch angle (X) by means of changing the flap control angle (Y) of the assigned control flaps (14) by the resulting blade pitch angle (X3) being set by applying the resulting flap angle (Y4) to the control flap (14), and the flap angle (Y4) being computed using an algorithm, the input quantities comprising the flap control angle (Y1) depending on the pilot primary control and the flap correction angle (Y2) depending on the secondary control.
US08475123B2	Fan housing structure A fan housing structure including a base seat and a sideboard. The base seat has a bed section and a mating section extending along a periphery of the bed section. The bed section has a bush made of a material other than the material of the bed section. The bush is disposed on the bed section to axially protrude therefrom. The sideboard is made of a material other than the material of the base seat. The sideboard is disposed on the mating section and integrally connected with the base seat. The sideboard and the base seat together define a space therebetween. The sideboard and the bush are made of a material other than the material of the base seat and are integrally connected with the base seat by means of insert injection molding. Accordingly, the fan housing structure has enhanced structural strength and thinner thickness to save room.
US08475122B1	Blade outer air seal with circumferential cooled teeth A BOAS with a blade tip shroud having a row of teeth formed by rows of grooves on an underside surface, and where rows of teeth include cooling air passages to provide cooling for the blade tip shroud and to discharge cooling air into the blade tip gap to reduce an effective hot gas leakage area to reduce the blade tip leakage flow. The cooling passages include inlet convergent channels to increase the cooling air flow velocity, followed by flow metering sections and then cooling air exit slots that open onto the bottom surface of the teeth.
US08475121B1	Ring segment for industrial gas turbine A ring segment for a turbine in an industrial gas turbine engine, the ring segment having an inner side with a number of pedestals extending radially inward, each pedestal having an inlet metering hole connected to a diffusion chamber having an opening flush with a TBC covering the pedestals. The pedestals form a larger surface area to secure the TBC to the ring segment so that the TBC can be formed thicker than the prior art without spalling.
US08475120B2	Exhaust gas turbocharger for an internal combustion engine In an exhaust gas turbocharger for an internal combustion engine, including a turbine housing and a rotor, the housing having an exhaust gas guide section and the rotor including a turbine wheel and a shaft connected to the turbine wheel which is driven by exhaust gas, and a control device for controlling the exhaust gas flow to the turbine wheel comprising an annular guide vane structure and an axial slide supported on a contour sleeve mounted to the turbine housing remote from the rotor and extending toward the rotor and forming also the turbine exhaust gas discharge duct, the axial slide includes a cavity accommodating the guide vane structure.
US08475118B2	Rotor path arrangements Within such machines as gas turbine engines it is desirable to provide close association between rotating assemblies and a rotor path arrangement to reduce leakage. However, such arrangements of rotor assemblies and rotor path arrangements are subject to thermal cycling and differentials between the respective parts can lead to rub associations. In order to allow closer thermal responses between the respective rotor path arrangement and rotor assembly, a flexible assembly is provided for a liner. A face surface is presented upon a backer plate or floating ring such that the thermal response can be tuned to the reciprocal similar effects under the same conditions of the rotor assembly. In such circumstances, closer gap control can be achieved. Furthermore, rather than requiring an entire integral casing to be overhauled, generally only the face surfaces and/or the flexible assembly will require remedial action.
US08475115B2	Pre-filtration bypass for gas turbine inlet filter house An inlet filter house is provided for use with a turbine engine including an inlet duct. The inlet filter house is coupled to the inlet duct and includes an inlet hood including a filter assembly selectively positionable between an operating position and a bypass position. An actuating assembly is coupled to the filter assembly to selectively position the filter assembly. A sensor is configured to detect at least one operating parameter. A controller is coupled to the sensor for actuating the actuating assembly based on the at least one operating parameter.
US08475113B2	Hydroelectric power device A hydroelectric power device equipped with a casing member that has a channel that passes through from an opening on the water entry side towards an opening on the water discharge side, a rotor having a plurality of blades that are integrally fixed respective to the rotating shaft and are disposed inside the channel of the casing member, and a tapered portion, that is provided on the opening on the water entry side of the casing, and that is formed such that the cross-sectional area of the tapered portion is gradually decreased towards the downstream side.
US08475110B2	System and method for online monitoring of corrosion of gas turbine components A system and method capable of performing online corrosion monitoring of a component installed in a gas turbine. A sensing device is located so that electrodes thereof are exposed to an operating environment within the gas turbine section containing the component. The electrodes are formed of a material so that the component and electrodes similarly respond to corrosive agents within the gas turbine section. The electrodes are electrically insulated from each other and each electrode is operable as an anodic electrode or a cathodic electrode, depending on the extent of corrosion thereat, so that each electrode has an electrical potential value, voltages exist across the electrodes, electric currents flow between the electrodes, and the electrical potential/current values correspond to corrosion behaviors at the anodic electrodes. During gas turbine operation, output signals are obtained from the sensing device and indications are provided as to when certain maintenance operations should be performed on the gas turbine.
US08475104B2	Book production line for producing books composed of book blocks inserted into a casing A production line including a casing-in machine and a processing section upstream of the casing-in machine. The processing section includes processing stations arranged at clocking intervals along the processing section to process a book block spine. The processing section includes a first processing station group and a second processing station group. The production line further includes a conveyor to successively supply the book blocks in clocked operation to the processing stations. The conveyor includes a first conveying section assigned to the first processing station group, the first conveying section including a first individual drive, and a second conveying section assigned to the second processing station group, the second conveying section including a second individual drive. The production line further includes a control unit operatively connected to the first individual drive and second individual drive to change the clocking interval length along the processing section.
US08475102B2	Enhanced conductivity sleeved fastener and method for making same A sleeve interference fastener adapted to be installed in a hole of a structure includes a sleeve; a pin member, wherein the pin member has a transition zone between a shank portion and a locking portion and wherein a portion of the pin member comprises a low friction dielectric coating; a locking member; wherein, in the installed position, a first interface between the shank portion of the pin member and the sleeve is substantially free from the low friction dielectric coating, and wherein, in the installed position, the transition zone of the pin member and a second interface between the locking portion of the pin member and the locking member are substantially covered with the low friction dielectric coating.
US08475100B2	Wall fastener with knife blade and a string A wall fastener includes a nut having a major planar structure having a hole for receiving a screw, the major planar structure having a first end with two staggered knife edges on opposite sides of the major planar structure and a second end; and a string, wherein the string is detachably connected to the major planar structure.
US08475099B2	Self-clinching blind floating fastener A fastener device includes a self-clinching retainer and a blind fastener. The self-clinching retainer is mounted to a hole in a sheet. The blind fastener is at least partially floating within the self-clinching retainer. The blind fastener has blind thread so that any debris from engaging another fastener is captured within the blind fastener.
US08475095B2	Transport unit and set for securing cargo items A transport unit is provided for cylindrical cargo items supported on a support surface and arranged in parallel in at least two layers. The center axes of cargo items are arranged on top of one another and extend essentially in the same vertical plane. At least one tension device extends between two layers. The tension device extends from an outside edge of a cargo item to an outside edge of an opposing cargo item in the layer. At least two stop elements are positioned on respective ends of the tension device. The stop elements are formed for engaging the cargo items and at least one of the stop elements being adjustably positionable on one end of the tension device. The stop elements being connectable by the tension device in a force transferring manner relative to the cargo items.
US08475094B2	Fixing structure of spindle balancer for machine tool technical field A fixing structure of a spindle balancer for a machine tool is described as having a flange member having a supported surface and provided fixedly to a cylinder body of a gas spring, a supporting member having a flange receiving surface and a fixing hole, and secured to the spindle head of a machine tool, and a plurality of fastening members for fastening the flange member to the supporting member so as to allow the supported surface of the flange member to abut against the flange receiving surface of the support member.
US08475091B2	Drill guide A drill guide, of the type that has a main body with a flat base and an aperture for assisting the movement of a drill bit, interchangeable drilling heads for guiding drill bits of different diameters, the heads designed to be optionally attached and fit onto the housing defined according to the size of through hole of the main body that has the aforementioned interchangeable drilling heads and inside apertures of different diameters on each drilling head, the apertures are specifically designed to guide drill bits of different diameters, a positioning device for attaching the drilling head in use in a set position inside the housing, and a retaining device for retaining any of the interchangeable drilling heads inside the housing.
US08475090B2	Drill with a centering drill insert, and a method of using a drill with a centering drill insert, and the insert therefor An insert includes a body portion and at least one cutting edge disposed on the periphery thereof. The cutting edge includes an inner lip and an outer lip disposed at an angle with respect to one another. A line extending along the inner lip intersects with a line extending along the outer lip at the vertex of the angle. The angular cutting edge further includes a protuberance disposed between, and connecting the inner and outer lips and projecting outwardly away from the body portion beyond the vertex of the angle defined by the intersection of the lines extending from the inner and outer lips. The protuberance having an inner lip connected to the inner lip of the cutting edge and an outer lip connected to the outer lip of the cutting edge to form smooth curvilinear transitions between the lips of the protuberance and the lips of the cutting edge.
US08475087B2	Tool for chip removing machining, as well as a basic body and a cutting insert therefor A tool for chip removing machining, including a basic body, in which at least one seating is included, which is delimited by a base surface and a rear support protruding in relation to the base surface, the base surface including a first coupling section in the form of one or more ridges and grooves, and a replaceable cutting insert having an upperside, an underside and a clearance surface extending between the upperside and the underside and transforming into the upperside via at least one cutting edge, the underside including a second coupling section having one or more grooves and ridges which engage the grooves of the first coupling section, and vice versa, at the same time as a part of the clearance surface is urged against the rear support. An imaginary extension of the ridges of the first coupling section extends by the side of the rear support.
US08475083B2	Umbilical for underwater diving An umbilical comprising a side-emitting optical fiber or optical fiber-bundle for providing a distributed source of light along part or the whole of the length of the umbilical.
US08475081B2	Articulating band saw and method An articulating band saw apparatus provides a frame that includes a vertically extending section having upper and lower end portions. An elevator moves between the upper and lower end portions of the frame. A first hydraulic actuator is supported on the elevator for movement therewith. A first arm provides arm end portions, the first arm supported by the first hydraulic actuator. An end of the first arm supporting a second hydraulic actuator that is spaced away from the first hydraulic actuator. The second hydraulic actuator supports a second arm. An endless band type saw is mounted on the free end of the second arm generally opposite the second actuator. The band saw is movable by articulation of the first and second actuators and resulting movement of the first and second arms. In one embodiment, the band saw is a diamond wire saw.
US08475079B2	Drainage apparatus including a support device and a wedge A drainage apparatus comprises a support device including a support segment defining a clamp path, a first clamp member and a second clamp member. At least the second clamp member is configured to be coupled to the support segment while being free to translate along the clamp path. The drainage apparatus further includes a wedge including a drive axis, a first edge and a second edge. The wedge is tapered along the drive axis between the first edge and the second edge, and the wedge is configured to be driven in a direction of the drive axis into a locked orientation of the support device.
US08475075B2	Capacitor discharge weld for connecting tubular twist beam profiles to cast trailing arm via adapter ring A suspension component for a vehicle includes a cast iron body, a high strength steel tube and an adapter ring. The adapter ring includes a protrusion engaged with a face of the cast iron body. The protrusion is heated to a plasticized state as a capacitor is discharged through the protrusion and the face. The adapter ring is welded to the body upon cooling of the adapter ring. The high strength steel tube is fixed to the adapter ring.
US08475065B2	Portable printer with asymmetrically-damped media centering A portable printer having improved ergonomic and operational characteristics. The printer includes an asymmetrically-damped media centering mechanism having first and second media support members moveable along a common longitudinal axis and configured to grasp roll media. The media support members are coupled to a reciprocal movement mechanism configured to translate a longitudinal movement of the first media support member into a corresponding opposite longitudinal movement of the second media support member. A pivoting arm is coupled to the reciprocal movement mechanism. The pivoting arm pivots to a first position when the first and second media support members are moved closer to each other, which causes a damping gear to engage the reciprocal movement mechanism, thereby damping the grasping motion of the media support members and providing an improved user experience. The printer facilitates one-handed operation, including one-handed loading and unloading of media, enabling its use in a variety of environments.
US08475064B2	Camera blade drive device A camera blade drive device includes a base plate 10 that has an aperture 10a forming an optical path, a blade member 20 that is supported by the base plate 10 and opens or closes the aperture 10a, and a driving ring 30 provided to rotate relative to the base plate 10. The camera blade drive is configured to operate the blade member 20 that is linked to the rotating driving ring 30. A permanent magnet 31 is provided on the driving ring 30 and a coil 11 rotates the driving ring 30 by magnetic force generated when the coil 11 is conducting. A magnetic member 12 holds the driving ring 30 in a predetermined position by magnetic attraction with the permanent magnet 31 when the coil 11 is non-conducting.
US08475061B2	Membrane suspended optical elements, and associated methods Membrane suspended optical elements include a structured substrate including a plurality of apertures defined therein and an array of optical elements, each of the optical elements being suspended by membrane within one of the apertures.
US08475060B2	Quick repositioner for a camera head An accessory for use on a camera crane has a first plate attachable to an end of the camera crane arm. A second plate is pivotally attached to the first plate and moveable into a first position and into a second position perpendicular to the first position. First and second latches secure the second plate into the first and second positions, respectively. The accessory allows a camera head on a camera crane arm to be quickly and easily reoriented.
US08475058B2	Optical module with ceramic package reducing optical coupling stress An optical module with an arrangement is disclosed in which the module has the LD, the TEC, and the lens with the lens carrier also mounted on the TEC. The signal light from the LD is concentrated by the lens and reflected by the mirror each assembled with the lens carrier mounted on the TEC. The TEC is mounted on the bottom metal that covers the bottom of the ceramic package, the first layer of which is widely cut to set the TEC therein. The FPC is coupled in at least two edges of the first ceramic layer left from the cut.
US08475054B2	Connector An electric connector comprises a conductive terminal and a housing. The conductive terminal is provided with a terminal body portion, a soldering portion, to which an end portion of an electric wire is soldered, and a connection portion connected to a counterpart terminal. The housing is provided with a terminal receipt-hole, in which at least a portion of the terminal body portion is received, and a soldering portion accommodation-groove, in which at least a portion of the soldering portion is accommodated. The soldering portion accommodation-groove is provided with inner side walls, that extend along lateral ends of a soldering surface of the soldering portion, and a concave portion, which is formed in the inner side walls so that a portion of solder that is used for soldering of the end portion of the electric wire is able to come into the concave portion.
US08475049B2	Fluid dynamic bearing assembly There is provided a fluid dynamic bearing assembly including: a sleeve having a shaft insertedly mounted therein; and upper and lower radial bearing parts formed on at least one of an outer circumferential surface of the shaft and an inner circumferential surface of the sleeve, wherein a clearance between the lower radial bearing part and a surface disposed to face the lower radial bearing part is wider than a clearance between the upper radial bearing part and a surface disposed to face the upper radial bearing part.
US08475046B2	Heat activated adhesives for bag closures A polymeric woven bag has a first panel and a second panel and an open end of the bag to be pinched closed. A first layer of heat activated adhesive material is on a portion of the bag to form an adhesive-to-adhesive seal by contact with a second layer of heat activated adhesive material on a portion of the bag. second panel, wherein the first adhesive layer and the second adhesive layer have respective heat activation temperatures below the softening point temperature of the polymeric bag material, and wherein sealing the bag end after the bag has been filled with contents by heat activating the first layer of adhesive material and the second layer of adhesive material at a temperature below the softening point temperature of the polymeric bag material.
US08475045B2	Bag with cover A bag includes an outer body portion or outer shell which encloses a storage compartment. The bag also includes a pocket non-removably attached to the bag which is accessible through the outer body portion or outer shell and is freely contained within the storage compartment. The pocket is configured to retain a cover, which is non-removably attached thereto. The cover is a flexible material that is water resistant or water repellant. The cover can be collapsed and stored within the pocket or can be withdrawn from the pocket and spread over the outer body portion or outer shell of the bag, thereby protecting it, for example, from inclement weather.
US08475043B2	Radiation imaging apparatus and processing method therefor A radiation imaging apparatus comprises a radiation generator configured to irradiate an object with radiation, a radiation detector configured to detect radiation transmitted through the object, a detector configured to detect movement or rotation or both of the radiation generator and the radiation detector relative to the object, and a controller configured to change the size of the irradiated region of the object based on a detection result.
US08475041B2	X-ray diagnostic apparatus An X-ray diagnostic apparatus includes imaging means including an X-ray application unit which applies X-rays to a subject and an X-ray detection unit which detects the X-rays applied from the X-ray application unit to pick up a medical image, path calculating means for obtaining a path of an imaging position for the subject on the basis of a map image, a storage unit which stores the path, imaging system moving means for movably supporting the imaging means to capture the imaging position in an imaging field and movement control means for moving the imaging system moving means to successively move the imaging position along the path.
US08475032B2	Backlight device, image display device, and method of assembling backlight device A backlight device, where expense reduction is promoted by standardizing lengths of LED boards to one type. The backlight device includes: a light guide plate; and LED boards which are arranged facing end surfaces of side surface portions of the light guide plate and on which LEDs introducing light to the light guide plate are mounted, wherein lengths of long sides of the LED boards arranged on long sides facing end surfaces in a long side direction of the light guide plate and lengths of long sides of the LED boards arranged on short sides facing end surfaces in a short side direction of the light guide plate are all the same.
US08475030B2	LED backlight for display systems An LED backlight method for display systems comprising receiving a plurality of light emitting diodes categorized into a plurality of bins, wherein each bin references a separate range of white point colors, and determining an optimal order for mounting the plurality of light emitting diodes at spatially distributed positions, the plurality of light emitting diodes comprising white point colors associated with separate bins, wherein the optimal order of the plurality of light emitting diodes produces a light of a desired white point color when the light outputs of the plurality of light emitting diodes are mixed.
US08475025B2	Light-emitting device One embodiment of the invention proposes a light-emitting device comprising a radiation source for the emission of a radiation having at least a first wavelength, and an elongated, curved light-guiding body, into which the radiation emitted by the radiation source is coupled and which couples out light at an angle with respect to its longitudinal axis on account of the coupled-in radiation having the first wavelength.
US08475022B2	Articulating reflector lighting assembly for a vehicle A vehicle lighting assembly is provided which includes a housing, first and second light sources located in the housing, and an articulating reflector. The articulating reflector is located within the housing and moves between a use position in front of the first light source to reflect light from the second light source and a retracted position. Accordingly, light assembly housing is effectively used to provide a secondary light source, such as a daylight running lamp.
US08475021B2	Vehicle lighting device According to the present invention, additional reflection surfaces 9UL, 9UR, 9DL, 9DR are provided for reflecting light L6 from semiconductor-type light sources 5U, 5D on intermediate invalid reflection surfaces 9, 9L, 9R. As a result, the present invention is capable of: reflecting the light L6 from the semiconductor-type light sources 5U, 5D on the intermediate invalid reflection surfaces 9, 9L, 9R, by means of the additional reflection surfaces 9UL, 9UR, 9DL, 9DR; illuminating the intermediate invalid reflection surfaces 9, 9L, 9R; and lessening a dark part.
US08475019B2	Hotspot cutoff D-optic The present invention is an optic used for producing a desired beam pattern having a body portion having a height and a thickness, and at least one sidewall profile, as well as an input port for receiving light from a light source. The optic of the present invention also includes an output surface formed as part of the body portion on the opposite side of the body portion in relation to the input port, at least one leg portion formed as part of the body portion, and at least one alignment feature formed as part of the at least one leg portion, the at least one alignment feature for controlling the alignment of the optic in relation to the light source.
US08475016B2	Optical device The present invention provides an optical device including: a light source; an optical element to be irradiated with light emitted from the light source; and a supporting member for supporting the optical element through a cured product of an adhesive. This cured product of the adhesive contains a thermoplastic elastic material. The present invention also provides an optical device including: a light source; an optical element to be irradiated with light emitted from the light source; and a supporting member for supporting the optical element through a cured product of an adhesive. This cured product of the adhesive has a Young's modulus of at least 1.0E+5 Pa but less than 1.0E+7 Pa in an exponential expression, in a temperature range that the cured product of the adhesive reaches due to heat generation during operation.
US08475012B2	Lamp A lamp can includes: a first reflective surface which can be provided on a surface of a circular shaped member, a radius of a top of the annular member can be longer than a radius of a bottom of the annular member; a second reflective surface which can be arranged inside of the first reflective surface and can have a conical shape, a vertex of the second reflective surface can be directed to a top side of the first reflective surface; and a plurality of light emitters which can be annularly arranged on the first reflective surface around the second reflective surface at a predetermined interval so as to be projected on the second reflective surface.
US08475008B2	Integrated sleeve and cap unit optically screens light source and intercepts light rays in a lighting unit with a reflector The invention relates to a lighting unit (1) having a concave reflector (2) with an axis of symmetry (3) and a light emission window 21) bounded by a circumferential edge (20) transverse to the axis, an elongate light source (30) extending substantially along the axis of symmetry (3), which light source (30) is accommodated in a holder (4) opposite the light emission window (21), and an axially positioned cap (5), which cap partly surrounds the light source (30) and forms an optical screening means to intercept unreflected light rays. According to the invention, the cap (5) forms part of a sleeve (60) surrounding the light source (30).
US08475007B2	Light emitting device A light emitting device comprises a light emitting element disposed within a space surrounded by a reflective surface of a reflector disposed on a board. A lower portion of the reflector is placed within a recess formed in the board, and a side wall of the recess is interposed between the lower end of the reflective surface of the reflector and the light emitting element.
US08475005B2	Backlight unit and display device including the same A backlight unit of an embodiment includes: a light emitting module including a plurality of light emitting diodes and a module substrate on which the light emitting diodes are mounted; a bottom cover accommodating the light emitting module; a board on the bottom cover; a transformer mounted on a lower portion of the board, and including a core and a coil surrounding at least one portion of the core; a transformer cover covering the transformer; and a heat dissipating cover between the transformer cover and the bottom cover.
US08475004B2	Optical sheet, light-emitting device, and method for manufacturing optical sheet A surface of a transparent substrate 5 which is adjacent to a light emitting body has a surface structure 13 that is defined by dividing the surface into a plurality of linear segments of width w which are inclined so as to extend in a specific direction in a plane of the surface and dividing the linear segments into minute regions aligned along the longitudinal direction of the linear segments such that the largest inscribed circle of the minute regions has a diameter from 0.2 μm to 1.5 μm. Each of the minute regions is formed by a raised or recessed portion formed in the surface of the transparent substrate 5. The proportion of the raised portions and the proportion of the recessed portions, P and 1−P, are determined such that P is in the range of 0.4 to 0.98.
US08475003B2	Lens body, light source unit and lighting system Substantially cylindrical supporting units are formed at both sides of a lens. The supporting units are to adjust the separation distance between the lens and the surface of a substrate depending on the height dimension of a light emitting diode mounted on the substrate from the substrate face when the lens body is fixed to the substrate. A cylindrical convex part is formed at a part of the tip face of the supporting unit in a concentric fashion relative to the supporting unit, and a cylindrical positioning unit is formed at a part of the tip face of the convex part in a concentric fashion. The positioning unit functions as a member for positioning when the substrate and the lens body are fixed to each other.
US08475002B2	Sustainable outdoor lighting system and associated methods A light fixture is described that measures the ambient light intensity and determines whether to provide illumination. The light fixture may further determine a traffic status proximate the fixture and adjust the illumination accordingly. A network of light fixtures is also provided, the light fixtures communicating data to each other and determining illumination states therefrom.
US08474998B2	Rail and clip mounting for LED modules for fluorescent application replacement In accordance with a first exemplary embodiment of the present disclosure, a mounting arrangement for use with an LED power strip module is provided. The mounting arrangement comprises one or more one frames having a first end and a second end, a first holding base configured to mate with the first end and a second holding base configured to mate with the second end, and at least one LED module having a first and second edge and comprising a plurality of LEDs, said LED module being adapted to removably attach to the one or more frames. The first and second holding bases are adapted to secure the one or more frames to an existing raceway structure.
US08474990B2	Vehicle inside mirror device employing ball clamps A vehicle inside mirror device employs a ball clamp in which a barrel-shaped ball clamp is prepared by assembling a pair of semi-barrel-shaped and symmetrical bodies to accommodate for manufacturing errors and the like. The ball clamp includes a mirror through which a driver can view rearwardly; and a mirror mounting part. The mirror mounting part has a barrel-shaped hinge part. A first ball clamp surrounds and clamps the hinge part. A second ball clamp corresponds to the first ball clamp with a spring between the first ball clamp and the second ball clamp for generating an expansion force. The mirror mounting part is fixed to a glass or a ceiling of a vehicle and has a hinge part for coupling the second ball clamp thereto. A tube surrounding the first ball clamp, the second ball clamp and the spring.
US08474987B2	Projector having light amount control based on projection system F-number A projector includes: an illuminator that emits an illumination light flux; a light control mechanism that blocks at least part of the illumination light from the illuminator; a light modulator illuminated with the illumination light from the illuminator; a projection system capable of projecting modulated light formed by the light modulator and switching the f number when the modulated light is projected; and a control unit that controls the open/close state of the light control mechanism in accordance with the f number of the projection system so that illumination light having an angular distribution corresponding to the f number of the projection system is incident on the projection system.
US08474985B2	Projector lamp lighting device supplying AC current including low frequency region having current reduction waveform A discharge lamp lighting device includes a lamp current control portion that generates, in synchronization with an input video signal, a control signal for controlling polarity reversal of an AC current with a steady-state lighting frequency and an AC current with a low frequency, and a lamp driving portion that drives the discharge lamp based on the control signal that is output by the lamp current control portion. The lamp current control portion generates a control signal for a brightness reduction waveform with timing corresponding to polarity reversal of the AC current with the steady-state lighting frequency, and the lamp driving portion inserts a current reduction waveform into the AC current with the low frequency by decreasing a voltage applied to the discharge lamp based on the control signal for the brightness reduction waveform. It is possible to reduce flicker that could be perceived due to insertion of a period without a reduction of the projection light amount (a period without a polarity reversal at the low frequency) during repeated reductions of the projection light amount occurring at intervals of polarity reversal of the steady-state lighting frequency.
US08474984B2	Projection display device A projection display device includes a light source, an optical intensity-equalizing element, an optical modulating element, an optical diffusion element, a relay optical system that is configured such that an output end of the optical intensity-equalizing element and a display element plane of the optical modulating element are optically conjugate, and a projection optical system. The relay optical system includes a first lens unit that condenses a light from the optical intensity-equalizing element and a second lens unit that further condenses a light from the first lens unit. The optical diffusion element is arranged between an light incident side of the first lens unit and the optical intensity-equalizing element. An optical axis of the second lens unit and a center of the output end of the optical intensity-equalizing element are shifted in a same direction from an optical axis of the first lens unit.
US08474976B2	Automatic accommodative spectacles using sensors and focusing elements A pair of spectacles that can automatically change its power so that a fixation region of interest (ROI) of the user is always in focus. The automatic accommodative spectacle device includes focusing elements, sensors, line of sight detector, focus engine, focusing element controller, and power supply. The line of sight detector determines the line of sight for the left and right eyes of the user using data from the sensors. The focus engine uses the lines of sight for left and right eyes to determine the user's fixation ROI. The fixation ROI is used to determine powers for the focusing elements in order to bring the fixation ROI into focus. The focusing element controller carries out the needed optical power adjustment to apply to the focusing elements. Optional light sources may be provided.
US08474974B2	Induced high order aberrations corresponding to geometrical transformations Wavefront measurements of eyes are typically taken when the pupil is in a first configuration in an evaluation context. The results can be represented by a set of basis function coefficients. Prescriptive treatments are often applied in a treatment context, which is different from the evaluation context. Hence, the patient pupil can be in a different, second configuration, during treatment. Systems and methods are provided for determining a transformed set of basis function coefficients, based on a difference between the first and second configurations, which can be used to establish the vision treatment.
US08474969B2	System and method of ink and data delivery A system (100, 500, 600, 800) of ink and multi-channel data delivery includes an optically transmissive tubular body (113) having at least two ends (105, 107). The tubular body (113) defines an ink channel between an ink supply (101) and at least one inkjet pen (117, 521, 525, 529, 901, 903). A multi-channel optical transmitter (111, 300, 400) is in optical communication with one end (105, 107) of the tubular body (113), and an optical receiver (115, 509, 511, 513) is in optical communication with another end (105, 107) of the tubular body (113).
US08474964B2	Ink, ink-jet recording method, and ink cartridge An ink containing a plurality of polymers and carbon black, wherein the plurality of polymers include a polymer A having an acid value of 200 mgKOH/g or more and 300 mgKOH/g or less and a polymer B having an acid value of 80 mgKOH/g or more and 180 mgKOH/g or less, the weight average molecular weight of the polymer A is larger than the weight average molecular weight of the polymer B, the carbon black has a DBP oil absorption of 75 mL/100 g or less and a specific surface area of 200 m2/g or more, and each of -Ph-(CH2)n—NH2 and -Ph-(CH2)n—NH—R serving as a functional group is bonded to surfaces of the carbon black particles, wherein in these formulae, Ph represents a phenylene group, n represents an integer of 0 to 2, and R represents the polymer A.
US08474963B2	Inkjet recording ink and image forming method An inkjet recording ink which includes: a carbon black; a dispersant, wherein the dispersant is a sodium naphthalenesulfonate-formalin condensate; resin emulsion; and water, in which the resin emulsion contains a resin which is at least one of a urethane resin and a styrene-acryl resin, and the ink satisfies the following relationship: 20≦B−A≦50, where A(nm) represents a particle diameter D90 of particles contained in dispersion containing the carbon black, the dispersant, and water, which is before added with the resin emulsion, and B(nm) represents a particle diameter D90 of particles contained in the ink.
US08474961B2	System and method for extracting solid-ink pellets from a container The present disclosure provides systems and methods for supplying solid-ink pellets from a container to a printing apparatus. The solid-ink pellets are held in a collapsible, hermetic bag, which is carried in the container. The bag is partially or fully transparent. A vacuum interface provides an access point to the bag. Further, a perforated nozzle, adapted to engage the vacuum interface, provides airflow within the bag and is configured to apply a suction force to extract solid-ink pellets from the bag.
US08474958B2	Ink cartridge and image forming apparatus including the same An ink cartridge includes a flexible container containing ink; and a restriction mechanism allowing the flexible container to deform only in the direction to decrease the volume of the flexible container. The ink cartridge is used for an image forming apparatus including an inkjet head for jetting ink from nozzles.
US08474952B2	Fluid ejecting apparatus and fluid ejecting method A fluid ejecting apparatus includes a nozzle row in which a plurality of nozzles that eject fluid onto a medium are arranged, a first movement unit that displaces a relative position between the medium and the nozzle row, and a control unit that forms a plurality of dot-lines by repeating a fluid ejection operation in which fluid is ejected so as to form a dot-line, such that a maximum time between when one of the adjacent dot-lines in the plurality of dot-lines is formed to when the other of the adjacent dot-lines is formed is reduced.
US08474950B2	Inkjet recording apparatus The recording apparatus includes a conveyor and a recording head which records an image to a recording medium being conveyed by the conveyor. The conveyor includes a circumferential wall, and conveys a recording medium placed on an outer circumferential surface of the circumferential wall, by rotation of the circumferential wall. The recording head includes an ejection surface where a plurality of nozzles are open, which nozzles eject at least one liquid droplet. The circumferential wall includes a tube-shaped base, and one or more detachable plates detachably attached to an external surface of the base.
US08474948B2	Fluid ejecting apparatus Provided is a fluid ejecting apparatus including a fluid ejecting head that has a nozzle row made of a plurality of nozzles and ejects fluid from the nozzle row. The fluid ejecting apparatus includes a line-shaped absorbing member that is provided to extend along the nozzle row and absorbs the fluid ejected from the nozzles at a position opposite the nozzles, and a retraction unit that retracts the absorbing member from the position opposite the nozzles by abutting on the absorbing member. The absorbing member is positioned at the position opposite the nozzles when the retraction unit does not abut on the absorbing member.
US08474945B2	Dislodging and removing bubbles from inkjet printhead A method of operating an inkjet printer including an inkjet printhead having an ink inlet, the inkjet printhead mounted on a motor-driven carriage having an encoder sensor, the method including sending a signal from the encoder sensor to a controller to indicate a position of the motor-driven carriage; determining a velocity of the motor-driven carriage; implementing a first motion control mode during a period when the inkjet printhead is printing, wherein the first motion control mode includes a first signal for damping vibrations in order to provide a substantially constant velocity of the carriage; selectively implementing a second motion control mode when the inkjet printhead is not printing, wherein the second motion control mode includes a second signal for enhancing vibrations of the carriage in order to dislodge air bubbles in the printhead; and removing air corresponding to the air bubbles from the printhead.
US08474943B2	Secure access to fluid cartridge memory An integrated fluid cartridge (100) for securing onboard memory (150, 215) includes an electrically actuated dispensing mechanism (120, 205) with a number of droplet generators which are fluidically connected to a fluid reservoir (110); a memory module (150, 215); and an electrical interface (200) containing shared select lines (250) and data lines (255) configured to control both the dispensing mechanism (120, 205) and the memory module (150, 215). A method for secure communications between a precision-dispensing device and integrated fluid cartridge (100) includes connecting the precision-dispensing device and the cartridge (100) via an electrical interface (200) containing select lines (250) and data lines (255); the cartridge (100) having several electronic components which are controlled via the select (250) and data lines (255).
US08474935B2	Image forming apparatus and recording head adjusting method An image forming apparatus includes: a recording head having plural sub-heads, the sub-heads each including plural nozzles, each of the plural nozzles within a sub-head ejecting liquid droplets at the same time with respect to a medium on which an image is drawn, and the sub-heads being arranged in a width direction of the medium; a setting unit; and a rotation unit. The setting unit uses a timing when a predetermined sub-head of the plural sub-heads ejects liquid droplets as a reference to set timings when sub-heads other than the predetermined sub-head eject liquid droplets. The rotation unit uses a predetermined axis as a spindle to rotate and position the recording head in a plane parallel to a plane of the medium.
US08474932B2	Image forming apparatus An image forming apparatus includes a head tank and a main tank that sends liquid to the head tank. When the remaining ink amount in the main tank is less than or equal to a predetermined amount (near empty), the liquid sending amount to be sent from the main tank to the head tank required for detecting a full state of the head tank is set to be a second liquid sending amount which is greater than a usual first liquid sending amount. An ink supply operation is performed to send liquid corresponding to the second liquid sending amount, from the main tank to the head tank. Then, it is determined whether the head tank is in a full state. When the head tank is not in a full state, the main tank is determined to be in an ink empty state.
US08474924B2	Rail device and server A rail device and a server are provided. The server includes a rack, at least one chassis, and a rail device. The rail device is disposed on the rack and the chassis that the chassis moves between a first position and a second position relative to the rack. The rail device includes a first rail, a second rail, a bracket, a driver, and a first latch. The first rail on the rack has an actuator, a first stopper, and a second stopper. The bracket has two ends slidably disposed at the first and the second rails individually. The driver is slidably disposed on the bracket. The first latch disposed on the chassis latches and pushes the driver forward when the chassis moves away from the first position. The first and the second stoppers then block movement of the driver and the bracket that the chassis moves to the second position.
US08474922B2	Electronic device enclosure with rotatable door An electronic device enclosure includes a cabinet, a door, a connection element, a spacing element, and a torsion spring. The cabinet includes a front panel and a standing table. The front panel defines an opening for receiving the standing table. A pair of first engagement portions extends from the standing table. The standing table defines a spacing hole. The door includes a pair of second engagement portions and a pair of third engagement portions. The connection element includes a pair of first shafts and second shafts respectively engaged with the first engagement portions and the second engagement portions. The spacing element includes a sliding portion and two arms, the sliding portion is received in the spacing hole, and a pair of third shafts extends outward from the arms and is engaged with the third engagement portions. The torsion spring is fixed between the door and the connection element.
US08474921B2	Wall-mounted patient egress and patient assist bar A support apparatus includes a patient assist bar that is coupled to a wall or to some other structure in a room of a healthcare facility, such as a headwall that is configured to be coupled to the room wall. The patient assist bar is pivotable a first axis that is substantially vertical and parallel to the headwall and a second axis that is substantially horizontal. The patient assist bar provides the patient with a stable support and guidance in moving about the room.
US08474919B2	Road milling machine with replaceable milling drum with different cutting widths Self-propelled road milling machine with a milling drum housing including a side with a power take-off to transmit rotational motion to a milling drum mounted in an axially sliding way and replaceable from the side opposite the side of the power take-off. The milling drum is rotated by a reduction gear. The reduction gear is mounted at the end of a hollow spacer. A transmission shaft is present in the hollow spacer. The hollow spacer connects the wall of the housing on the side of the power take-off to a support flange of the reduction gear, which is connected to a spacer. The spacer engages a movable flange of the reduction gear, and connects to fastening elements and the support on the wall of the housing. The support flange and the hollow spacer are static with respect to the rotary movement of the milling drum.
US08474911B2	Vehicle seat assembly and actuator system for same A vehicle seat assembly includes a seat back, a seat base, a first input lever, a second input lever, an actuator, a latching mechanism, and a system connecting the first input lever, the second input lever and the actuator. The seat base connects with the seat back and is mounted to a vehicle floor. The input levers each connect with at least one of the seat back and the seat base. The actuator connects with at least one of the seat back and the seat base. The latching mechanism is for selectively locking movement of the seat back with respect to the seat base or for selectively locking movement of the seat base with respect to the vehicle floor. The latching mechanism is operably connected with the actuator such that movement of the actuator results in movement of the latching mechanism. The first input lever, the second input lever, and the actuator are connected in series along the system.
US08474910B2	Vehicle seat, in particular motor vehicle seat A vehicle seat includes a base (9) which includes at least one front foot (11). A seat (3) is connected in an articulated manner to the front foot by at least one front leg (13). At least one rear foot (21) is locked to the base (9) in at least one use position. At least one coupling (42) is provided between the seat and the rear foot. At least one coupler (30) is provided between the backrest and the coupling or the seat. The seat may be transferred from the use position into a boarding position as, after unlocking the rear foot, the seat pivots upwards and the backrest carries out a forward shifting movement by means of the rear foot. The seat may also be transferred from the use position into a flat-floor position, by the backrest pivoting forward and the seat being lowered by the coupler.
US08474909B2	Power lift lumbar support system A power lift lumbar support system for a furniture member includes a lumbar pad. A scissoring portion is rotatably connected to the lumbar pad and moves the lumbar pad between a fully retracted and a fully extended position. A lumbar actuation portion is connected to the scissoring portion and drives the scissoring portion using a powered actuator to displace the lumbar pad. A carrier support rod has first and second carriers slidably disposed on the carrier support rod. The scissoring portion is connected to each of the first and second carriers. Displacement of the first and second carriers toward each other operates through the scissoring portion to displace the lumbar pad away from the carrier support rod and toward the fully extended position.
US08474904B2	Passenger compartment material structure To inhibit the attractiveness of a ceiling material from deteriorating. According to a passenger compartment material structure (10), on a ceiling material (12), there is disposed a water guide portion (34) that guides water (W) flowing on a surface (32A) of an air barrier film (32) on a passenger compartment outer side toward a pillar garnish (14) to the pillar garnish (14). Consequently, even in a case where the water (W) has flowed on the surface 32A of the air barrier film 32 on the passenger compartment outer side toward the pillar garnish 14, this water guide portion (34) guides the water (W) to the pillar garnish 14, so the water (W) can be inhibited from reaching an end (28A) of an upholstery material (28) on the pillar garnish (14) side. Because of this, the water (W) can be inhibited from seeping out to a passenger compartment inner side of the upholstery material (28), so the attractiveness of the ceiling material (12) can be inhibited from deteriorating.
US08474902B2	Transverse-member module for a motor-vehicle The present invention relates to a transverse-member motor-vehicle module for receiving the instrument panel and reinforcing the bodywork for the direct connection of the two A-pillars of a motor vehicle, composed of a transverse member with a steering-column retainer, where the transverse-member module, i.e. not only the transverse member but also the steering-column retainer, are manufactured using a metal-plastic-composite design (hybrid technology), and these are composed of at least one main body and of at least one first thermoplastic part and one second thermoplastic part, where these have been securely bonded via injection molding firstly to the main body and simultaneously the various plastics parts have been bonded to one another, where the two plastics parts are composed of different plastics materials and these are injected in the bi-injection molding process, where they fuse with one another when they encounter one another.
US08474900B2	Motor vehicle front transverse beam comprising a rear fairing element This beam (4) is intended to be located between a shield skin (2) and a front end (6) of a motor vehicle front assembly (1), said beam (4) being designed to deform by absorbing energy in the event of an impact with the shield skin (2), said beam (4) having an approximately planar front face (8). The beam (4) comprises a rear fairing element (10) having a concavity (16) facing the front of the vehicle so as to promote a laminar flow of air from the front face (8) of the beam (4) toward the front end (6) of the front assembly (1) of the motor vehicle.
US08474898B1	Vehicle floor mat A floor mat is positionable in front of a vehicle seat on a vehicle floor of a vehicle having at least one structural member that contacts the vehicle floor and is disposed rearward of a front edge of the vehicle seat. The floor mat includes a main body and an engagement structure. The main body has an upper surface, a lower surface, a first end, and a second end that is longitudinally spaced from the first end. The engagement structure is defined at a peripheral edge of the main body between the upper and lower surfaces. The engagement structure has a first edge portion that extends in a longitudinal direction and a second edge portion that laterally extends from the first edge portion. The second edge portion is positionable to engage the at least one structural member to restrain horizontal movement of the main body in the longitudinal direction.
US08474895B2	Inner rack structure for saddle-ride type vehicle An inner rack structure for a saddle-ride type vehicle which can easily form an inner rack with a distinctive outward appearance. An inner rack opening that opens upwardly is provided in an upper cover, and an inner rack body portion formed to bulge in a forward direction is provided in the upper portion of a lower cover. The inner rack opening is covered from below and the front by the inner rack body portion, and the inner rack body portion is covered from a rear direction by a lower-side rear wall portion that extends downwardly from the inner rack opening of the upper cover, thereby forming an inner rack serving as a storage portion.
US08474894B2	Movable bulkhead system to increase load capacity of a vehicle A moveable bulkhead 10, 110 for a motor vehicle such as a van 1 is disclosed comprising of a number of panels 11, 12, 13; 111, 112, and 113 hingedly connected together to permit the bulkhead 10 to be moved or transformed between forward and rear positions by rotation of the panels 11, 12, 13; 111, 112, and 113. The bulkhead 10 is “U”-shaped defining a concavity that faces forward when the bulkhead 10 is latched in the forward position and rearwardly when the bulkhead 10 is latched in the rear position so as to maximize the cargo carrying capacity of the van 1.
US08474893B2	Grasping apparatus A grasping apparatus includes a base unit, left and right parallel links, and a driving unit that is housed in the base unit and drives the first link of the right parallel link and the first link of the left parallel link in the open/close direction. Each of the left and right parallel links has a first link attached pivotably in an open/close direction about a base shaft of the base unit, a second link attached pivotably in the open/close direction about an auxiliary shaft located on an outer side in the open/close direction, a finger unit supported pivotably at an end of the first link and an end of the second link, and a claw projecting toward the inner side in the open/close direction and disposed along an end face of the grasping surface of the finger unit of each of the left and right parallel links.
US08474889B2	Device for actuating a lock integrated in a door, hatch, or similar, especially in a vehicle A device for actuating a lock mounted in a door includes a handle with a bearing extension at one end, which can be installed from the exterior of the door in a bracket mounted in the interior of the door. A two-part electrical control unit has one control unit located in the handle and a second control unit in the vehicle. Electrical wiring with two sections, which are connected to each other by an electrical coupling part and a mating coupling part, extends between the two parts of the control unit. A receptacle for the electrical coupling part is provided in the bearing extension of the handle. The mating coupling part at the end of one section of wiring projects out through the opening in the exterior panel of the door and is fitted into the coupling part of the handle before the handle is installed. When the handle is to be installed, a common structural unit is available, composed of the handle, the coupling part, and the mating coupling part. When the handle is actuated as intended after installation, its pivot axis serves simultaneously as the axis of rotation for the coupling part and the mating coupling part, which are connected to each other.
US08474887B2	Door opening and closing apparatus for vehicle A door opening and closing apparatus for a vehicle includes a displacement body operating a latch and being displaced within a moving region including a closing region, a releasing region and a neutral region positioned between the closing region and the releasing region, the displacement body displacing by an actuator, a control unit controlling the actuator for selectively engaging and disengaging the latch and a striker, a first detection portion outputting a first detection signal changed when the displacement body passes through a first border portion of the neutral region closer to the closing region, and a second detection portion outputting a second detection signal changed when the displacement body passes through a second border portion of the neutral region closer to the releasing region. The control unit controls a moving position of the displacement body based on the first detection signal and the second detection signal.
US08474886B2	Vehicle door latch The object of the present invention is a vehicle door latch, whose basic version contains a locking mechanism (1, 2) with at least one operating lever (3) for the locking mechanism (1, 2) and a motor drive (4, 5, 6, 7) for opening the locking mechanism (1, 2). According to the invention, the motor drive (4, 5, 6, 7) directly acts upon the locking mechanism (1, 2) solely via the operating lever (3).
US08474884B2	Door lock A door lock with a bolt, wherein the bolt pieces of the dual-action bolt are prevented from turning away from each other as the bolt pieces have two projections (24, 26) arranged to cooperate with the inner surface (30) of the front plate. In relation to the support of the bolt piece on the shaft (29), one of the projections (26) is arranged on the opposite side in the axial direction compared to the other away-facing projection.
US08474883B2	Latching mechanism A latching system for and a method of latching a first member to a second member are provided. The latching system includes a latching mechanism including a displaceable feature which, when operatively displaced, allows a striker to engage with a housing of the latching mechanism, at a recess defined by the housing, to provide supplementary or auxiliary latching force. The displaceable feature may be displaced by an actuating load transmitted between the striker and the latching mechanism, where the actuating load is substantially greater than the nominal load experienced by the latching system during ordinary latching conditions. The engagement of the striker with the housing at the recess may transfer a portion of the actuating load to the housing during the event generating the actuating load, thereby increasing the latching strength of the latching system and reducing the potential for deformation or distortion of the latching element during the event.
US08474881B2	Sheet metal corner for duct flanges A corner flange connection member for joining flanges of duct sections, includes two leg portions joined together in an angular relationship by a corner portion, the connection member being substantially flat and including at least one opening for receiving a fastening member having a threaded portion, the threaded portion having a root diameter, the opening being defined by two joined and offset partially rounded openings, at least one of the offset partially rounded openings having a sectional extent between opposite sides thereof about equal to the root diameter of the threaded portion of the fastening member, the offset being about equal to a thread height of threads of the threaded portion of the fastening member, and the sides of the offset openings being joined generally tangentially. The opening or openings can be located in the corner portion or one or both of the leg portions.
US08474879B2	Non threaded drill pipe connection A threadless connection for coupling segments of pipe longitudinally end to end includes a pin end having a groove for receiving therein a locking ring. A box end has a groove for receiving the locking ring therein when the pin end is inserted into the box end. The locking ring has an uncompressed diameter selected to exert lateral force on the groove in the box end when assembled to the pin end.
US08474878B2	Securing device of a fluid line connection A securing device for axially connecting a sleeve-shaped end section of a first fluid line part to an end section, which is designed as a pointed end, of a second fluid line part includes a clamping body which is of annular design and has a passage opening for insertion of the second fluid line part, at least one retaining element of a hook-shaped design, and at least one spacer of web-shaped design, wherein the at least one retaining element and the at least one spacer are both integrally formed with the clamping body and extend in the same axial direction.
US08474875B2	Repeater for wired pipe A wired drill pipe electronic device includes a housing having a threaded connection at each end configured to couple to a wired drill pipe having double shoulder threaded connections. A chassis is disposed inside the housing and is configured to define at least one sealed atmospheric chamber between the chassis and the housing. The chassis defines an internal passage therethrough. The device includes a stress coupling to enable transmission of at least one of axial and torque loading from both the inner and outer shoulder of adjacent wired drill pipe segments through the housing.
US08474874B2	Layered image display sheet A moiré pattern display sheet is defined by a surface, with the surface being configured to be curved. A first layer has a pattern printed thereon. The pattern comprises a series of visual elements in a first row that have been distorted at least in a first direction. At least some of the series of visual elements are printed to approximately follow an arc having a sweep angle associated therewith. A light steering optical layer overlays the first layer. The light steering optical layer comprises a plurality of parallel optical features which each have a width and which change the direction of the light and thereby provide a depth effect of the visual elements to a viewer looking through the light steering optical layer.
US08474872B2	Passive safety device There is provided a passive safety device which can prevent an occupant from moving when an acceleration that causes the occupant to move in a vehicle is working on the occupant, and which can improve the ride comfort. A passive safety device of the present invention comprises an acceleration detecting unit that detects an acceleration of a vehicle, a seat adjusting unit that expands a seat side of a seat in order to prevent an occupant sitting down the seat from moving, a safety belt adjusting unit that controls tension of a safety belt worn by the occupant, and a control unit that controls an expansion of the seat side and/or the tension of the safety belt through the seat adjusting unit and the safety belt adjusting unit, based on the detected acceleration of the vehicle.
US08474871B1	Vehicle frame A frame for recreational vehicles having a pair of oppositely spaced longitudinal frame members, having notches completely therethrough. The longitudinal frame members have a foam core in direct contact with a woven fiber fabric on an exterior of the longitudinal frame members with fabric flaps extending therefrom. The frame has a plurality of transverse stringers having a foam core in direct contact with a woven fiber fabric on an exterior of stringers that rest in notches of the longitudinal members. The stringers are complementary to the notches in the longitudinal members and the stringers have fabric flaps that extend along their length on opposite sides. The stringers extend completely through the longitudinal frame members. The flaps on the longitudinal frame members and the stringers are in overlapping contact. A deck having a layer of fabric covers the stringers, the flaps, and the longitudinal frame members and is impregnated with resin.
US08474870B1	Vehicle frame assembly A vehicle frame assembly includes a first frame member and a separate second frame member having an end portion connected to an end portion of the first frame member. A frame patch is interposed between and connected to the respective end portions of the first and second frame members. The frame patch together with the respective end portions of the first and second frame members defines a tri-layer patch configured to divide an input load applied longitudinally to the vehicle frame assembly into multiple force vectors which distribute the input load across a wide area of the vehicle frame assembly.
US08474869B2	Steering column for a motor vehicle A steering column for a motor vehicle includes a casing unit, which rotatably supports a steering shaft about the longitudinal axis thereof, and a retaining part. The casing unit is held in a fixed manner relative to said retaining part up to a threshold value of a force acting on the casing unit in a parallel manner to the longitudinal axis of the steering shaft in the direction of the front of the vehicle. When the threshold value is exceeded, the casing unit is movably held in a parallel manner to the longitudinal axis in the direction of the front of the vehicle. The casing unit is connected to the retaining part via an energy-absorbing connection, which a bending wire or strip that is deformed when the casing unit is moved relative to the retaining part parallel to the longitudinal axis in the direction of the front of the vehicle, and via a breakaway connection closed up to a threshold value of the force and blocks a movement of the casing unit relative to the retaining part and which opens when the threshold value of the force is exceeded.
US08474867B2	Steering wheel unit A steering wheel unit with an airbag module and a steering wheel body is connectable to a steering column defining the axial direction. The steering wheel body includes an accommodation for the airbag module in the hub area. The airbag module can be pressed down against the steering wheel body against the force of at least one spring and at least two positioning units act between the airbag module and the steering wheel body. The positioning units are arranged in a center of gravity plane being perpendicular to the axial direction. In order to provide an easy mountability and a high degree of flexibility in respect of the installation space, the positioning units act at least in non-axial direction and the at least one spring is spaced from the positioning units.
US08474866B1	Airbag with zones of less elastic material An airbag is provided that includes one or more rigid regions within a restraint zone that has an elasticity lower than neighboring regions of the airbag. The rigid regions serve to contact the head of an occupant and provide directional support and guidance for the position of an airbag upon deployment or contact with an occupant.
US08474863B2	Side airbag system, backrest and headrest A side airbag system is provided with a side airbag for protecting the upper thorax and head area of a vehicle passenger between a lateral vehicle structure and the vehicle passenger, and with a gas generator that is fluidically connected with the side airbag. The side airbag is planar in the deployed condition, and protectively covers a path of motion for the head, along with various seated positions for small and large vehicle passengers. In order to realize an expanded protective potential for the head in semi-convertibles and compact cars, the side airbag, viewed from the lateral vehicle structure, has an outer contour with an essentially continuous bead.
US08474861B1	Interior panels having integrated airbag deployment doors for motor vehicles and methods for making the same Interior panels having integrated airbag deployment doors for motor vehicles, and methods for making such interior panels are provided herein. In one example, an interior panel comprises a substrate that comprises a first PP/TPO material. An airbag chute-door assembly comprises a chute portion that has a chute wall. The chute wall at least partially surrounds an interior space that is sized to permit passage of an airbag during deployment. A first door flap portion is disposed adjacent to the interior space. The first door flap portion comprises a first door flap section and at least one first weld feature. The at least one first weld feature comprises a second PP/TPO material and attaches the first door flap section to the substrate. A first hinge pivotally connects the first door flap section to the chute portion. The first hinge comprises a TPE material.
US08474859B2	Airbag arrangement for vehicle occupant restraint system An airbag arrangement for a vehicle occupant restraint system is provided. The airbag arrangement comprising airbag inflatable for protecting a vehicle occupant, a gas generator for inflating the airbag, a gas generator carrier at which the gas generator is arranged, a housing part which—with regard to the state of the airbag arrangement installed in the vehicle—covers the airbag towards the vehicle interior. The housing part comprises at least one latching element and the gas generator carrier comprises at least one latching opening assigned to the latching element. The housing part can be connected to the gas generator carrier by inserting the latching element into the latching opening along an insertion direction up to a latching position. The latching element reaches behind a blocking element adjacent the latching opening and connected to the gas generator carrier such that pulling the latching element out of the latching opening is counteracted.
US08474857B2	Airbag device for saddle-ride type vehicle An airbag device for a saddle-ride type vehicle can include an acceleration sensor for detecting impacts working on a body to actuate the airbag, a left-right pair of acceleration sensors in side frame members.
US08474845B2	Wheel suspension The invention relates to a wheel suspension having a shock absorber (1) with a piston rod (2) and a spring element (7), the spring element (7) being mounted between a lower spring retaining plate (4) and an upper spring retaining plate (6) and the head of the shock absorber (1) being fastened to a vehicle body (8). An intermediate element system (9, 11, 12; 9, 26) is arranged and embodied between the upper spring retaining plate (6) and the vehicle body (8) in such a manner that a compensating moment (23) is generated during final installation of the shock absorber (1) on the vehicle body (8).
US08474840B2	Collapsible skateboard A collapsible skateboard includes an upright handle having lower portion on which is fixedly mounted a bracket, a connector having a curved slot having a lower end formed with a horizontal recess, an upper end formed with a vertical recess, and a circular hole under the vertical recess, an adjust pin inserted into the vertical recess of the connector and the elongated hole of the bracket, a pivot pin fitted through the circular hole of the connector and the circular hole of the bracket, a spring having an upper end connected to the adjust pin and a lower end to the pivot pin, and a platform on which is fixedly mounted the connector, whereby the skateboard can be easily folded up as desired.
US08474834B2	Voter terminal storage and transport cart A voter cart capable of supporting a voting terminal in a portable, fully usable, and secure configuration. The cart is generally formed with a pair of opposing side rails joined together in a spaced-apart configuration and mounted on casters, and a voting terminal housing interspaced between the side rails. The voting terminal is seated atop a bottom shelf of the voting terminal housing at waist-level for easy wheelchair voter access thereto. The voting terminal is restrained against lateral and vertical motion, and yet there is full access to the voting terminal's control panels, doors, etc. Moreover, the particular design maximizes strength and usability, and yet keeps weight to a minimum with a framework that is as light weight as possible.
US08474831B2	Axially adjustable tool holder An axially adjustable tool holder, having a principal body (1)with attachment, in a recess (2) of which is slidably mounted a mobile part (3) for mounting a tool (4). The mobile part (3) cooperates with a ring for transverse adjustment (5), mounted in rotation on the extremity of the principal body (1)with the recess (2) and secured transversely to said extremity, by a ball bearing device (8), in the form of a sleeve with an interior thread (5′). The ball bearing device (8) presenting axial play of the ring for transverse adjustment (5), when the mobile part (3) is tightened, application of the proximal face (51) of the adjustment ring (5)against a corresponding distal external supporting flange (1′) of the principal body (1). The mobile part (3) being locked in working position, after adjustment, by a device for tightening (6) by traction cooperating with a part (7) of the mobile part (3).
US08474830B2	Gasket A gasket is provided that forms a sealing connection between a pair of tubular members. The gasket comprises a first section shaped to fit within a recess of one of a pair of tubular members. The first section includes an anchor portion comprising first and second sides. The gasket further comprises a second section extending from the first section and is configured to make a sealing contact with the other of the tubular members. The gasket also includes at least one self-locating arm in a sealing contact within the recess and extending from one of the first or second sides of the anchor portion of the first section. The self-locating arm biases the first section such that the other of the first or second sides is in contact with the recess to form a sealing connection.
US08474829B2	Sealing device To prevent breakage of a sealing device having a main sealing body installed within an annular installing groove (31) formed in one member (3) to slidably and concentrically contact with the other member (2) and a backup ring (12) arranged at a non-sealing space side of said main sealing body, a height (h1±Δh1) of said backup ring (12) in a facing direction of a bottom surface (31a) of said installing groove (31) to the other member (2) is greater than a facing distance (L±ΔL) between the bottom surface (31a) and the other member (2), and said backup ring (12) has a cross-sectional shape which is symmetrical in a thickness direction thereof, and has an easily compressible part (12a) which can be compressed to the extent of the difference (x) between said height (h1±Δh1) and said facing distance (L±ΔL).
US08474825B2	Sealing device To improve sealing performance, a sealing device comprises an oil seal (10) mounted to a non-rotating housing (2), and a dust cover (20) mounted to a rotating body (5) outside the oil seal (10), one of the oil seal (10) and the dust cover (20) facing each other has an external seal lip (24) slidably in close contact with the other of them (10, 20) outside the slide sections (S1, S2) between the oil seal (10) and the rotating body (5), the oil seal (10) and the dust cover (20) have non-contact lips (16, 25) which are positioned outside the slide sections (S1, S2) and inside the external seal lip (24), have substantially conical tubular shapes becoming larger in diameter toward the tips thereof, and are loosely inserted to each other, and a labyrinth seal (30) is provided at the outer diameter side of the external seal lip (24).
US08474824B2	Pressure sensing module having an integrated seal plate and method of assembling pressure sensing module A method of assembling a pressure sensing module includes affixing a pressure sensor unit to an alignment tool and indexing the alignment tool to a circuit board. After the pressure sensor unit is attached to the circuit board, a seal plate is indexed thereto. A locator feature indexes receptacle elements on the circuit board, alignment tool, and seal plate. An integrated seal module includes a mounting plate having first and second opposing faces, and at least one locator hole and one or more pressure passages extending therethrough. A unitary seal member effects a fluid seal between the pressure ports and the first face and the pressure sources and the second face. A seal member and locator bushings may be formed as a single, continuous liquid injection molded framework, including portions encased by the mounting plate. Pressure passages provide fluid to pressure sensors, which may be overmolded in the mounting plate.
US08474822B2	Craps blackjack A modified blackjack card game using an electronic gaming machine and 6 or 8 decks of standard playing cards without jokers, Craps Blackjack is playing in electronic device, computer, slot machine, video game, etc. and using two steps wagering strategies, win or lose at two initial cards and continue to play or fold the hand and providing six side bets. It is a card game combined the playing method of craps, poker and blackjack. It provides optional side bets, dragon's head and phoenix's tail, ace-deuce, ace-ace, any eleven, any seven, and six-six and two main bets, Craps Blackjack and Any Craps.
US08474820B2	Customizable display of roulette betting layout A roulette table allows players to make customized betting selections and customize the layout of the betting options that appear on the player station of the roulette table. In particularly contemplated embodiments, players may add, delete, or modify the appearance of betting options through a user interface so that the players may more readily indicate desired wagers. This functionality may not only speed up game play, but also make the betting layout more intuitive for each user resulting in increased attendance of roulette games.
US08474818B2	Nip release system Methods and system for reducing sheet skew in a sheet transport system are disclosed. A sheet transport system may include an idler wheel, a drive wheel a drive motor and an actuator. The idler wheel may have a substantially rigid outer layer. The drive wheel may have a compliant outer layer and may correspond to the idler wheel. The drive motor may be operably connected to the drive wheel and may be configured to cause the drive wheel to rotate around a shaft. The actuator may be operably connected to the drive wheel and configured to cause the drive wheel to move between a closed position and an open position. The drive wheel is configured to contact a sheet in the closed position and to not contact a sheet in the open position.
US08474815B2	Transport device, image forming device, transport method, and recording medium In a transport device, a first speed control unit controls a rotating speed of a first roller driving unit to reach a first target speed, and a second speed control unit controls a rotating speed of a second roller driving unit to reach a second target speed. The second speed control unit is arranged to perform, when a print medium is transported by both a first transport roller unit and a second transport roller unit, a follower control having a response sensibility to speed fluctuations in a predetermined frequency region of a control system, which is smaller than a response sensibility when the print medium is transported by the second transport roller unit solely.
US08474811B2	Sheet feeding device and image forming apparatus incorporating same A sheet feeding device includes a sheet carrying unit, an attraction separation device electrostatically attracting and separating an uppermost sheet from a sheet stack and including multiple rollers, an endless dielectric belt stretched over the multiple rollers, and an elastic member provided inside a loop of the belt to cause the endless dielectric belt to contact the uppermost sheet, a sheet conveying device, and a lifting and lowering device. The lifting and lowering device lifts the sheet stack to a lift position at which the uppermost sheet contacts with the attraction separation device, and the attraction separation device stands by for a predetermined time to attract the uppermost sheet and starts to convey the uppermost sheet after the predetermined time elapses in a state in which the sheet stack remains at the lift position.
US08474810B2	Reflective photosensor and image forming device incorporating the same A reflective photosensor detects a target object. The photosensor includes a transparent circuit board, a light emitter and a light receiver on one surface of the circuit board, including a light emitting element and a light receiving element, respectively, and disposed so that the light emitting element and the light receiving element face the one surface, a concave portion on the other surface of the circuit board, including a first refractive face to oppose the light emitting element and refract light from the light emitting element to the light receiving element and a second refractive face to oppose the light receiving element and refract, to the light receiver, a component of the light refracted by the first refractive face and specularly reflected by the target object.
US08474809B2	Image recording apparatus An image recording apparatus according to one aspect comprises: a first tray disposed within an opening of a main body to allow a recording medium to be placed thereon; a second tray disposed above the first tray, the second tray having a second end portion located on a side of the opening; a conveying unit; and a recording unit. The second tray is movable between a first posture and a second posture. When the second tray is in the first posture, a top surface of the second tray in the vicinity of the second end portion is positioned at a predetermined height relative to the first tray. When the second tray moves from the first posture to the second posture, the top surface in the vicinity of the second end portion is moved toward the first tray.
US08474805B2	Microalloyed spring The systems and methods described herein include innerspring assemblies or innerspring cores for use with cushioning articles such as mattresses. The innerspring core may have one or more coil springs formed from a high-carbon steel wire alloyed with one or more suitable alloying elements such as titanium and copper and capable of imparting greater strength and durability to the innerspring core.

1 2 3 4 5 6 7 8 9 10