Document | Document Title |
---|---|
US11707779B2 |
Method and casting core for forming a landing for welding a baffle inserted in an airfoil
A method and casting core for forming a landing for welding a baffle inserted into an airfoil are disclosed, wherein the baffle landing of the blade or vane is formed in investment casting by the casting core rather than by wax, reducing tolerances and variability in the location of the baffle inserted into the cooling cavity of airfoil when the baffle is welded to the baffle landing. |
US11707772B2 |
High flow differential cleaning system
A high flow differential cleaning system uses a source of pressurized compressed dry gas to pressurize a holding tank. A component to be cleaned is securely loaded and oriented against a blast plate designed specifically for the desired pressure, flow, and volume. A fast-actuated valve system opens to direct high volumes of pressurized gas from a holding tank through and around the component(s) held within the cleaning chamber for the removal of remnant powder and foreign particles from interior cavities as well as exterior component surfaces. |
US11707770B2 |
Pressure control strategies to provide uniform treatment streams in the manufacture of microelectronic devices
The present invention provides techniques to more accurately control the process performance of treatments in which microelectronic substrates are treated by pressurized fluids that are sprayed onto the substrates in a vacuum process chamber control strategies are used that adjust mass flow rate responsive to pressure readings in order to hold the pressure of a pressurized feed constant. In these embodiments, the mass flow rate will tend to vary in order to maintain pressure uniformity. |
US11707768B2 |
Systems and methods for peanut sorting and grading
Various examples of a system for peanut sorting and grading are disclosed herein. The system for grading peanut maturity, can include: a sample feeder configured to supply individual peanuts to an imaging area; a sorting board comprising a plurality of chutes and a plurality of gates, each chute of the plurality of chutes designated for a grade of peanut; and program instructions to obtain the digital image of the individual peanut; determine the grade of the individual peanut; and sort the individual peanut based on the grade of the individual peanut. A method for grading peanut maturity, can include feeding an individual peanut to an imaging area; obtaining a digital image of the individual peanut; determining a grade of the individual peanut based on an average color; and sorting the individual peanut in a chute of a sorting board based on the grade of the individual peanut. |
US11707763B2 |
Apparatus and methods using coatings for metal applications
An apparatus and methods for using coatings for metal applications are disclosed. According to one embodiment, an article comprises a cured polymeric film having a first reaction product of a cationic photoinitiator and a compound suitable for cationic polymerization. The article has a second reaction product of a free-radical photoinitiator and a compound suitable for free-radical polymerization; The article has a metal substrate, wherein the cured polymeric film coats the metal substrate. |
US11707759B2 |
Coating head, coating apparatus, and coating method
According to one embodiment, a coating head includes a coating bar, nozzles, a first member, second members, third members, elastic members, and a position controller. The coating bar faces a coating member. The nozzles supply a liquid toward the coating bar. The first member includes first recesses. A portion of the nozzles is between the first recesses and the third members. The portion of the nozzles and the third members are fixed to the first member by the second members. The elastic members are located in at least first, second, or third positions. The first position is between the third members and the second members. The second position is between the portion of the first recesses and the nozzles. The third position is between the portion of the nozzles and the third members. The position controller controls a relative position between the coating bar and the nozzles. |
US11707753B2 |
Handheld fluid sprayer
A handheld fluid sprayer is configured to draw spray fluid from a reservoir mounted on the fluid sprayer and eject the spray fluid through a nozzle. The reservoir is removably mounted to the fluid sprayer. A priming pathway extends through the fluid sprayer and routes air out of the reservoir to prime the pump. The priming pathway extends from the reservoir and to a side of the pump opposite the reservoir. |
US11707749B2 |
Centrifuge including rotatable bowl and conical separation discs arranged in the bowl
A disc-type centrifuge is configured to use clean water as sealing water to be supplied at high pressure to a sealing mechanism unit. A pump is disposed on a circulation pathway connecting a sealing water tank, in which the sealing water is stored, and the sealing mechanism unit. The sealing water (clean water) is circulated between the sealing water tank and the sealing mechanism unit by the pump. The pump is connected to the drive shaft of a motor that supplies a driving force to a rotating shaft and bowl and is configured so that the pump is operated by receiving the driving force of the motor. |
US11707744B2 |
Cooled motor for a paper shredder
A paper shredder motor cooling assembly having a paper shredder motor coupled to a fan shaft, an enclosure surrounding the paper shredder motor and having selected input and selected output vents to control airflow to the paper shredder motor, a fan coupled to the fan shaft, communicating with the selected input vents or the selected output vents; when the paper shredder motor is operating, the rotor shaft turns the fan to generate a differential air pressure between the selected input vents and the selected output vents, removing heat from the motor. A duty cycle of greater than 50% is obtained. The fan can be coupled to the motor by speed increasing gearing, attached to the cutter blade assembly, such that the fan turns faster than the motor. The fan also can be attached to the motor shaft. An input fan and an output fan can be used. |
US11707742B2 |
Refiner disc and hub assembly
An assembly comprising an annular hub with a hub inner surface and a hub outer surface and a rotary third refining member having a central opening within a refining member inner surface. The refining member has at least two equally spaced apart member portions extending radially inwardly from the member inner surface, and the assembly includes a key for connecting the member portions to the hub. The assembly also include an annular cover plate with at least two radially extending spaced apart flanges, each flange overlying a member portion, and at least two spaced apart port plates, each port plate overlying a member portion side opposite the annular cover plate, the spaces between the at least two port plates defining ports from a first stock flow path to a second stock flow path. |
US11707739B2 |
Continuous microfluidic dilatometry for physical activity monitoring with ultrahigh sensitivity
Continuous microfluidic dilatometry devices and methods are provided for activity monitoring with ultra-high sensitivity. Corner flow in capillary channels is used to detect the resistance change in microfluidic circuits filled with ionic liquids. The conversion of mechanical input (e.g. strain) to an intermediary domain, namely liquid displacement, allows a large enhancement in sensor performance. Embodiments are suitable for tracking skin deformations that occur as a result of human movements. |
US11707735B2 |
Multi-metallic bulk hydroprocessing catalysts
Multi-metallic bulk catalysts and methods for synthesizing the same are provided. The multi-metallic bulk catalysts contain nickel, molybdenum tungsten, yttrium, and optionally, copper, titanium and/or niobium. The catalysts are useful for hydroprocessing, particularly hydrodesulfurization and hydrodenitrogenation, of hydrocarbon feedstocks. |
US11707734B2 |
Method for making a photocatalyst nanocomposite
An efficient photocatalyst nanocomposite comprising reduced graphene oxide, noble metal, and a metal oxide prepared by a one-step method that utilizes date seed extract as a reducing and nanoparticle determining size agent. The photocatalyst of the invention is a more effective sunlight photocatalyst than that prepared by traditional method in the photo decomposition of organic compounds in contaminated water. |
US11707728B2 |
Carbon-based compositions with highly efficient volumetric gas sorption
The present application is generally directed to gas storage materials such as activated carbon comprising enhanced gas adsorption properties. The gas storage materials find utility in any number of gas storage applications. Methods for making the gas storage materials are also disclosed. |
US11707726B2 |
Nitric oxide containing composite
The present invention provides a nitric-oxide containing composite in the form of microparticles, wherein said microparticles comprise: (i) a core which comprises silica; (ii) a layer on said core which comprises a metal-organic framework; and (iii) nitric oxide; wherein said metal-organic framework comprises organic ligands comprising at least one amine group, said metal-organic framework is uniformly distributed on the surface of said silica core and said nitric oxide is chemisorbed within said metal-organic framework. |
US11707716B2 |
Connection structure and membrane filtration device
A membrane element having a filtration main body, a header (a water collection portion) that collects treated water from an end portion of the filtration main body and a treated water lead-out portion that leads out the treated water is used. The treated water lead-out portion is connected to a tubular peripheral wall of a water collection pipe that collects treated water solid-liquid-separated by the membrane element, and communicates with an inside of the tubular peripheral wall. The tubular peripheral wall has a thick portion that is thicker in a horizontal direction at an upper-side peripheral wall portion located at an upper side (or at a lower-side peripheral wall portion located at a lower side) in the radial direction of the tubular peripheral wall, and a connecting hole that penetrates the thick portion. |
US11707715B2 |
Reverse osmosis system
A reverse osmosis system includes a membrane unit, an energy recovery device, high and low pressure inlet lines, and a concentrate line. The membrane unit has a membrane, an inlet for receiving a feed fluid, a permeate outlet for discharging a permeate fluid and a concentrate outlet for discharging a concentrate fluid. The energy recovering device has a turbine portion, a turbine inlet and a turbine outlet, a pump portion, a pump inlet and a pump outlet, a motor, and a motor control unit for controlling the motor. The low pressure inlet line is connected to the pump inlet for supplying the feed fluid at a low pressure. The high pressure inlet line connects the pump outlet with the inlet for supplying the feed fluid at a high pressure. The concentrate line connects the concentrate outlet with the turbine inlet for supplying the concentrate fluid to the turbine portion. |
US11707714B1 |
Reactive byproduct treatment in gas generators
The disclosure provides devices, methods, and systems for treating reactive metals and other reactive species produced during operation of thermal solid-state gas generators. Thermal energy, which may be derived from the gas generation process, physical contact with the evolved gases, or a dedicated or shared heat source, is used to release a gaseous species that neutralizes the reactive species. In some embodiments, the neutralization reaction causes the release of additional product gas(es). |
US11707713B2 |
Information management system, carbon dioxide collection station, and information management device
An information management system includes: a plurality of CO2 recovery devices configured to recover CO2; a CO2 collection station configured to collect CO2 recovered by the plurality of CO2 recovery devices; a CO2 using facility configured to use CO2 collected at the CO2 collection station; and an information management device including a communication unit configured to transmit linked information in which intended use information indicating intended use of CO2 in the CO2 using facility and an amount of use for the intended use is linked with identification information of a user of each of the plurality of CO2 recovery devices to an information communication terminal used by the user. |
US11707711B2 |
Device for drying a gas, in particular air
A drying device for processing a gas to be dried, in particular air, comprises an air/air exchanger which includes an inlet for the gas to be dried and an outlet for the dried gas, an evaporator which receives the gas to be dried from the air/air exchanger, the evaporator being formed by means of a plurality of adjacent layers. The layers comprise at least a first layer configured for the passage of a refrigerating fluid, at least a second layer configured to receive the gas to be dried from the air/air exchanger and a plurality of third layers configured to receive a phase change material. The layers are arranged in a sequence which comprises in alternation a first layer, a third layer, a second layer and a further third layer. |
US11707710B2 |
Systems and methods for generating liquid water from air
This disclosure includes systems and methods for extracting water vapor from atmospheric air and, more particularly, but not by way of limitation, systems and methods for optimizing liquid water production from air, in some instances, taking into account diurnal variations. The systems comprise an adsorption zone an a desorption zone, an actuator to move a desiccant between the adsorption zone and the desorption zone. The liquid water production is optimized based, at least in part, on measurements of one or more of: an ambient air temperature, ambient air relative humidity, and a level of solar insolation. |
US11707708B2 |
Systems and methods for capturing carbon dioxide
A method for capturing carbon dioxide includes contacting a carbon dioxide lean gas mixture with water. One or more acid gas impurities may pass from the carbon dioxide lean gas mixture to the water to form a gas mixture and an aqueous effluent. The gas mixture is passed to a pressure swing adsorption system or a temperature swing adsorption system to increase a concentration of carbon dioxide in the gas mixture to form a carbon dioxide enriched gas mixture. The carbon dioxide enriched gas mixture is contacted with the aqueous effluent in a carbon dioxide scrubber. Carbon dioxide passes from the carbon dioxide enriched gas mixture to the aqueous effluent to form a stripped gas and acid gas enriched water. The acid gas enriched water is passed to a reactive rock formation. The one or more acid gas impurities and carbon dioxide are mineralized and permanently sequestered. |
US11707706B1 |
Corona disinfecting air filter systems
The present disclosure relates generally to air filtration devices. More specifically, but not exclusively, the present disclosure relates to an air filtration device comprised of a copper (or copper alloy) medium to inactivate airborne pathogens (e.g., viruses, bacteria, coronaviruses, COVID-19, etc.) and mitigate harmful exposure to said pathogens. The copper medium is a porous mesh (i.e., copper wool) that is positioned within or on a structure to provide support. The air filtration device may be positioned in an HVAC system such that an air stream flows through the copper medium to inactivate airborne pathogens, such as viruses, in the air stream. The air filtration device may be used in combination with, or in addition to, existing HVAC system conventional air filters (e.g., HEPA filters). The air filtration device includes a copper medium positioned on a face mask to inactivate airborne pathogens during respiratory processes. |
US11707705B2 |
Multi-function hydraulic separator
A hydronic system separator has an air separator with a vent release mechanism to remove air from the fluid within a hydronic system. The separator includes a magnetic assembly for collecting ferrous particles from the fluid. One or more screens are used to remove other particles from the fluid. The separator housing includes a removable debris collection receptacle that has a drain assembly. |
US11707700B2 |
Process for interfacial separation of metal nanoparticles or nanowires using centrifugal separators
The present invention disclosed a continuous flow and batch process for the separation of metal or metal oxide nanoparticles continuously in a periodic manner at the liquid-liquid interface using a centrifugal separator cum extractor, wherein the nanoparticles are collected at the liquid-liquid interface of the polar and non-polar liquids. |
US11707699B2 |
Plate assembly and method of manufacturing for use in water treatment
Various systems, apparatus, and methods used to remove solids from water are provided. A plate assembly for a plate settler assembly is provided which includes a plate body with a plate body thickness. The plate assembly also includes a first support plate attached to the plate body on a first axis extending between the first and second end of the plate body. The plate assembly may further include a second support plate attached to the plate body on a second axis extending between the first and second end. The plate assembly may also include a stiffener or a central stiffener attached to the plate body on a third axis. The plate assembly may still further include a flow control plate along the first end. The thickness of the support plates, stiffener, and flow control plate are greater than the plate body thickness. A corresponding method of manufacture is provided. |
US11707687B1 |
Systems and methods for administering a prediction game
In a prediction game, the potential value of a participant’s prediction depends on the time when the prediction is submitted. The prediction may pertain to the outcome of a competition in a bracket-style tournament (e.g., the NCAA Division I Men’s Basketball Championship, or “March Madness”). |
US11707685B2 |
Systems and methods for fractional ownership of user-generated content within an online gaming platform
Systems and methods for dispersing gains derived from ownership of user-generated content among users of a gaming platform are disclosed. Exemplary implementations may: execute an instance of a game and implement in-game actions in the instance of the game as requested by the users; assign ownership of a first item of user-generated content to a group of users; record the ownership of the first item of user-generated content by the group of users; determine a first quantity of gains that have been gained within the gaming platform through use of the first item of user-generated content; and disperse at least a portion of the first quantity of gains to individual ones of the group of users. |
US11707684B2 |
Cross-platform consumption of in-game objects
Computer implemented systems and methods for cross-platform consumption of in-game objects are provided herein. An exemplary method includes receiving by a data platform from at least one first device game object data discovered by a user while playing a video game associated with the data platform; attributing by the data platform a cross-platform identifier to the game object data; storing by the data platform metadata associated with the game object data to a database associated with the data platform, and receiving by the data platform from a second device associated with the data platform a request for access to the game object data and the metadata. The request may include the cross-platform identifier. The exemplary method further includes authenticating by the data platform the request based on the cross-platform identifier; and based on the authentication selectively providing by the data platform access to game object data and the metadata. |
US11707681B2 |
Information processing system for a multiple mode team game, non-transitory computer-readable storage medium having stored therein information processing program, information processing apparatus, and information processing method for the same
During a predetermined period, a team competition event is held. If a game regarding the team competition event is performed using a character belonging to a user team to which a user belongs, the user can acquire team medals, and the team medals are added to the user team. If, on the other hand, the game is performed using a character belonging to a team other than the user team to which the user belongs, the team medals are not added to the user team. After the lapse of the predetermined period, in accordance with team medals of each team, the result of the team competition event is displayed. |
US11707679B2 |
Medium, information processing apparatus, and method for generating a natural sentence
A computer is caused to execute: acquiring the log; generating a natural sentence based on the acquired log; and generating story content to be appreciated by a user by arranging the generated natural sentence and one or a plurality of game-related contents that are related to the log. |
US11707677B2 |
Visualization system for creating a mixed reality gaming environment
A virtualization system is that comprises a display configured to display a representation of a real-world gaming area with physical objects. A user selects and adds one or more virtual electronic gaming machines (EGMs) to the gaming area representation to generate a mixed reality gaming area. Each virtual EGM added to the mixed reality gaming area can be moved to a desired location and rotated to a desired orientation. Each virtual EGM added to the to the mixed reality gaming area is also shown implementing a game that may also be selected by the user. The user is provided with a representation on the tablet computer of the mixed reality gaming area that includes the specific EGMs implementing the specific game, where the specific EGMs can be added or replaced at one or more virtual locations. |
US11707675B2 |
Graphical user interface and parametric equalizer in gaming systems
A system that incorporates the subject disclosure may include, for example, a gaming system that cooperates with a graphical user interface to enable user modification and enhancement of one or more audio streams associated with the gaming system. In embodiments, the audio streams may include a game audio stream, a chat audio stream of conversation among players of a video game, and a microphone audio stream of a player of the video game. Additional embodiments are disclosed. |
US11707672B2 |
Player density based region division for regional chat
The virtual location of a player in a location-based game is determined from the real-world location of the player's client device. The location-based game provides the player access to one or more chat room based on their location. To determine the locations of chat room, a server analyzes player locations in a geographic region, clusters player locations to identify centroids, and adjusts the clusters based on constraints. The server selects chat room locations (e.g., at points of interest) to more evenly balance the number of players in each chat room while complying with one or more restraints on the size of the geographic area served by each chat room. |
US11707671B2 |
Anamorphic display device
An anamorphic display device is provided. The anamorphic device includes a secondary display configured to be detachably coupled to a computing device including a primary display; and a non-transitory device operatively coupled to the primary and secondary displays and having instructions thereon that are configured, when executed, to render an anamorphic image on at least one of the primary and secondary displays so as to create, in combination, a three-dimensional effect from a point of view facing the primary and secondary displays. |
US11707666B2 |
Adjustment mechanism for electric power-driven shoe
An adjustment mechanism for an electric power-driven shoe, the mechanism comprising a shoe sole (1) is presented, wherein a plurality of rolling wheels (2) are arranged below the shoe sole (1); a foot-positioning mechanism is arranged above the shoe sole (1) and is provided with an angle-adjusting mechanism for adjusting an angle between the foot-positioning mechanism and a lengthwise direction of the shoe sole (1). |
US11707658B2 |
Golf club head or other ball striking device having reinforced sole
A head for a ball striking device includes a bracing member connected to an upper sole surface located on the sole of the body opposite the bottom sole surface. The bracing member includes a first end connected to a first point on the upper sole surface, a second end connected to a second point on the upper sole surface spaced from the first point, and a bridge portion extending between the first and second ends. The bridge portion extends upward from the upper sole surface and is spaced from the upper sole surface. The bridge portion may be formed by one or more trusses, and may define a generally triangular shape in one embodiment. The first and second ends may be connected to the upper sole surface using a variety of techniques, e.g., welding or other integral joining technique, integral forming, adhesive or other bonding material, or other technique. |
US11707657B2 |
Golf-shot-tracking-self-driving-path central controlling system
Disclosed is a golf-shot-tracking-self-driving-path central controlling system, comprising a predetermined-paths-determining module, a golf-ball-next-shot-location determining module and a path driving controlling module, to centrally control each of a plurality of golf-shot-tracking fairway-self-driving golf carts to drive in one of a plurality of predetermined paths or shift among the plurality of predetermined paths. |
US11707656B2 |
Smart golf putter heads
A golf putter clubhead is designed with a unique structure using a geometry and a balance technology to provide super symmetry, harmony and balance at motion and at rest. The clubhead includes a body with triangular members, a putting face, and optional holes. The triangular form clubhead does not require compensation during the swing thus allowing for greater repetition and simplicity of movement in turn producing performance benefits via consistency. The geometric triangular shape of the clubhead provides an instantly recognizable assistance in proper alignment at the rest position. The body of the clubhead may be hollow and feature inner symmetrical structures to complement the form of the body and to enhance and provide superior weight distribution and balance, thus, providing a performance edge in swing consistency and performance, and allowing for repeatability of the clubhead. |
US11707654B2 |
Club heads having reinforced club head faces and related methods
A golf club head including a face element having a face surface, a rear surface, and a reinforcement device with a reinforcement element that extends out from the rear surface of the face element toward a rear end and away from a front end of a golf club head. The reinforcement element includes a looped rib having an outer perimeter surface and an inner perimeter surface. The face surface is nearer to the rear surface proximal to the face center than proximal to the face perimeter. The outer perimeter surface of the reinforcement element is filleted with the rear surface. |
US11707653B2 |
Golf club heads and methods to manufacture golf club heads
Embodiments of golf club heads, golf clubs, and methods to manufacture golf club heads and golf clubs are generally described herein. In one example, a golf club head includes a recessed opening between a front opening and a back wall portion, a front plate portion coupled to the recessed opening to enclose a first interior cavity in the golf club head between the front plate portion and the back wall portion, a face portion coupled to a front portion to enclose a second interior cavity between the face portion and the front plate portion, a first filler material at least partially filling the first interior cavity, and a second filler material at least partially filling the second interior cavity. The first filler material and the second filler material have at least one different physical property. Other examples and embodiments may be described and claimed. |
US11707652B2 |
Aerodynamic golf club head
An aerodynamic golf club head having body attributes that impart beneficial aerodynamic properties. |
US11707651B2 |
Golf club heads and methods to manufacture gulf club heads
Embodiments of golf club heads and methods to manufacture golf club heads are generally described herein. In one example, a golf club head includes a top portion having a heel-side portion, a toe-side portion, and a raised central top portion with an opening. A shoulder portion extends inward toward the opening and a crown portion is attached to the shoulder portion and covers the opening. The bottom portion includes a central protrusion between a heel-side dividing plane and a toe-side dividing plane, a toe-side protrusion between the toe-side dividing plane and a toe-side bounding plane, and a heel-side protrusion between the heel-side dividing plane and a heel-side bounding plane. A distance between the toe-side dividing plane and the heel-side dividing plane is about equal to a diameter of a golf ball. Other examples and embodiments may be described and claimed. |
US11707648B2 |
Golf ball
An object of the present invention is to provide a novel golf ball having excellent spin performance on approach shots. The present invention provides a golf ball comprising a golf ball body, and a paint film formed on a surface of the golf ball body and composed of at least one layer, wherein a base resin constituting an outermost layer of the paint film includes a polyurethane, and the polyurethane has a loss elastic modulus (E″) of 0.2×108 Pa or more at −50° C. and a loss tangent (tan δ) having a peak temperature of 0° C. or less, obtained by measuring dynamic viscoelasticity of the polyurethane under specific conditions. |
US11707646B2 |
Strength training and exercise platform
An exercise device includes a base defining an inner volume and a top supported by the base, the top defining an aperture. The exercise device further includes a force sensor configured to measure force on the top and a motor disposed within the base and below the top, the motor including a cable extendable through the aperture. The exercise deice further includes a controller communicatively coupled to each of the force sensor and the motor. The controller is adapted to actuate the motor in response to forces applied to the top as measured by the force sensor. The controller may also actuate the motor in response to one or more additional parameters related to the speed or force with which the cable is manipulated (e.g., pulled by a user). |
US11707644B2 |
Variable—resistance exercise machine with network communication for smart device control and brainwave entrainment
A variable-resistance exercise machine with network communication for smart device control and brainwave entrainment, comprising an exercise machine with a plurality of moving surfaces, that each provide an independent degree of resistance to movement, a sensor that detects movement and provides output to a controller, a brainwave entrainment manager that selects a brainwave entrainment frequency based on the sensor output, and a controller that receives an input from a user device, changes the operation of the plurality of moving surfaces based on the input, and sends the brainwave entrainment frequency to the user device. |
US11707641B2 |
Combustible concealed space
Fire protection system and methods for concealed spaces providing for effective fire protection over an effective depth range measuring from a minimum six inches up to a maximum that is greater than thirty-six inches. A combustible concealed space that includes an upper deck and a ceiling deck spaced about a longitudinal axis extending substantially parallel to the ceiling deck with a fire protection system having a firefighting fluid supply pipe and at least one automatic upright sprinkler coupled to the fluid supply pipe and positioned to define an effective depth range that measures from six inches to a maximum of at least sixty inches. |
US11707634B2 |
Real-time methods for magnetic resonance spectra acquisition
The invention pertains to advances in real-time methods in nuclear magnetic resonance by offering a new dual-frequency dynamic nuclear polarization (DNP) method that uses a microwave beam to polarize the spins of electrons and concomitantly act as a NMR transmitter. |
US11707631B2 |
Antenna assemblies for use with transcutaneously powered medical implants
An antenna assembly for use with a medical implant includes an antenna that defines at least one turn and an electromagnetic shield. |
US11707630B2 |
His-bundle or bundle branch pacing capture verification
Systems and methods for pacing cardiac conductive tissue are described. In an embodiment, a medical system includes an electrostimulation circuit to generate pacing pulses to stimulate a His bundle or a bunch branch. A sensing circuit senses a far-field ventricular activation, determines a cardiac synchrony indicator using the far-field ventricular activation in response to His bundle or bundle branch pacing, and verifies His-bundle capture status using the determined cardiac synchrony indicator. The system can determine a pacing threshold using the capture status under different stimulation strength values. The electrostimulation circuit can deliver stimulation pulses in accordance with the determined pacing threshold. |
US11707624B2 |
Methods and systems for treating cardiovascular disease using an implantable electroacupuncture device
A method of treating cardiovascular disease in a patient includes generating, by an implantable stimulator configured to be implanted beneath a skin surface of the patient, stimulation sessions at a duty cycle that is less than 0.05 and applying, by the implantable stimulator in accordance with the duty cycle, the stimulation sessions to a location, within the patient, that is associated with the cardiovascular disease. The duty cycle is a ratio of T3 to T4. Each stimulation session included in the stimulation sessions has a duration of T3 minutes and occurs at a rate of once every T4 minutes. |
US11707623B2 |
Surgical implant system
The disclosed subject matter is directed to a surgical implant and a device for its activation. The surgical implant comprises a substantially planar central body portion having a top side and a bottom side and at least two adjustable wing portions. In addition, the implant comprises at least two connecting members, each one of the at least two connecting members extending from opposite sides of the central body portion, the each one of the at least two connecting members being configured for flexibly connecting each one of the at least two wing portions at opposite sides to said central body portion. |
US11707618B2 |
Oral muscle training
A trans mucosal neuromuscular electrical stimulation device including a mouthpiece, electrodes associated with the mouthpiece. The device and/or mouthpiece incorporates electrical circuitry operatively connecting to the electrodes to a power source and is configured to provide, in use, electrical stimulation to one or more palate and/or tongue muscles via the electrodes through the oral mucosa. The treatment regime, including the location of stimulation and the parameters used, is designed to increase resting muscle tone and/or muscle tone during sleep. |
US11707617B2 |
Method to extract and quantify the cardiac end diastolic point/mitral valve closing point from the HVAD estimated flow waveform
A control circuit for a sensorless implantable blood pump configured to determine mitral valve regurgitation includes processing circuitry configured to generate an estimated blood flow waveform from the sensorless implanted blood pump and generate an alert if between an end period of diastole and a beginning period of systole a measured amplitude of the estimated blood flow waveform does not include an inflection point. |
US11707601B2 |
Cover to facilitate reduced-touch insertion of a catheter and related systems and methods
A catheter system may include a catheter assembly and a needle assembly. The catheter assembly may include a catheter hub and a catheter extending distally from the distal end of the catheter hub. The catheter assembly may include a cover coupled to a proximal portion of the catheter hub. The cover may be configured to reduce contact with the catheter assembly during initial insertion of the catheter assembly into vasculature of a patient and/or threading the catheter, which may reduce a risk of bacterial contamination of the catheter. The needle assembly may include an introducer needle, a housing, and a needle hub disposed within the housing. The housing may include a button. A proximal end of the introducer needle may be secured within the needle hub. In response to activation of the button, the needle hub and the introducer needle may move proximally within the housing. |
US11707597B2 |
Catheter tray, packaging system, and associated methods
A tray (100) for accommodating a coiled medical device, such as a catheter assembly (700), includes a first compartment (101), a second compartment (102), and a third compartment (103). The catheter assembly (700) and devices associated with a catheterization procedure, such as syringes (701,702) containing sterile water and lubricating jelly and a specimen container (703) can be disposed within the tray. Printed instructions (1001) can be included with the tray (100). When a CSR wrap (1000) is disposed about the tray (100), the printed instructions can be placed atop the CSR wrap (1000) but beneath an outer sterile wrap (1002). The printed instructions (1001) can include a patient portion (1202) that is detachably coupled to a health care services portion (1201) such that it can be taken home with the patient after the procedure. |
US11707595B2 |
Controlling light exposure for circadian phase management
This disclosure pertains to a system configured to control light exposure for circadian phase management and/or light deficient disorders of a subject. The system comprises a user interface, physiological sensors configured to generate output signals conveying physiological data of the subject, and a light control valve configured to block or reduce blue light ambient radiation reaching eyes of the subject. Processors are in communication with the user interface, the physiological sensors, the light control valve, and radiation generators. The processors cause the system to receive physiological goals of the subject, determine a light control plan based on the physiological goals, the physiological data, environmental data, and time data. The system operates the light control valve to block or reduce blue light ambient radiation based on the light control plan, and generate, using the one or more radiation generators, therapeutic light radiation based on the light control plan. |
US11707590B2 |
Patient interface with a seal-forming structure having varying thickness
A cushion assembly for a patient interface includes an elastomeric seal-forming portion with a dome-shaped superior region that is intersected by the sagittal plane in the vicinity of a superior tangent point. The seal-forming portion further including a saddle-shaped inferior region that is intersected by the sagittal plane and includes an inferior tangent point. A first support region is located on one side of the sagittal plane between the inferior region and the superior region, the exterior surface of the elastomeric seal forming portion at the first support region being cylinder-shaped and/or saddle-shaped. In addition, a blowout prevention system is configured to counter a force acting on the unsupported edge of the elastomeric seal-forming portion due to a pressure within the chamber, the blowout prevention system being attached to the elastomeric seal-forming portion at the first support region of the elastomeric seal-forming portion. |
US11707589B2 |
Patient interface
A patient interface may include a plenum chamber and a positioning and stabilising structure. The plenum chamber may include a seal-forming structure and a fascia portion. At least a medial portion of the fascia portion is flexible. In embodiments, the patient interface may include a rigidiser to control flexing of the fascia portion. |
US11707588B2 |
Determining patient interface device optimal hardness
A system for determining an optimal hardness of a patient interface device includes a fit score determination unit structured to receive a 3-D model of the patient interface device and a 3-D model of a patient's face and to determine a fit score between the patient interface device and the patient's face based on the 3-D model of the patient interface device and the 3-D model of the patient's face, and a hardness determination unit structured to determine a hardness value of the patient interface device based on the determined fit score. |
US11707587B2 |
Wire heated tube with temperature control system, tube type detection, and active over temperature protection for humidifier for respiratory apparatus
A heated conduit is configured to connect to and receive pressurized breathable gas from a respiratory unit. The heated conduit includes a first cuff that includes an air inlet portion and an electrical connector portion that is adjacent the air inlet portion and comprises three electrical terminals that are configured to engage a respiratory unit electrical connector. The heated conduit also includes a second cuff comprising an air outlet and a flexible tube portion with a first end connected to the first cuff, a second end connected to the second cuff, and a spiral rib structure wrapped around a central lumen. A grouping of wires is supported within the spiral rib structure of the flexible tube portion and include a pair of heating wires and a signal wire. A sensing device extends into the gas flow path from an interior surface of the second cuff and is configured to output a signal indicative of the condition inside the heated conduit. |
US11707585B2 |
Heater assembly for an aerosol-generating system
A heater assembly for an aerosol-generating system includes a perforated glass substrate and a heater element. The heater element is provided in the glass substrate, on the glass substrate, or both in and on the glass substrate. The heater element includes a plurality of parallel strips between alternating rows of the perforations. |
US11707583B2 |
Detection and monitoring of dosage delivery for vaporized waxes, solids or viscous oils, and cannabinoids
A sensing module for monitoring dosage delivery of a vaporized material, and a portable vaporization unit including the sensing module, include a light sensor that detects disruptions in a light path across a vapor channel, the disruptions caused by the vaporized material flowing through the vapor channel. The light sensor includes a UV light source, which may emit 370 nm wavelength light, and a UV light detector that converts intensity of incident light in the light path into a signal. A microprocessor of the sensing module compares the signal to a baseline measurement to determine the concentration of a medicament in the vapor; then, using the flow rate and activation time of the device, the microprocessor determines the dosage and can perform monitoring and reporting actions based on the dosage. A measuring circuit measures fluctuations in resistance/impedance of a vaporization element to further determine flow rate and/or dosage. |
US11707578B2 |
System and method for safety syringe
A system for injecting includes a syringe body defining a proximal opening and a distal needle interface. The system also includes a plunger member defining a plunger interior and configured to be manually manipulated to insert a stopper member relative to the syringe body. The plunger member includes a needle retention feature disposed in the plunger interior, an energy-storage member disposed in the plunger interior, and an energy-storage member latching member disposed in the plunger interior. The system further includes a needle hub assembly coupled to the distal needle interface of the syringe body. The needle assembly includes a needle having a needle proximal end feature, a hub, and a needle latching member configured to couple the needle to the hub. The needle is retractable into plunger interior upon manipulation of the plunger member to actuate the energy-storage member latching member. |
US11707573B2 |
Electronic module and drug delivery device
The invention relates to an electronic module for recording information of a drug delivery device, the electronic module comprising at least one connector, wherein at least one connector is adapted to be connected to a port of the drug delivery device and wherein at least one connector is adapted to be connected to a port of a computer. Furthermore, the invention relates to a drug delivery device, comprising a port for connecting to the connector of the electronic module. |
US11707572B2 |
Drug injection device
A cartridge adapter includes: a cartridge holder having a space that can accommodate therein a drug cartridge, the drug cartridge including a cylinder having a tubular internal space extending in a longitudinal direction, a gasket supported in the internal space so as to be movable in the longitudinal direction, and a drug held in the internal space; a piston that moves the gasket in the longitudinal direction in the internal space of the cylinder; a piston guide that movably supports the piston and connected to the cartridge holder; and a piston driving mechanism that drives the piston in the longitudinal direction. |
US11707571B2 |
Hierarchical adaptive closed-loop fluid resuscitation and cardiovascular drug administration system
The present disclosure describes a closed-loop fluid resuscitation and/or cardiovascular drug administration system that uses continuous measurements and adaptive control architecture. The adaptive control architecture uses a function approximator to identify unknown dynamics and physiological parameters of a patient to compute appropriate infusion rates and to regulate the endpoint of resuscitation. |
US11707567B2 |
System and methods for fluid delivery
A system for at least partial closed-loop control of a medical condition is disclosed. The system includes at least one medical fluid pump. The medical fluid pump including a sensor for determining the volume of fluid pumped by the pump. Also, at least one continuous analyte monitor, and a controller. The controller is in communication with the medical fluid pump and the at least one continuous analyte monitor. The controller includes a processor. The processor includes instructions for delivery of medical fluid based at least on data received from the at least one continuous analyte monitor. |
US11707566B2 |
Pump for measuring pressure of fluid to be transferred, fluid transport system using the same, and method for operating the system
The present invention discloses a pump for measuring a pressure of fluid to be transferred, a fluid transport system using the same, and a method for operating the system. The pump includes a pumping portion alternately generating a positive pressure and a negative pressure; a first diaphragm which is provided on one side of the pumping portion and of which a shape is changed as the positive pressure and the negative pressure are alternately generated; a transport chamber which sucks and discharges a transport target fluid corresponding to the deformation of the first diaphragm; a second diaphragm which is provided on the other side of the pumping portion; a monitoring chamber which is provided on one side of the second diaphragm and of which a pressure changes corresponding to the deformation of the second diaphragm; and a pressure measuring portion measuring a pressure change of the monitoring chamber. |
US11707564B2 |
Safe operation of integrated negative pressure wound treatment apparatuses
Disclosed herein are systems and methods for safe operation of a wound treatment apparatus with electronic components integrated on or within a wound dressing. In some embodiments, the electronic components include a power source, an isolation circuit, a controller, a capacitor, and a negative pressure source. The isolation circuit provides multiple activation states with at least one state preventing application of power to the other electronic components capable of storing electrical energy, thereby providing a safe operation of the apparatus. For example, sterilization of the apparatus can be performed safely. |
US11707561B2 |
Another insert piece for a blood tubing set to promote mixing an infusion solution with a further fluid
The present invention relates to an insert piece for a blood tubing set that includes a first connection site for connecting a first tubing portion of the blood tubing set to the insert piece; a second connection site for connecting a second tubing portion of the blood tubing set to the insert piece; a third connection site for connecting a third tubing portion of the blood tubing set to the insert piece; a first main line for conducting a first liquid through the insert piece; a second main line for conducting the first liquid through the insert piece; a secondary line for conducting a second liquid into at least one of the first main line, and the second main line; and a connection portion which connects both main lines to each other or to the second connection site. |
US11707555B2 |
Nanofiber reinforcement of attached hydrogels
Described herein are hydrogels attached to a base with the strength and fatigue comparable to that of cartilage on bone and methods of forming them. The methods and apparatuses described herein may achieve an attachment strength between a hydrogel and a substrate equivalent to the osteochondral junction. In some examples the hydrogel may be a triple-network hydrogel (such as BC-PVA-PAMPS) that is attached to a porous substrate (e.g., a titanium base) with the shear strength and fatigue strength equivalent to that of the osteochondral junction. |
US11707550B2 |
Polyphosphate-functionalized inorganic nanoparticles as hemostatic compositions and methods of use
A hemostatic composition is provided. The hemostatic composition includes a hemostatically effective amount of a hemostatic agent that includes a nanoparticle and a polyphosphate polymer attached to the nanoparticle. Also provided are medical devices and methods of use to promote blood clotting. |
US11707549B2 |
Adhesive containing microparticles
Methods for forming and incorporating microparticles containing one or more active agents into adhesives are described. The methods involve spray drying a liquid of the one or more active agents and obtaining the active agent in a particulate form. The dry powder is then blended or otherwise incorporated with the adhesive of interest. Also described are various medical products utilizing the adhesive and one or more active agents in microparticle form, and related methods of use. |
US11707546B2 |
Miniaturized device to sterilize surfaces from Covid-19 and other viruses and bacteria
A system for sterilizing biological material comprising beam generation circuitry for generating a radiating wave having radiating energy therein at a predetermined frequency therein. A controller controls the radiating wave generation at the predetermined frequency. The predetermined frequency equals a resonance frequency of a particular biological material and is determined responsive to a plurality of parameters from an influenza virus. The predetermined frequency induces a mechanical resonance vibration at the resonance frequency of the particular biological material within the particular biological material for destroying a capsid of the particular biological material. Radiating circuitry projects the radiating wave on a predetermined location to destroy the particular biological material at the predetermined location. |
US11707545B2 |
Light source module and ultraviolet ray irradiating apparatus including the same
A light source module including a fixing plate configured to extend in a first direction; a circuit board disposed on the fixing plate; a plurality of ultraviolet light emitting elements disposed on the circuit board in the first direction; a first reflection plate disposed at one side of the fixing plate; and a second reflection plate disposed at the other side of the fixing plate. Further, the plurality of ultraviolet light emitting elements are disposed between the first reflection plate and the second reflection plate in the first direction. |
US11707535B2 |
Method and composition for treating neuropathic pain
The present invention provides a therapy for treating neuropathic pain by subpial administration of small quantities of a composition for spinal segment-specific upregulation of GAD65 (glutamatedecarboxylase) gene and VGAT (vesicular GABA transporter) gene, which is effective for induction of nociceptive effects by potentiating release of vesicular GABA from infected dorsal horn neurons into the synaptic cleft. |
US11707532B2 |
Compositions and methods of treating muscle dystrophy
Disclosed herein are polynucleic acid molecules, pharmaceutical compositions, and methods for treating muscle dystrophy (DM1). |
US11707531B2 |
Compounds, compositions, and methods for the treatment of disease
Disclosed are compounds and compositions for the activation or induction of expression of a pattern recognition receptor (e.g., STING, RIG-I, MDA5), and methods of use thereof. |
US11707528B2 |
Mannose-based mRNA targeted delivery system and use thereof
The present invention provides a mannose-based mRNA targeted delivery system and use thereof. The mRNA can encode one or more target polypeptides and contains at least one mannose modification. The technical solution of the present invention modifies the mRNA molecule with a mannose, so that the mRNA can be directly and efficiently coupled with the mannose, and the targeted delivery of the mRNA is realized without the need for a carrier. |
US11707524B2 |
Liquid pharmaceutical composition
The present invention relates to novel liquid pharmaceutical compositions of adalimumab, which include adalimumab or a biosimilar thereof, an acetate buffering agent/system such as sodium acetate/acetic acid, and a sugar stabiliser such as trehalose. Such a combination of components furnishes formulations having a stability (e.g. on storage and when exposed to stress) which is comparable to or an improvement upon those known in the art, and with fewer ingredients. Such advances will help adalimumab treatments to become more widely available at lower cost, and prolong the viability of pre-loaded delivery devices (e.g. pre-filled syringes) to reduce unnecessary waste of the drug. |
US11707522B2 |
Human antibodies to Tn antigen
The present invention provides compositions for the production of an antibody or functional fragment thereof directed against Tn antigen or sTn antigen. The compositions disclosed herein include isolated antibody or functional fragments thereof that binds to Tn antigen or sTn antigen and polynucleotides encoding the heavy chain and/or a light chain variable domains of such antibody or functional fragment. The invention also provides methods of treating or preventing a disease, such as cancer or tumor formation, wherein the antibody or functional fragment includes a variable heavy chain domain and a variable light chain domain that has an amino acid sequence provided herein. The invention further provides a conjugate of an antibody or functional fragment thereof conjugated or recombinantly fused to a localizing agent, detectable agent or therapeutic agent, and methods of treating, preventing or diagnosing a disease in a subject in need thereof. |
US11707520B2 |
Adjuvanted vaccines with non-virion antigens prepared from influenza viruses grown in cell culture
An immunogenic composition comprising: (i) a non-virion influenza virus antigen, prepared from a virus grown in cell culture; and (ii) an adjuvant. Preferred adjuvants comprise oil-in-water emulsions. |
US11707519B2 |
Phosphorylated heptose compounds: process for their preparation and use
Processes for the preparation of phosphorylated heptose compounds are provided. Embodiments of the invention relate to the chemical synthesis of heptopyranose phosphate compounds. Also, embodiments of the invention relate to the use of compounds according to the invention in modulating an immune response in a subject. |
US11707508B2 |
Anti-retroviral treatment using growth hormone
The subject invention pertains to methods of treating HIV-1 infected subject comprising the administration of growth hormone to a subject infected by HIV-1. The subject may be undergoing co-administration of anti-retroviral therapies (ARTs), may be untreated with anti-retroviral drugs (ARDs) or may be in a period of time where no ART is being administered. Growth hormone may be administered at a fixed dosage for a set period of time or may be administered at a first dosage for a first period of time that may then be increased or decreased to a second dosage for a second period of time. |
US11707506B2 |
Use of a VEGF antagonist to treat angiogenic eye disorders
The present invention provides methods for treating angiogenic eye disorders by sequentially administering multiple doses of a VEGF antagonist to a patient. The methods of the present invention include the administration of multiple doses of a VEGF antagonist to a patient at a frequency of once every 8 or more weeks. The methods of the present invention are useful for the treatment of angiogenic eye disorders such as age related macular degeneration, diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, branch retinal vein occlusion, and corneal neovascularization. |
US11707505B2 |
VCP and factor H as viral entry inhibitors
The present invention further relates to using vaccinia virus complement control protein (VCP), factor H and/or a complement control protein (CCP)-containing protein as modulator of the entry and/or replication of pathogen(s), wherein the pathogen is a virus or bacteria. The present invention further relates to a method of prevention and/or treatment of influenza A virus (IAV) infection in a subject of need thereof and to a method of modulation of the entry and/or replication of pathogen(s) in a subject of need thereof. |
US11707504B1 |
Fusion peptide inhibitors of human coronavirus 229E
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays. |
US11707503B2 |
Modulators of complement activity
The present invention provides polypeptide modulators of complement activity, including cyclic polypeptide modulators. Also provided are methods of utilizing such modulators as therapeutics. |
US11707502B2 |
Stable pharmaceutical composition of vasopressin
The present invention relates to a stable pharmaceutical composition comprising vasopressin or pharmaceutically acceptable salts thereof. The present invention further provides a method of increasing blood pressure in adults with vasodilatory shock by administering said pharmaceutical composition of vasopressin or pharmaceutically acceptable salts thereof. |
US11707499B2 |
Odor masking formulations for natural compounds
The invention discloses odor masking formulations for stench natural compounds, selected from the extracts, fraction and pure phytochemicals that are produced in combination with a natural or synthetic hydrocolloid polymer gum(s). The invention further discloses novel process of producing the odor and taste masking formulations. The invention also discloses taste masking formulations of valerian extracts with no characteristic stench odor & or negligible stench odor in combination with natural hydrocolloid gum such as guar gum, acacia or other polymers. The invention further discloses method of reducing insomnia, anxiety, Attention Deficit Disorder (ADD), Chronic Fatigue Syndrome (CFS) using odor masking formulation of the current invention. Importantly, the said odor masked formulation of the present disclosure helps in improving sleep cycle and helps in efficient functioning of brain. |
US11707498B2 |
Method of using a gel, rinse, and spray for management of post-oral surgical recovery and maintenance of oral health
Homeopathic spray, gel, and rinse compositions containing tinctures of Arnica montana, Calendula officinalis, Chamomilla, Ignatia amara, Echinacea purpurea and/or Echinacea angustifolia are disclosed, along with homeopathic compositions containing tinctures of Calendula officinalis, Echinacea purpurea, Plantago major, and Azadirachta indica. Methods of using, and kits containing, the homeopathic spray, gel, rinse and other compositions for maintaining oral care and reducing inflammation, pain, and bruising after oral surgery are provided. |
US11707497B2 |
Methods and compositions with purified Bombyx mori cocoon silk peptide fiber and refined Buglossoides arvensis seed oil providing anti-inflammatory effects and neuroprotection for disease states
The present invention is directed to compositions comprising purified Bombyx mori cocoon silk peptide fiber, refined Buglossoides arvensis seed oil, and optionally Blueberry extract, and related methods for decreasing inflammation and providing neuroprotection. The compositions provide synergistic effects and may be used to treat relevant diseases and disorders. |
US11707492B2 |
Fetal support tissue products and methods of use
Methods of treating a complex wound by administering to a complex wound in the individual a therapeutically effective amount of a fetal support tissue product to treat the complex wound. Methods of treating a complex lower extremity ulcer by administering to a complex lower extremity ulcer in the individual a therapeutically effective amount of a fetal support tissue product to treat the complex lower extremity ulcer. Methods of reducing or preventing scar formation from granulation tissue by administering a fetal support tissue product to granulation tissue. Methods of repairing a spina bifida defect by administering to the defect in the individual a therapeutically effective amount of an umbilical cord product. |
US11707490B2 |
Methods and reagents for treating diabetes
Disclosed are methods for treating or limiting development of diabetes, by transplanting into the eye of a subject with diabetes or at risk of diabetes an amount effective to treat or limit development of diabetes of insulin-producing cells engineered to reduce expression of a β3 subunit of Cav (Cavβ3). |
US11707480B2 |
Highly active compounds against COVID-19
The present invention is the use of a small group of purine nucleotide phosphoramidate disclosed herein or a pharmaceutically acceptable salt thereof in an effective amount for the treatment or prevention of the novel 2019 coronavirus disease (COVID-19) in a host, for example a human, in need thereof. |
US11707479B2 |
Combination formulation of two antiviral compounds
Disclosed are pharmaceutical compositions comprising Compound I, having the formula: and an effective amount of sofosbuvir wherein the sofosbuvir is substantially crystalline. Also disclosed are methods of use for the pharmaceutical composition. |
US11707476B2 |
Catecholamine prodrugs for use in the treatment of parkinson's disease
The present invention provides compounds of formula (Id) that are prodrugs of catecholamine for use in treatment of neurodegenerative diseases and disorders. The present invention also provides pharmaceutical compositions comprising compounds of the invention and methods of treating neurodegenerative or neuropsychiatric diseases and disorders using the compounds of the invention, in particular Parkinson's disease. |
US11707467B2 |
(17-ß)-3-oxoandrost-4-en-17YL tridecanoate compositions and methods of their preparation and use
Described here are substantially pure (17-β)-3-Oxoandrost-4-en-17-yl tridecanoate compositions, methods of their preparation and uses thereof. |
US11707465B2 |
Theacrine-based supplement and method of use thereof in a synergistic combination with caffeine
A human dietary supplement comprises theacrine and optionally other compounds that modulate the effects of theacrine. Uses for the theacrine-containing supplement include improvement of at least one of mood, energy, focus, concentration or sexual desire or a reduction of at least one of anxiety or fatigue. A synergistic composition comprises co-administration of theacrine and caffeine, wherein the co-administered caffeine reduces theacrine oral clearance (CL/F) and oral volume of distribution (Vd/F). In addition, the co-administered caffeine increases area under the plasma concentration time curve (AUC) of theacrine, and increases theacrine maximum plasma concentration (Cmax) in comparison with the corresponding pharmacokinetic parameters when theacrine is administered alone. |
US11707461B2 |
N-formyl vortioxetine and preparation method thereof and solid preparation of vortioxetine
Disclosed is N-formyl vortioxetine, and also disclosed is a method for preparing the N-formyl vortioxetine and a stable solid preparation of vortioxetine. |
US11707460B2 |
Ophthalmic compositions
The present disclosure provides an ophthalmic composition comprising 4-(3-amino-1-(isoquinolin-6-ylamino)-1-oxopropan-2-yl)benzyl 2,4-dimethylbenzoate or its pharmaceutically acceptable salts; about 0.01% weight/volume to about 1.0% weight/volume of a buffer; and about 0.01% weight/volume to about 10% weight/volume of a tonicity agent. |
US11707459B2 |
Method for treating nervous system injuries using boldine and analogs thereof
Provided are methods of treating an injury to the nervous system in a subject comprising administering to the subject an effective amount of boldine, a boldine analog, or a pharmaceutically-acceptable salt thereof. Also provided are methods of improving voluntary muscle control and methods of treating neuropathic pain in a subject having an injury to the nervous system. This abstract is intended as a scanning tool for purposes of searching in the particular art and is not intended to be limiting of the present disclosure. |
US11707457B2 |
IRAK degraders and uses thereof
The present invention provides compounds, compositions thereof, and methods of using the same. |
US11707453B2 |
Treatment of unipolar depressive disorder
The invention relates to the treatment or control of unipolar depressive disorder by administering a compound of Formula I or a salt thereof to a subject; wherein: E is S or Se; R1 and R2 are optional substituents, and are at each occurrence independently selected from: (1) a halogen, which is preferably selected from F, Cl and Br; (2) C1-C4 alkyl, such as C1-C2 alkyl or C1 alkyl, optionally substituted with one or more halogen atoms, each of which is preferably selected from F, Cl and Br; and (3) C1-C4 alkoxy, such as C1-C2 alkoxy or C1 alkoxy; optionally substituted with one or more halogen atoms, each of which is preferably selected from F, Cl and Br; m is an integer in the range of from 0 to 5; and n is an integer in the range of from 0 to 4. |
US11707452B2 |
Modulators of alpha-synuclein proteolysis and associated methods of use
The present disclosure relates to bifunctional compounds, which find utility as modulators of α-synuclein (target protein). In particular, the present disclosure is directed to bifunctional compounds, which contain on one end a Von Hippel-Lindau, cereblon. Inhibitors of Apotosis Proteins or mouse double-minute homolog 2 ligand which binds to the respective E3 ubiquitin ligase and on the other end a moiety which binds the target protein, such that the target protein is placed in proximity to the ubiquitin ligase to effect degradation (and inhibition) of target protein. The present disclosure exhibits a broad range of pharmacological activities associated with degradation/inhibition of target protein. Diseases or disorders that result from aggregation or accumulation of the target protein are treated or prevented with compounds and compositions of the present disclosure. |
US11707447B1 |
C4-carbonothioate-substituted tryptamine derivatives and methods of using
Disclosed are novel C4-carbonothioate-substituted tryptamine derivative compounds and pharmaceutical and recreational drug formulations containing the same. The pharmaceutical formulations may be used to treat brain neurological disorders. |
US11707446B2 |
Psychoactive medicines and their use for treating psychiatric and neurological conditions and disorders
The invention relates to psychoactive medicines including 2C-B, methylone, MBDB, their respective metabolites, isomers, enantiomers, polymorphs, and analogues (2C-series and cathinones); their preparation, formulations, intermediates, routes of administration, dosing and schedule for medical uses for psychiatric and neurological conditions and disorders. |
US11707443B2 |
Storage stable aqueous parenteral solutions comprising diclofenac
The present invention relates to stable, aqueous, parenteral solutions comprising diclofenac and polyvinylpyrrolidone, wherein the solutions are for parenteral (subcutaneous, intravenous and/or intramuscular) administration. |
US11707440B2 |
Esketamine for the treatment of depression
The present invention provides methods of maintaining stable remission or stable response achieved by a patient with depression following administration of a therapeutically effective amount of esketamine during an initial administration phase, comprising continuing administration of a therapeutically effective amount of esketamine for at least five months during a subsequent administration phase. The present invention also provides methods for the long term treatment of depression in a patient, comprising administering to the patient in need of the treatment a clinically proven safe and clinically proven effective therapeutically effective amount of esketamine for at least six months. In some embodiments, the depression is major depressive disorder or treatment resistant depression. |
US11707439B2 |
Parenteral treatments involving aminoadamantane derivatives
A method and composition is described for treating impaired neurological function, CNS disease or condition, including altered state of consciousness disorders in a human subject, comprising parenterally administering a composition comprising aminoadamantane derivatives or salts thereof, alone or in combination with other neuroprotective and/or anti-inflammatory compounds, in a pharmacologically effective amount. In some embodiments, a method for treating traumatic brain injury caused by a stroke or an accident in a human subject is provided comprising intravenously administering a composition comprising amantadine hydrochloride in a pharmacologically effective amount to the subject in need thereof. |
US11707438B2 |
Curcuminoid composition for therapeutic management of metabolic syndrome
The present invention discloses a composition comprising 70%-80% w/w tetrahydrocurcuminoids, 10%-20% w/w hexahydrocurcuminoids and 5%-10% w/w octahydrocurcuminoids and its therapeutic application. More specifically, the present invention discloses the use of a composition comprising 70%-80% w/w tetrahydrocurcuminoids, 10%-20% w/w hexahydrocurcuminoids and 5%-10% w/w octahydrocurcuminoids in the therapeutic management of metabolic syndrome in mammals. |
US11707435B2 |
Gate for a tablet discharge of a tablet press, and method for actuating a gate
A tablet press comprises a gate and a control apparatus configured to generate a switching signal. A drive apparatus is configured to move the gate in response to the switching signal received from the control apparatus between a first switching position and at least a second switching position. At least one sensor is configured to generate a detection signal when the gate reaches one of the switching positions. The control apparatus receives the detection signal and is configured to output a switching signal to the drive apparatus to at least partially move the gate back into a home position when there is a switching signal to move the gate out of the home position and there is no detection signal received from the at least one sensor. The control apparatus subsequently outputs a switching signal to again move the gate out of the home position to a target position. |
US11707434B2 |
Method for preparing organic solvent-free lyophilized cyclophosphamide
The present invention relates to a method for preparing a lyophilized cyclophosphamide composition, wherein 99% or more of the finally prepared lyophilized cyclophosphamide composition is reconstituted within 15 seconds when water for pharmaceutical use is injected thereinto at a ratio of 50 mL per 1 g of anhydrous cyclophosphamide, comprising a step of dissolving D-mannitol or lactose, as a lyoprotectant, and cyclophosphamide in a water solvent in a selected reaction vessel; and a lyophilized cyclophosphamide composition for injection prepared thereof. |
US11707433B2 |
Methods and compositions for treating diabetic foot ulcers
In one aspect, the disclosure relates to methods and compositions, i.e., pharmaceutical formulations, for treating and preventing diabetic foot ulcers. In a particular aspect, the disclosed methods and compositions pertain to water-based pharmaceutical formulations that are useful for administration in an aqueous foot bath. This abstract is intended as a scanning tool for purposes of searching in the particular art and is not intended to be limiting of the present disclosure. |
US11707431B2 |
Dental strips for the delivery of specifically targeted antimicrobial peptides
In certain embodiments a dental strip for the prevention or reduction of dental caries is provided. In certain embodiments the dental strip is constructed to deliver effective amounts of specifically targeted antimicrobial peptides (or simple antimicrobial peptides) and comprises an orally compatible backing layer, a delivery layer disposed on one surface of the backing layer where the delivery layer comprises an orally compatible polymer, or combination of polymers, and a specifically targeted antimicrobial peptide (and/or simple antimicrobial peptide) capable of binding and killing Streptococcus mutans. In certain embodiments the dental strip additionally comprises a release liner. |
US11707430B2 |
Ophthalmic compositions
A composition comprises: a base oil; an additive comprising a copolymer comprising hydrophobic and hydrophilic units; and a drug. The copolymer may for example have a comb structure in which the hydrophobic units and hydrophilic units are pendant chains on a backbone of the copolymer. The hydrophobic units and hydrophilic units may for example comprise polydimethylsiloxane moieties and ethylene glycol residues respectively. The composition may for example be used as a tamponade or as a component for a tamponade administered to the eye. The invention is useful for solubilising and/or releasing drugs. |
US11707428B2 |
Dye composition comprising a combination of two plant extracts of Lawsonia inermis
The disclosure relates to a dye composition comprising a combination of two extracts of Lawsonia inermis and a method for preparing thereof. The disclosure also relates to the cosmetic use of said composition for dyeing keratin fibers. Finally, the disclosure relates to a cosmetic method for dyeing keratin fibers comprising the application of such a composition. |
US11707427B2 |
Cosmetic compositions and methods
The current disclosure relates to a combination of ingredients including Plumeria alba (Frangipani) flower extract and salicylic acid. The composition can further contain hydroxyacetophenone, titanium dioxide, and/or carrageenan. This combination of components has been shown to be useful as a cleansing composition that is effective for reducing sebum, increasing clarity of the skin, and for improving the appearance of the skin by reducing shine and pore size. This combination of components has further been shown to be useful for reducing irritation and inflammation in the skin. |
US11707426B2 |
Color protectant compositions
Provided herein are color protectant compositions for dyed human hair, and methods for determining the same. |
US11707422B2 |
Inorganic sunscreen agents with higher UV radiation protection
Ultraviolet radiation sun protective compositions are reported which feature micronized metal oxide inorganic particles selected from zinc oxide, titanium oxide and mixtures thereof, the inorganic particles being coated with poly[C8-C20 hydroxycarboxylic acid], the coated particles measured at a 10% loading in dodecane and 1 minute elapsed time having a Zeta Potential ranging from 2 to 10 mv, amounts of the poly[C8-C20 hydroxycarboxylic acid] to the inorganic particles being in a relative weight ratio of 1:100 to 1:10. |
US11707420B2 |
Compositions, kits, and methods for altering the color of hair
The disclosure relates to hair color base compositions comprising an alkoxylated fatty alcohol, a fatty acid, a fatty alcohol, a buffer system, and optionally a thickening agent and/or colorant compound, hair color altering compositions comprising the hair color base, and kits and methods for altering the color of keratinous fibers such as hair. |
US11707418B2 |
Connector for a gastrostomy device
A connector for rotatably coupling an enteral feeding solution supply tube to a circular port of a gastrostomy device wherein the connector comprises a fluid conduit having a first end configured for connection with an orifice defined in the circular port to supply the enteral feeding solution to the gastrostomy device, and a second end configured for connection to the enteral feeding solution supply tube, a pair of arms circumferentially arranged around an outer wall of the first end of the fluid conduit, each arm including a first free end and a second free end, wherein the second free end includes a catch configured to releasably engage with a circumferential rim on the circular port, and a flexible bridge connecting each arm to the first end of the fluid conduit and about which the first and second ends of each arm can be pivoted, wherein the connector is couplable to and decouplable from the circular port by pivoting the first and second ends of each arm at the flexible bridge such that the catch on the second free end of each arm is radially displaced into engagement or out of engagement with the rim. |
US11707417B2 |
Adjustable bottle holder and use thereof
A bottle holder, which is secured on a supporting surface, comprises a receiving base and a telescoping shaft inserted into the receiving base. A portion of the shaft is elastic, such that it can be flexed (bent and/or twisted) to a comfortable close position of the bottle, held by the bottled holder, to the user who will be consuming the bottle's contents, without the aid or assistance of another individual. When the user finishes drinking from the bottle and releases the bottle, the shaft springs (snaps) back to its initial, unbiased position, where the supported bottle is angled upwards in such a way that any contents left in the bottle will not spill. |
US11707416B2 |
Prescription monitoring system
A monitoring system includes a weight sensor for receiving a vial containing a controlled substance possessed by a patient. A processor receives a weight measured by the weight sensor. A communication circuit transmits the weight measured by the weight sensor to a remote server. The weight sensor may be mounted in a container having a first compartment and a second compartment. The first compartment has a first lid that is releasable without any lock. A second compartment has a second lid that is secured by a lock. The weight sensor is mounted inside the second compartment. |
US11707414B2 |
Sealed assembly for pill crushing and delivering and method for using thereof
A sealed assembly for pill crushing and delivering and a method for using thereof are provided. The assembly includes: a connecting valve with different diameters, including a first end, a valve and a second end provided with a syringe-abutting interface, wherein, an opening diameter of the first end is larger than that of the second end; and a pill-crushing carrier including a sealed cavity having only one filling-in opening, the pill-crushing carrier has a first state when separated from the connecting valve and the filling-in opening is exposed for delivering pills into the carrier, and a second state when the filling-in opening is connected to the first end of the connecting valve, crushed and dissolved pill powders in the sealed cavity can be taken out through the connecting valve. The assembly can crush pills and dissolve powders in a sealed cavity, deliver powder-dissolved liquid and prevent powders from dispersing. |
US11707408B2 |
Delamination resistant pharmaceutical glass containers containing active pharmaceutical ingredients
The present invention is based, at least in part, on the identification of a pharmaceutical container formed, at least in part, of a glass composition which exhibits a reduced propensity to delaminate, i.e., a reduced propensity to shed glass particulates. As a result, the presently claimed containers are particularly suited for storage of pharmaceutical compositions and, specifically, a pharmaceutical solution comprising a pharmaceutically active ingredient, for example, HUMIRA® (Adalimumab). |
US11707403B1 |
Systems and methods for treatment of abnormal visual development
Systems and methods for treatment of abnormal visual development, including at least the steps of establishing determined metrics for a patient, wherein the determined metrics include at least a diameter and a distance of the patient’s scotoma and/or the patient’s fostoma; providing, based on the determined metrics, one or more visual therapy elements; and displaying, via an electronic device, visual representations of the one or more visual therapy elements, wherein the one or more visual therapy elements comprise visual complications and/or movements of a scotoma image and/or a fostoma image. |
US11707400B2 |
Wearable device and operation method of the wearable device
A wearable device is disclosed. The wearable device may process a state variable defined based on motion information of a user, determine an interactive mode of the wearable device based on a gain associated with a magnitude of a torque of the wearable device, select a motion type from among motion types of the determined interactive mode based on a gait parameter of the user, determine a control factor for the torque based on the selected motion type, and generate the torque based on the processed state variable, the gain, and the determined control factor. |
US11707396B2 |
Medical device support apparatus for litter
An apparatus for mounting and securing medical/surgical devices may be attached to a litter (40), The medical/surgical devices may include. for example, IV holders (186), aspirators (144). cardiac monitors (148) , defibrillators (150) , infusion pumps 152 (152), ventilators (146) and other devices. The apparatus frame assembly (10) includes rails (12), (14), (16), (18), (20), (46), (48), (50), (52) having cross-sections of standard surgical rails, for attachment of slidable rail clamps (84), (104). Medical device mounts (108), (110), (112) are attached to the slidable rail clamps. The medical device mounts have height and/or rotational adjustment to improve patient access and view. The apparatus may be mounted longitudinally anywhere along the litter to maximize access to the patient. |
US11707391B2 |
Hospital bed having rounding checklist
A patient support apparatus, such as a hospital bed, communicates with an electronic medical record (EMR) system in healthcare facility. The hospital bed includes a patient support structure to support a patient, a graphical user interface coupled to the patient support structure, and control circuitry coupled to the graphical user interface. The graphical user interface displays at least one input that may be used by a caregiver to chart data into an electronic medical record (EMR) of a patient supported by the patient support structure. |
US11707385B2 |
Systems and methods for applying reduced negative pressure therapy
Embodiments of a negative pressure wound therapy systems and methods for operating the systems are disclosed. In some embodiments, a system includes a pump assembly, canister, and a wound dressing configured to be positioned over a wound. The pump assembly, canister, and the wound dressing can be fluidically connected to facilitate delivery of negative pressure to a wound. The system can be configured to efficiently deliver negative pressure in continuous and intermittent modes. The system can also be configured to gradually ramp up and down to set pressure values. The system can also be configured to detect and indicate presence of certain conditions, such as low pressure, high pressure, leak, canister full, and the like. Detection and indication of the presence of at least some of these conditions can be enabled and disabled. |
US11707384B1 |
Bilateral compression device
The present invention provides an improved bilateral compression device for post-operative surgical site, the bilateral compression device including a central cavity presented by an outerwall and a circumscribing sidewall, the central cavity in receipt of a post-operative pillow further comprising an outer membrane separated from an inner membrane for exerting a central compressive force and central indentation force deflection towards the post-operative surgical area which varies from a surrounding compression force. |
US11707380B2 |
Ear apparatus and methods of use
Selectively controllable apparatus for insertion into an ear canal, and related methods of use and operation for behavioral control. In one embodiment, the apparatus includes a body configured for insertion into an ear canal. In one variant, the body includes one or more thermal mechanisms which enable selective increase or decrease of temperature of at least portions of the ear canal so as to implement behavioral control of the user, such as to mitigate cravings for food, alcohol, narcotics, or other potentially deleterious substances. In one variant, a mild nausea or pre-nausea condition is created within the user according to a time-temperature profile so as to induce the aforementioned behavioral modification. |
US11707379B2 |
Ostomy appliance
An ostomy appliance comprising a main body portion comprising an inner wall and an outer wall of flexible sheet material joined together to define a cavity for containing a stomal output; the inner wall comprising an inlet for receiving the stomal output into the cavity; the ostomy appliance further comprising an outer comfort layer overlying at least a portion of the outer wall; wherein the outer comfort layer comprise a first part and a second part which are joined to the outer wall so that the first part partially overlaps the second part in an overlap region, wherein the first part and the second part are separable from each other in the overlap region to form a window opening for viewing the cavity; wherein the overlap region is angled obliquely to a horizontal direction when the ostomy appliance is orientated as it would be in use. |
US11707378B2 |
System for applying a stoma cover
A system including a stoma cover and an applicator for applying a stoma cover for temporarily covering a stoma during exchange of an ostomy appliance. The stoma cover has a hood-like element with a proximal end portion and a distal end portion, wherein the proximal end portion of the hood-like element is configured to be adjustable to provide for a stoma entrance of the stoma cover to be of variable size, which can be manipulated using the applicator. Also disclosed is a stoma cover and a kit of parts. |
US11707376B2 |
Base plate for a medical appliance and a sensor assembly part for a base plate and a method for manufacturing a base plate and sensor assembly part
Disclosed is a base plate for an ostomy appliance and a method for manufacturing a base plate. The base plate comprising: a top layer; a first adhesive layer; an electrode assembly comprising a plurality of electrodes, the electrode assembly having a first part and a second part, the first part comprising connection parts of the plurality of electrodes, the second part being arranged between the first adhesive layer and the top layer; and a monitor interface configured for connecting the base plate to a monitor device, the monitor interface comprising a plurality of terminals configured to form electrical connections with respective terminals of the monitor device. The top layer comprises a top layer opening configured to allow for connection between the plurality of electrodes of the electrode assembly and terminals of the monitor device. |
US11707375B2 |
Head and jaw immobilization device
Methods of immobilizing the head of a patient include heating a thermoplastic mask preform to a formable temperature, forming the thermoplastic mask over at least a mouth of the patient, and pushing a mouth receiving end of a bite piece into a portion of the thermoplastic mask preform that is positioned over the mouth of the patient, which moves the portion of the thermoplastic mask preform into the mouth of the patient. The methods also include allowing the thermoplastic mask preform to cool from the formable temperature, causing the portion of the thermoplastic mask moved into the mouth of the patient to harden. |
US11707372B2 |
Process for machine pre-crimping of stents, especially drug-coated stents
A process for arranging a stent, especially a drug-coated stent, on a balloon of a balloon catheter. At a stent implantation site (e.g., during an angioplasty procedure), the balloon of the balloon catheter serves to expand the stent radially, so that the stent, e.g., opens a vascular stenosis and is securely fixed to the vessel wall. Pressure plates are arranged and operate to maintain a protection device that avoids contamination of the stent. |
US11707367B2 |
Method for configuring a myoelectrically controlled prosthesis system and prosthesis system
A method for configuring a myoelectrically controlled prosthetic system with a prosthesis socket and several lead electrodes for recording electric muscle activities, featuring the steps: placement of a surface electrode arrangement comprising several surface electrodes around the circumference of a residual limb, recording of electric muscle activity in muscles of the residual limb as electromyograhic signals, the activity being recorded by the surface electrodes, evaluation of the myoelectric signals with regards to the distinctness of the signals, selection of the control procedure that is to be used to control the prosthesis system, based on the evaluation of the distinctness of the signals, and fixing of the lead electrodes to the prosthesis socket. |
US11707365B2 |
Magnetic locking mechanism for prosthetic or orthotic joints
A magnetic locking actuator for a prosthetic or orthotic device is provided. The actuator includes a first component including one or more magnets and a second component including one or more magnets. The first and second components are coupled to separate portions of the device. The magnets allow for adjustment of a length of the actuator to adjust an angular orientation of the first and second portions of the device. When magnets in the second component are aligned with magnets in the first component having an opposite polarity, a position of the second component is fixed relative to the first component, locking the actuator. When magnets in the second component are not aligned with magnets in the first component having the opposite polarity, the position of the second component is adjustable relative to the first component, thereby allowing adjustment of the height of the actuator. |
US11707362B2 |
Surgical targeting device
Disclosed is a surgical targeting device for assisting placement of an elongated guidance member in a bone. The targeting device comprises a bottom portion having a dome-shaped convex outer surface and comprising a guidance through-hole extending along a guidance through-hole central axis for receiving the guidance member. A top portion of the targeting device is configured to be gripped by a tool. Further, a surgical system is disclosed which comprises the surgical targeting device. |
US11707359B2 |
Expandable intervertebral implant
An expandable intervertebral implant is provided for insertion into an intervertebral space defined by adjacent vertebrae. The expandable intervertebral implant includes a pair of outer sleeve portions and an inner core disposed between the outer sleeve portions. Movement of the inner core relative to the outer sleeve portions causes the outers sleeve portions to deflect away from each other, thereby engaging the expandable intervertebral implant with the vertebrae and adjusting the height of the intervertebral space. |
US11707353B2 |
Systems for knotless tissue repair
Systems and methods for knotless tissue repair employ a first suture construct routed through a tissue in a first inverted mattress stitch, including a loop portion and two free limbs. The loop portion of the first suture construct so routed is positioned adjacent to a superior surface of the tissue and the free limbs of the first suture construct so routed extend through an inferior surface of the tissue. A second suture construct, separate from the first suture construct, is inserted within the loop portion of the first suture construct such that two free limbs of the second suture construct extend from the loop portion of the first suture construct. The second suture construct comprises a plurality of braided filaments and possesses a substantially rectangular cross-sectional profile, and does not include a suture core surrounded by the braided filaments. |
US11707352B2 |
Locking kit for implantable artificial organ
The invention relates to a chamber (100) for encapsulating secreting cells producing at least one substance of interest, the chamber comprising: —an upper washer (120) and a bottom washer (110) configured to be oppositely placed on a side and on another side of two semi-permeable membranes (141, 142), —optionally at least one intermediate washer (130), provided between both membranes, in a plane sensibly parallel to upper and bottom washers planes and delimiting two superposed half cells spaces (S1, S2) capable of containing the secreting cells producing the at least one substance of interest, —optionally sealing means (150) the upper and the bottom washers (120, 110) being tightly clipped together, incorporating the intermediate washer (130) therebetween. |
US11707350B2 |
Stertile packaging container
The present disclosure in one aspect provides a sterile packaging container comprising a container body with a cross-sectional shape that is constant along the majority of the longitudinal axis, a cover and a closure assembly that inhibits the passage of microbial contaminants. The container is configured such that the interior of the container can be sterilized. The sterile packaging container described herein allows one to manufacture a sterile packaging tube exercising the smallest possible volume. |
US11707348B2 |
Surgical instrument for deploying a prosthesis
The present invention relates to a surgical instrument (1) for deploying a prosthesis (200) and includes a first layer and second layer assembled together so as to define an internal space accessible to said surgical instrument (1) by means of an opening provided in said first layer, said surgical instrument including at least one sheet (2) made of a flexible resilient material, said sheet continuously overlapping itself one or more times so as to define a plurality of levels forming a spiral (3). The invention also relates to a kit including such a surgical instrument and such a prosthesis. |
US11707347B2 |
Detecting tooth shade
Disclosed in a method, a user interface and a system for use in determining shade of a patient's tooth, wherein a digital 3D representation including shape data and texture data for the tooth is obtained. A tooth shade value for at least one point on the tooth is determined based on the texture data of the corresponding point of the digital 3D representation and on known texture values of one or more reference tooth shade values. |
US11707346B2 |
Dental mill blank and method for producing same
The present invention provides a dental mill blank that exhibits desirable resistance against wear in opposing teeth. The present invention relates to a dental mill blank comprising: an inorganic filler containing an inorganic filler (A) and an inorganic filler (B); and a polymer, the inorganic filler (A) partly forming an aggregate, and the dental mill blank satisfying the following formulae (I) to (III), 0.001≤a<0.32 (I) 0.3≤b≤10 (II) 5≤x≤80 (III), where a is an average primary particle diameter of the inorganic filler (A) in micrometers, b is an average primary particle diameter of the inorganic filler (B) in micrometers, and x is an average particle diameter of the aggregate in micrometers. Preferably, the dental mill blank comprises an island component containing the aggregate, and a sea component containing the inorganic filler (A) and the inorganic filler (B). |
US11707345B2 |
Dental implant
A dental implant that facilitate insertion and can be used in all bone types. The implant includes a body having a coronal end, and an apical end opposite the coronal end. A tapered region may be adjacent the apical end. On the apical part one or more taps are provided so the tap is cutting when rotating clockwise and counter-clockwise. The implant can have at least one variable profile helical thread that extends along the tapered region. The implant can have also micro-threads below the main threads, a gradual compressing tapered core, a self drilling apical end and a narrow coronal region. |
US11707344B2 |
Segmentation quality assessment
Methods and systems for improving segmentation of a digital model of a patient's dentition into component teeth. |
US11707342B2 |
Identification system for medical devices
A system and method of use thereof are disclosed, the system including a treatment source, such as an electrosurgical generator and a plurality of treatment devices operable to be coupled to the treatment source, one or more of the treatment devices being associated with one or more device identifiers which can be, for example, physically present on the device or contained in device software. |
US11707340B2 |
Image processing device, image processing method, and surgical navigation system
Provided is an image processing device including a matching unit that performs matching processing between a predetermined pattern on a surface of a 3D model of a biological tissue including an operating site generated on the basis of a preoperative diagnosis image and a predetermined pattern on a surface of the biological tissue included in a captured image during surgery, a shift amount estimation unit that estimates an amount of deformation from a preoperative state of the biological tissue on the basis of a result of the matching processing and information regarding a three-dimensional position of a photographing region which is a region photographed during surgery on the surface of the biological tissue, and a 3D model update unit that updates the 3D model generated before surgery on the basis of the estimated amount of deformation of the biological tissue. |
US11707339B2 |
Distance indication for invasive microsurgical instruments
A microsurgical instrument having one or more distance indication members is provided. In a particular embodiment, the microsurgical instrument comprises a microsurgical tool and a first distance indication member coupled to, and extending beyond a distal end of, the microsurgical tool. A distal portion of the first distance indication member may be configured to deflect when in contact with a tissue surface, without causing damage to the tissue surface, to give a visual indication that the distal end of the microsurgical tool is in proximity to the tissue surface. The distal portion of the distance indication member can be further configured to return to a non-deflected configuration when no longer in contact with the tissue surface. |
US11707338B2 |
Storage system including at least one container containing medical supplies
A storage system includes at least one cabinet, a plurality of shelves adjustably positioned within the at least one cabinet, and a plurality of scales removably attached to at least one of the shelves, each of the scales including a load sensor. The storage system also includes a plurality of holders, each of the holders being configured to hold at least one container containing medical supplies, and each of the holders being supported by a respective one of the scales. The storage system also includes a receiver in operative communication with each of the load sensors. Each of the load sensors is configured to continuously measure a weight of the medical supplies contained in the respective at least one container held by the respective holder, and to communicate each detected weight to the receiver. |
US11707337B2 |
System and method for maintaining a tool position and orientation
A system and method of maintaining a tool position and orientation for a computer-assisted device include a control unit and an articulated structure coupled to the control unit and including a plurality of joints. The articulated structure is configured to support an instrument. The control unit is configured to determine an error that is introduced to a position of the instrument, an orientation of the instrument, or both the position of the instrument and the orientation of the instrument by movement of a first joint of the plurality of joints; and drive at least a second joint of the plurality of joints to reduce the error. |
US11707331B2 |
Systems and methods for navigational bronchoscopy and selective drug delivery
Provided in accordance with the present disclosure is a diagnostic and a therapeutic bronchoscopy system for localized delivery of medication within the lungs. Specifically, systems and methods are disclosed for creating a functional and anatomical map of the lungs, diagnosing a condition within the lungs, generating a treatment plan for a target site within the lungs, navigating to the target site, administering a treatment directly to the target site for immediate absorption within the target site, and assessing the efficacy of the treatment. |
US11707330B2 |
Systems and methods for surgical navigation
Disclosed are systems, methods, and techniques for registering a HMD coordinate system of a head-mounted display (HMD) and a localizer coordinate system of a surgical navigation localizer. A camera of the HMD captures at least one image of a registration device having a registration coordinate system and a plurality of registration markers. The registration markers are analyzed in the at least one image to determine a pose of the HMD coordinate system relative to the registration coordinate system. One or more position sensors comprised in the localizer detect a plurality of tracking markers comprised in the registration device to determine a pose of the registration coordinate system relative to the localizer coordinate system. The HMD coordinate system and the localizer coordinate system are registered using the registration device, wherein positions of the registration markers are known with respect to positions of the tracking markers in the registration coordinate system. |
US11707324B2 |
Spinal correction rod implant manufacturing process part
A spinal correction rod implant manufacturing process includes: estimating a targeted spinal correction rod implant shape based on a patient specific spine shape correction and including spine 3D modeling, one or more simulation loops each including: first simulating an intermediate spinal correction rod implant shape from modeling mechanical interaction between the patient specific spine and: either, for the first simulation, the implant shape, or, for subsequent simulation, if any, an overbent implant shape resulting from the previous simulation loop, a second simulation of an implant shape overbending applied to the targeted spinal correction rod implant shape producing an overbent spinal correction rod implant shape representing a difference between: either, for the first loop, the targeted spinal correction rod implant shape, or, for subsequent loop, if any, the overbent spinal correction rod implant shape resulting from the previous simulation loop, and the intermediate spinal correction rod implant shape. |
US11707323B2 |
Electrical analyzer assembly for intravascular lithotripsy device
A catheter system for treating a treatment site within or adjacent to a vessel wall or a heart valve includes an energy source, a balloon, an energy guide, and an electrical analyzer assembly. The energy source generates energy. The balloon is positionable substantially adjacent to the treatment site. The balloon has a balloon wall that defines a balloon interior that receives a balloon fluid. The energy guide is configured to receive energy from the energy source and guide the energy into the balloon interior. The electrical analyzer assembly is configured to monitor a balloon condition during use of the catheter system. The electrical analyzer assembly can include a first electrode, a second electrode, and an impedance detector that is electrically coupled to the first electrode and the second electrode. The impedance detector is configured to detect impedance between the first electrode and the second electrode. |
US11707322B2 |
Radio frequency ablation systems
The present invention relates to systems for use for radio frequency ablation. The systems can include one or more of an ablation tool, power source for use with the ablation tool and a backstop for use in conjunction with the ablation tool during surgical procedures. Preferred ablation tools comprise a series of three or more blade-shaped electrodes disposed in a linear, curved, curvilinear or circular array. The backstops are useful for reducing direct physical and thermal heat transfer injuries to the patient or surgeon during procedures using radiofrequency (RF) ablation devices. |
US11707314B2 |
Ablation system with impedance navigation
Dual coil ablation systems are provided. Methods of using the systems to ablate tissue are also provided. The dual coil ablation systems can include a first guide needle and a second guide needle, and the methods can include securing the tissue and guiding the dual coil ablation system into the tissue for the ablation, the securing and the guiding facilitated by the first guide needle and the second guide needle. The dual coil ablation systems can also include a phase-offset between the coils to achieve a significant and surprising enhancement to the energy density provided by the systems, and the uniformity of ablation provided by the methods. |
US11707311B2 |
Bone fastener and driver with retaining features
A bone fastener driver assembly with a bone fastener retention feature has an outer sleeve, a handle fixed to said outer sleeve and an inner shaft. The inner shaft has a distal end with a torque driving tip. The inner shaft is coupled to the handle and axially movable relative to the outer sleeve from a proximal disengaged position to a distal engaged position. The outer sleeve has a bone fastener retaining distal end configured to lock into an internal groove or undercut of a bone fastener screw head when the inner shaft is axially moved from the proximal disengaged position to the distal engaged position to lock the bone fastener to the driver and upon a return movement of the inner shaft to the proximal disengaged position to unlock and release the driver from the bone fastener screw head. |
US11707310B1 |
Anchor apparatus
An anchor for anchoring tensile members to bone includes: a housing extending along a central axis, with a hollow interior; a collet in the hollow interior having a central bore for accepting tensile members and an exterior surface, the collet being configured to swage around and against tensile members; a sleeve having a peripheral wall defining interior and exterior surfaces, the sleeve disposed in the housing's hollow interior axially adjacent to the collet, and movable parallel to the central axis between first and second positions; and wherein at least one of the collet exterior surface and the sleeve interior surface is tapered and the sleeve and the collet are arranged so movement of the sleeve from the first position to the second position causes the sleeve interior surface to bear against the collet exterior surface, causing the collet to swage radially inwards around and against one or more tensile members. |
US11707308B2 |
Implant positioner and sternal plating system
Implant positioning devices for use with and assisting in positioning orthopaedic fixation devices (such as bone plates, etc.). An implant positioning device may include a body that has a fastener guide with slits in a first end of the fastener guide that form a retaining arm proximal to the first end of the fastener guide. The implant positioning device may also be coupled to a bone plate by a retaining beam positioned within the implant positioning device to facilitate ease of alignment and insertion of the fastener into a fastener apertures of the bone plate. |
US11707303B2 |
Multi-level vertebral implant system
A spinal implant system (10) includes a superior attachment rod (12) coupled to, and articulating with respect to, a roller housing (17), an inferior cross bar member (20) coupled to the roller housing (17), and an inferior attachment rod (14) coupled to the inferior cross bar member (20). At least one of the superior and inferior attachment rods (12, 14) is supported by a flexure assembly (16). The inferior attachment rod (14) is coupled to the inferior cross bar member (20) with a swivel joint (32) and/or a telescoping portion (20). |
US11707302B2 |
Interspinous spacers and associated methods of use and manufacture
Systems, devices, and methods for treating the spine are disclosed herein. Medical devices can be positioned along a subject's spine to treat various conditions and diseases. The medical device can include an actuator assembly and a clamp assembly. The actuator assembly can be positioned at an interspinous space between a superior spinous process and an inferior spinous process. The actuator assembly can be used to reconfigure the clamp assembly such that the clamp assembly clamps onto the superior and inferior spinous processes. |
US11707301B2 |
Threaded closure for bone anchor receivers with parallel planar outer surfaces and methods of use
A method for securing an elongate rod to a bone anchor with a receiver and a threaded plug. The receiver includes a channel configured to receive the elongate rod, and a helically wound receiver guide and advancement structure formed into the interior surfaces of the receiver. The threaded plug is configured for positioning within the channel to secure the elongate rod to the receiver in a locked configuration, with the threaded plug having an outer surface with a mating continuous helically wound guide and advancement structure configured for rotatable engagement with the receiver guide and advancement structure. |
US11707300B2 |
Bone screw threaded enlarger
A bone fastener system can comprise a fastener and a first sizing component. The fastener can comprise a shaft that provides an anchoring footprint. The first sizing component can be configured to be connected to the shaft and can include a first anchoring feature, or circumferential bone engaging feature, to increase a size of the anchoring footprint. The first anchoring feature can comprise a sleeve that radially expands a diameter of the threaded shaft. The first anchoring feature can comprise axially extending teeth. The system can further comprise a second sizing component including a second anchoring feature to increase the size of the anchoring footprint, the second anchoring feature being different from the first anchoring feature. The second anchoring feature can expand the diameter of the threaded shaft a greater amount than the first anchoring feature. The second anchoring feature can have a length greater than the first anchoring feature. |
US11707298B2 |
Dynamic spinal stabilization assembly with elastic bumpers and locking limited travel closure mechanisms
A dynamic stabilization assembly includes a core, typically in the form of a tensioned cord, at least one pair of bone anchors, a spacer surrounding the core located between the bone anchors, at least one elastic bumper and at least one fixing or blocking member. The core is slidable with respect to at least one of the bone anchors, the spacer and the bumper. The bumper is compressed. Bone screws of the assembly include closure structures that lock against the bone screw independent of any fixing or sliding of the core with respect to the bone screw. |
US11707295B2 |
Medical instrument and associated method
A medical instrument includes a handle, a trocar in communication with the handle, and a cannula in communication with the trocar and the handle. The cannula is engaged (locked) with the handle when linearly displaced proximally towards the handle and, the cannula is disengaged (unlocked) from the handle when linearly displaced distally away from the handle. The cannula is linearly reciprocated, between the locked position and the unlocked position, along a linear travel path defined parallel to a longitudinal axis of the trocar such that the cannula is prohibited and permitted to articulate about the longitudinal axis of the trocar, and relative to the handle, respectively. Advantageously, the cannula is locked and unlocked from the trocar by without requiring an external force exerted generally transverse to trocar and/or cannula—thereby permitting a user to lock/unlock the cannula, relative to the trocar, with one hand. |
US11707291B2 |
Devices and methods for treating epistaxis
The present disclosure relates to devices and methods for treating epistaxis. In some embodiments, a device for occluding epistaxis includes a first curvilinear wall, a second curvilinear wall, and a third curvilinear wall each disposed at a top portion of the device. The device has an x-axis, y-axis, and z-axis, and the top portion is relative to the y-axis. The device includes a fourth wall and a fifth wall each disposed at a bottom portion relative to the y-axis of the device. The fourth wall and the fifth wall independently are substantially straight or curvilinear. The device includes a first end including a front first end portion and a back first end portion. The first end is curvilinear corresponding to the first curvilinear wall, and the first end is disposed at an angle relative to the x-axis. |
US11707287B2 |
Disposable guide device for spinal surgery
A disposable guide device for spinal surgery comprises two tubular guide bodies extending along respective main axes between a proximal end and a distal end to guide a surgical operation on a vertebra of a patient, a plurality of support feet projecting laterally relative to each guide body, near said proximal end, each defining a contact area configured to abut on a side of the spinous process or on a lamina or facet or transverse process of the vertebra of the patient, in a mating configuration, at least one junction element extending between the guide bodies, starting from the respective distal ends, in order to space them from each other, wherein the guide bodies are oriented so that the proximal ends are more distant from each other with respect to the distal ends. |
US11707283B2 |
Detection and treatment of abnormal upper esophageal sphincter functionality
An esophageal device is used to recognize, diagnose, characterize, or relieve an impact of an abnormal or defective UES anatomy, physiology, or functionality. In one implementation, the esophageal device measures a UES response to esophageal fluid infusion to detect or characterize an abnormality or defective UES anatomy, physiology, or functionality. An Upper Esophageal Sphincter compression device is used to increase intra-luminal pressure within the Upper Esophageal Sphincter of a patient in order relieve an impact of an abnormal or defective UES anatomy, physiology, or functionality. |
US11707282B2 |
Multi-piece ligation clip
Polymeric ligation clips and a clip applier for applying a polymeric ligation clip to tissue are disclosed herein. More particularly, the polymeric ligation clips include separate first and second beams that can be coupled to each other and are movable from a reduced diameter open position in which minimal strain is placed on the ligation clip to a clamped position and to a clip applier for delivering such a ligation clip to a surgical site. |
US11707278B2 |
Surgical stapler tool assembly to minimize bleeding
A cartridge assembly for a surgical stapling device includes a staple cartridge that includes a staple array that has a configuration to minimize blood leakage through a staple line formed by the staple cartridge. |
US11707274B2 |
Articulating mechanism for surgical instrument
A surgical instrument, such as a surgical fastener applying apparatus, includes a tool assembly, an endoscopic body portion, and an articulation mechanism. The articulation mechanism articulates the tool assembly in relation to the endoscopic body portion over large arc segments while providing simple operating components. Thus, the range of operation of the surgical instrument and the types of surgical activities that can be performed by the surgeon can be expanded without at the same time requiring complex operating components. |
US11707270B1 |
Arthroscopic tool for labrum repair procedure and a method for use thereof
An arthroscopic tool for labrum repair procedure, including: a cannulated working channel having a proximal end and a distal end; and a holding element adapted to be attached to the proximal end of the working channel for supporting a labrum during an arthroscopic labrum repair procedure. |
US11707268B2 |
Tissue retractors
A surgical retractor for retracting body tissue in a therapeutic procedure includes a blade having a body portion and a plurality of elongate elements extending from the body portion. The plurality of elongate elements is separated a distance from one another along a length of the body portion and form one or more gaps therebetween. The plurality of elongate elements is connected by one or more cross connectors transverse to the plurality of elongate elements. The retractor blade is configured to permit movement of a lung being retracted. |
US11707267B2 |
Individual packaging arrangement for orthopedic tools
A protective member for a medical instrument includes a body portion having an inner side wall defining an interior, configured to receive at least a portion of the medical instrument. The body portion also includes a first end and a second end, wherein at least one of the first end and the second end is configured to at least partially close the respective first end and/or second end of the body portion. The at least partially closed first end and/or second end is configured to be opened for use of the medical instrument, such that the medical instrument can pass through both the first and second ends of the body portion during use, while the inner side wall surrounds a portion of the medical instrument. The body portion is configured for use during a medical procedure using the medical instrument, for example, as a tissue protector or a drilling guide. |
US11707262B2 |
Systems and methods for real-time sweat sampling and analysis
Systems and methods for continuous real-time sweat sampling and analysis are disclosed. In one case, a sweat collection device and method of using the same are provided. The sweat collecting device has a main body with a sweat-collecting surface that is placed adjacent the person's skin. A sweat collecting tube is provided. The first end of the sweat collecting tube is joined to a bore in the main body of the device and the second end extends outward therefrom. In another case, a sweat collection article and method of collecting sweat from a person's skin using the sweat collection article are provided. The sweat collection article includes: a sweat collecting tube placed adjacent to the person's skin, and at least one piece of flexible material that has an adhesive that adheres the article to the person's skin and is positioned to overlie one end of the tube. In both cases, the second end of the sweat collecting tube is in fluid communication with an instrument such as a mass spectrometer that analyzes the sweat on a real-time basis. The systems and methods may further include a device for removing salt from the sweat that is arranged so that the sweat is transported to the device prior to being transported to the instrument for analyzing the sweat. |
US11707261B2 |
Ultrasound probe enabled for ultrasound reception operation of at least two modes
A two-dimensional array ultrasound probe, which is enabled for ultrasonic reception operation of a continuous wave Doppler mode (C mode) and an imaging mode (B mode). The probe includes a reception circuit provided for each transducer and a first multiplexer; a plurality of first wires connected to the first multiplexer; a second wire connected to a plurality of first wires outside the array; switches that are provided to the second wire and that can be turned off to adapt to phasing addition units; a plurality of second multiplexers connected to the second wire and a plurality of first output ports for the first mode; and a plurality of second output ports that are connected to each region between the switches on the second wire and that are used in the second mode. |
US11707259B2 |
Wireless needle guidance using encoder sensor and encoder scale to achieve positional sensing between movable components
One or more devices, systems, methods and storage mediums for performing medical procedure (e.g., needle guidance, ablation, biopsy, etc.) planning and/or performance, and/or for performing guidance of multiple probes or multiple needles, are provided. Examples of applications for such devices, systems, methods and storage mediums include imaging, evaluating and diagnosing biological objects, such as, but not limited to, lesions and tumors, and such devices, systems, methods and storage mediums may be used for radiotherapy applications (e.g., to determine whether to place seed(s) for radiotherapy). Even in instances where communication between a medical tool or needle guidance device and a system is wireless or wired, preferably guidance information is still gathered and transmitted, especially in instances where wireless or wired communication signals are intermittent or interrupted. |
US11707258B2 |
Device and method for intravascular imaging and sensing
An intravascular sensor device can be used to guide treatment of a diseased blood vessel in the body of a patient. In some examples, the intravascular sensor device includes a pressure sensor and an ultrasound transducer. The intravascular sensor device is used to measure a pressure within the diseased blood vessel and acquire an ultrasound image of the diseased blood vessel. The pressure may be measured during hyperemic blood flow that is caused by a pharmacologic vasodilator drug. The measured pressure can be used to calculate a fractional flow reserve value. The ultrasound image can be used to determine a physical dimension of the blood vessel, such as cross-sectional area. The fractional flow reserve value and physical dimensions of the blood vessel can be used to optimize patient treatment. |
US11707257B2 |
Ultrasonic probe and probe head for ultrasonic probe
The ultrasonic probe according to a present embodiment includes a piezoelectric vibrator and an acoustic lens. The piezoelectric vibrator is configured to transmit and receive an ultrasonic wave. The acoustic lens is provided on an ultrasonic-wave transmission/reception side. The acoustic lens is formed in such a manner that a surface shape of each of end regions located on both sides of a central region of a surface of the acoustic lens is formed to have a curvature different from a curvature of a surface shape of the central region of the surface of the acoustic lens. |
US11707256B2 |
System and method for tracking completeness of co-registered medical image data
A system and method for tracking completeness of co-registered medical image data is disclosed herein. The system and method tracks the position of an anatomical reference marker positionable on a patient and an ultrasound probe during an imaging session and co-registers medical images based on positional data received from the anatomical reference marker and the ultrasound probe. Using the co-registered image data, the system and method generates a surface contour of a region of interest (ROI) of the patient, such as a breast. The surface contour is defined to represent an interface between a chest wall structure and tissue of the ROI in a plurality of co-registered medical images. A completeness map of the image data within the defined surface contour during the imaging session is generated and overlaid on a graphic representation of the ROI. |
US11707253B2 |
Monitoring apparatus for monitoring an ablation procedure
The present invention relates to a monitoring apparatus for monitoring an ablation procedure. The monitoring apparatus comprises an ultrasound signal providing unit for providing an ultrasound signal that depends on received echo series of an object that is ablated. The monitoring apparatus further comprises an ablation depth determination unit for determining an ablation depth from the provided ultrasound signal. The ablation depth can be determined directly from the ultrasound signal and is an important parameter while performing an ablation procedure. For example, it can be used for determining the progress of ablation within the object and for determining when the ablation has reached a desired progression. |
US11707246B2 |
Method and apparatus for automatic determination of object and background region of interest for real-time automatic dose rate control in dynamic imaging systems
A method of imaging includes obtaining a first image including projection data representing an intensity of X-rays detected by a plurality of detectors at a first X-ray exposure setting, the X-rays being emitted from an X-ray source; based on a detection result of a first object in the first image: determining a background region of interest (ROI) around the first object, the background ROI including background ROI pixels having a first intensity value corresponding to the intensity of the X-rays; and converting, for each pixel of the background ROI pixels, the first intensity values of the background ROI pixels to a normalized X-ray attenuation factor; and determining a second X-ray exposure setting for use in obtaining a second image based on the background ROI pixels converted to the normalized X-ray attenuation factor. |
US11707245B2 |
Quantification of an influence of scattered radiation in a tomographic analysis
Systems and methods for quantification of an influence of scattered radiation in the analysis of an object a projection image is provided. Based on the projection image and on a characteristic of a tomography facility and/or of the object relating to the influence of the scattered radiation, at least one intermediate image is created. The at least one intermediate image is analyzed using an artificial neural network to quantify the influence of the scattered radiation. |
US11707244B2 |
Techniques for breast imaging patient motion artifact compensation
An imaging system may include an imaging detector to capture an image of human tissue and a compression paddle situated apart from the imaging detector to compress the human tissue between the compression paddle and the imaging detector. A force sensor may generate a force signal indicating a measure of force applied superior to the human tissue. A movement detection circuit may filter a movement signal from the force signal indicating a measure of movement of the compressed human tissue. A movement analysis module may determine that the movement signal is beyond a movement threshold. An image correction module to perform a corrective action based upon the determination that the movement signal is beyond a movement threshold. |
US11707243B2 |
Scatter and random coincidence rejection
Multiple interactions, such as Compton scattering, inside a PET detector are used to predict an incident photon's direction for identifying true coincidence events versus scatter/random coincidence events by creating a cone shaped shell projection defining a range of possible flight directions for the incident photon. The disclosed techniques can be used as prior information to improve the image reconstruction process. The disclosed techniques can be implemented in a LYSO/SiPM-based layer stacked detector, which can precisely register multiple interactions' 3D position. |
US11707240B2 |
Visualization method and apparatus
An inverse visualization of a time-resolved angiographic image data set of a vascular system of a patient that was recorded by a medical imager during the flow of a contrast medium through the vascular system is provided. The time-resolved angiographic image data set of the vascular system has a temporal sequence of frames of the vascular system corresponding to the contrast medium filling process. A data set from bolus arrival times for each pixel or voxel is determined. The bolus arrival time corresponds to the time in the temporal sequence at which a predetermined contrast enhancement due to the contrast medium filling first occurs. A data set of temporally inverted bolus arrival times with respect to the contrast medium filling is determined for each pixel or voxel, resulting in a temporally inverted sequence of frames with respect to the contrast medium filling. The time-resolved angiographic image data set in the temporally inverted sequence is visualized. |
US11707238B2 |
Dental panoramic views
Provided herein are devices and methods generating a panoramic rendering of a subject's teeth. Methods and processes are provided to image the subject's teeth with a dental scan. Methods and processes are also provided to automatically 3D render the subject's teeth with the scan images. Methods and apparatuses are also provided to generate simulated panoramic views of the subject's dentition from various perspectives. |
US11707237B2 |
System and method for measuring radiotracer bolus morphology for quantitative analysis
A computer-implemented method for determining a flow rate for a given vessel includes obtaining, via a processor, dynamic three-dimensional (3D) images of a subject utilizing nuclear medicine imaging. The method also includes obtaining, via the processor, injection parameters for a radiotracer bolus injected into the subject via an automated injector. The method further includes generating, via the processor, time activity curves (TACs) for the radiotracer bolus from the 3D images. The method even further includes estimating, via the processor, the flow rate for the given vessel based on a morphology of the one or more TACs and the injection parameters. |
US11707236B2 |
Monitoring a respiratory curve
A method is provided for monitoring a current respiratory curve of a patient with regard to a recording region which is imaged by magnetic resonance scanning. The method includes acquiring a reference respiratory curve of the patient over a plurality of respiratory cycles; establishing a respiration state of the patient that is suitable for the magnetic resonance scanning based on the reference respiratory curve; determining at least one reference recording time window and a trigger threshold value for starting a magnetic resonance scan based on the previously determined respiration state; carrying out at least one magnetic resonance scan within the determined reference recording time window of the current respiratory curve using the trigger threshold value; and continually acquiring and monitoring the current respiratory curve during the magnetic resonance scan in the reference recording time window. |
US11707233B1 |
Simultaneous sub-Nyquist acquisition of a plurality of bioelectric signals
Methods and systems for simultaneous sub-Nyquist measurement of a plurality of bioelectric signals are disclosed. A system includes measurement and reference electrodes configured to measure a first and a second bioelectric signal simultaneously. The first signal is within a first frequency band, the second signal is within a second frequency band, the second band is higher than the first band, and the first and second bands are separated by a frequency gap. The system also includes a filter for attenuating in the frequency gap and a sampler configured to sample, by conducting a sampling at a sampling frequency, the first and second bioelectric signals as measured simultaneously by the measurement and reference electrodes. The sampling frequency is lower than the Nyquist frequency for the second signal. An alias of the second signal caused by the sampling is in the frequency gap. The alias does not overlap the first band. |
US11707225B2 |
Bio-sensing based monitoring of health
In one embodiment, a health-monitoring system may access a waist-hip measurement of a user. The system may determine one or more stress-related parameters of the user using one or more computing devices. The system may determine one or more correlations between the waist-hip measurement and the one or more stress-related parameters of the user. The system may provide feedback to the user based on one or more of the one or more stress-related parameters or the determined correlations between the waist-hip measurement and the one or more stress-related parameters. |
US11707220B2 |
Systems and methods for assessing sympathetic nervous system tone for renal neuromodulation therapy
Systems and methods for assessing sympathetic nervous system (SNS) tone for renal neuromodulation therapy are disclosed herein. A system configured in accordance with embodiments of the present technology can include, for example, a detector attached to or implanted in a patient and a receiver communicatively coupled to the detector. The detector can measure cardiac data and the receiver and/or a device communicatively coupled thereto can analyze the cardiac data to provide one or more SNS tone indicators. The SNS tone indicators can be used to determine whether a patient will be responsive to a neuromodulation therapy and/or whether a neuromodulation therapy was effective. |
US11707218B2 |
Miniature ECG data acquisition device
An apparatus for generating ECG recordings and a method for using the same are disclosed. The apparatus includes a handheld device having four electrodes on an outer surface thereof, the handheld device having an extended configuration and a storage configuration. The apparatus also includes a controller configured to measure signals between the electrodes to provide signals that are used to generate an ECG recording selected from the group consisting of standard lead traces and precordial traces. When the handheld device is in the extended configuration and the first and second electrodes contact a first hand of a patient such that the first and second electrodes contact different locations on the first hand, the third electrode is in contact with a location on the patient's other hand and the fourth electrode contacts a point on the patient's body that depends on the particular trace being measured. |
US11707216B2 |
Recommendations based on biometric feedback from wearable device
Methods and architecture for using sensor data to offer content, such as purchase or viewing suggestions, to a viewer, are disclosed. Wearable or other external sensor devices may monitor a viewer while the viewer consumes a first media element. The sensor data may then be used to determine an emotional response of the viewer to the media element or to entities found within that element, such as actors, scenes, brands, or objects. Emotional response data for a user may be stored, and may be used either immediately or at a later time to deliver content or make content or purchase suggestions to the viewer. |
US11707211B2 |
Implantable sensor driven by alignment key, implantable device comprising implantable sensor, and biometric data measurement system comprising implantable device
Disclosed are an implantable sensor driven by an alignment key, an implantable device comprising the implantable sensor, and a biometric data measurement system comprising the implantable device. The implantable device according to the present embodiment may comprise an implantable sensor forming a magnetic dipole moment in one direction from the inside to the outside of the body, and may be inserted into the body to measure biometric data by means of the implantable sensor. |
US11707210B2 |
Acoustically probed over-the-ear hearing assessment devices and methods
An over-the-ear hearing assessment device and a method for evaluating the performance of over-the-ear hearing devices are described. An exemplary over-the-ear hearing assessment device includes an ear cup defining an interior volume and positionable at least partially over the ear of a user. The ear cup includes a shell, a cushion, and an acoustic port extending from an exterior to the interior volume of the ear cup. The acoustic port is sealably engagable with a microphone. |
US11707209B2 |
Detecting method and positioning analysis method of human functional joint rotation center
A detecting method and a positioning analysis method of human functional joint rotation center are provided. The detecting method of human functional joint rotation center includes: step 11: in a continuous motion, a human functional joint rotation center FCR is abstracted as a center of a flexible ball; step 12: at any moment during a test, position coordinates of the center of the ball (i.e. FCR) at the moment are determined according to position coordinates of M1, M2 and M3, and then the motion trajectory of the FCR is obtained in the continuous motion; the positioning analysis method performs positioning analysis of joint positions based on morphological parameters collected by 3D scanning. The detecting method is based on an idea of flexible ball, its operation is simple within a certain error range, and the method performs very well in the continuity of trajectory of joint. |
US11707202B2 |
Apparatus for generating field-free region, apparatus and method for nano magnetic particle image
Disclosed herein is an apparatus for imaging nano magnetic particles using a 3D array of small magnets. A field-free region generation apparatus includes a hexahedral housing having an opening formed in the first surface thereof such that a measurement head is inserted into a spacing area, a pair of rectangular-shaped magnets installed respectively on two surfaces facing each other, among four surfaces perpendicular to the first surface of the housing, and a pair of magnet arrays installed respectively on the first surface of the housing and on another surface facing the first surface, each of the magnet arrays including multiple small magnets arranged along the edge of the opening. |
US11707201B2 |
Methods and systems for medical imaging based analysis of ejection fraction and fetal heart functions
Systems and methods are provided for enhanced heart medical imaging operations, particularly as by incorporating use of artificial intelligence (AI) based fetal heart functional analysis and/or real-time and automatic ejection fraction (EF) measurement and analysis. |
US11707200B2 |
Pressure measurement device, guide wire connector, guide wire, and method for manufacturing guide wire
A connector (140) is provided with a holding component (141), a support component (148), a terminal (144) electrically connected to a contact of a guide wire (130) held by the holding component (141), and a guide component (147) rotatable around an axial line (130A) of the guide wire (130) with respect to the support component (148). The holding component (141) is provided with a body (150) having an insertion hole (150a) for the guide wire (130) and a holding piece (151) extending along an axial line of the insertion hole (150a) from the body (150) and capable of being elastically deformed inward in a radial direction with respect to the axial line. The guide component (147) has a guide surface (165a) guiding the holding piece (151) inward in the radial direction. The holding component (141) is slid along the axis line of the insertion hole (150a) with respect to the guide component (147), whereby the holding piece abuts on the guide surface (165a) to be elastically deformed inward in the radial direction. |
US11707199B2 |
Measurement system with controlled pressure ramp
A measurement system and method of manufacture can include: a pressure resistant structure; a pressure inducer coupled to the pressure resistant structure, the pressure inducer having an engaged configuration, the engaged configuration of the pressure inducer increasing pressure exerted on a portion of a user in contact with the pressure resistant structure; a light source coupled to the pressure resistant structure; an optical sensor coupled to the pressure resistant structure and configured to detect a signal from the light source; a pressure sensor coupled to the pressure resistant structure, the pressure sensor configured to detect the pressure exerted on the portion of the user in contact with the pressure inducer; and a processor coupled to the optical sensor and the pressure sensor, the processor configured to correlate volumetric data from the optical sensor with pressure data from the pressure sensor and to provide a blood pressure measurement. |
US11707197B2 |
Apparatus, system, and method for physiological sensing in vehicles
Methods and apparatus provide physiological movement detection, such as gesture, breathing, cardiac and/or gross motion, such as with sound, radio frequency and/or infrared generation, by electronic devices such as vehicular processing devices. The electronic device in a vehicle may, for example, be any of an audio entertainment system, a vehicle navigation system, and a semi-autonomous or autonomous vehicle operations control system. One or more processors of the device, may detect physiological movement by controlling producing sensing signal(s) in a cabin of a vehicle housing the electronic device. The processor(s) control sensing, with a sensor, reflected signal(s) from the cabin. The processor(s) derive a physiological movement signal with the sensing signal and reflected signal and generate an output based on an evaluation of the derived physiological movement signal. The output may control operations or provide an input to any of the entertainment system, navigation system, and vehicle operations control system. |
US11707195B2 |
System, method, and computer readable medium for monitoring, tracking, and tracing temperature and humidity under garment
The invention relates to systems for temperature and humidity monitoring under garments and is characterized by that it contains at least one internal electronic module located under the garment and an external electronic module with sensors for temperature and humidity monitoring, storage devices connected to the electronic modules wirelessly (for example, via Bluetooth), and the receiving device, which provides the user with the possibility to monitor the current temperature and humidity of the observed object. |
US11707192B2 |
Eye-tracking using laser doppler interferometry
An eye-tracking device includes an optical device that includes a light source with an optical cavity and a light sensor. The light source is positioned to output coherent light toward an eye of a user and receive at least a portion of the coherent light back from the eye of the user as feedback light. The feedback light enters the optical cavity and causes modulation of an intensity of the coherent light. The light sensor is optically coupled with the light source for detecting the modulated intensity of the coherent light and generating one or more signals based on the detected intensity of the coherent light. The eye-tracking device also includes one or more processors that are coupled to the optical device for determining, from the one or more signals, movement information of the eye. A method of detecting movement of an eye using the eye-tracking device is also disclosed. |
US11707185B2 |
Side-scan infrared imaging devices
Infrared imaging devices are provided which are configured to implement side-scan infrared imaging for, e.g., medical applications. For example, an imaging device includes a ring-shaped detector element comprising a circular array of infrared detectors configured to detect thermal infrared radiation, and a focusing element configured to focus incident infrared radiation towards the circular array of infrared detectors. The imaging device can be an ingestible imaging device (e.g., swallowable camera) or the imaging device can be implemented as part of an endoscope device, for example. |
US11707180B2 |
Digital dental examination and documentation
Systems and methods are disclosed for processing and storing acquired data relating to one or more dental conditions. The methods can include acquiring a first oral feature in a first data acquisition using a data acquisition device, determining a first oral feature first reference point from the first data acquisition, diagnosing a first dental condition upon confirming that the first oral feature first reference point is associated with the first dental condition, acquiring the first oral feature in a second data acquisition using the data acquisition device, determining a first oral feature second reference point from the second data acquisition, and tracking the progression of the first dental condition by determining a discrepancy between the first oral feature first and second reference points. |
US11707179B2 |
Automatic probe reinsertion
In accordance with one embodiment, an automated probe system includes a probe configured to be reversibly inserted into a live body part, a robotic arm attached to the probe and configured to manipulate the probe, a first sensor configured to track movement of the probe during an insertion and a reinsertion of the probe in the live body part, a second sensor configured to track movement of the live body part, and a controller configured to calculate an insertion path of the probe in the live body part based on the tracked movement of the probe during the insertion, and calculate a reinsertion path of the probe based on the calculated insertion path while compensating for the tracked movement of the live body part, and send control commands to the robotic arm to reinsert the probe in the live body part according to the calculated reinsertion path. |
US11707178B2 |
Shoe cleaning apparatus and method
A shoe cleaning apparatus and method configured for cleaning a user's shoes while the user is wearing said shoes. A cleaning solution can be supplied by the shoe cleaning apparatus and operation of the shoe cleaning apparatus can agitate the surface of the shoe and the cleaning solution. The shoe cleaning apparatus can be provided as part of a decorative or storage unit, entry system, portable system, or built-in system. |
US11707177B2 |
Surface cleaning apparatus
A surface cleaning apparatus having an upright assembly, a power source, and a coiled electrical cable. The upright assembly including a frame and a telescoping handle at last partially extending from the frame and movable between an extended position and a contracted position. The coiled electrical cable being provided within a portion of the telescoping handle and configured to uncoil or coil when the telescoping handle is moved between the extended position and the contracted position. |
US11707174B2 |
Vacuum inlet valve assembly with sliding pins
A locking sleeve for connection with a valve box assembly of a central vacuum system includes, a first end adapted to couple to a wall of a valve box assembly, a second end opposite the first end, a central vertical axis between the first end and the second end, a first side adapted to be adjacent to a rear wall of a valve box assembly, a second side opposite the first side, a central horizontal axis between the first side and the second side, a slidable locking mechanism moveable in a sliding manner. The slidable locking mechanism is adapted to secure a vacuum hose assembly to the valve box assembly of the central vacuum system. |
US11707171B2 |
Hair cutting brushroll
A surface cleaning apparatus comprising a cleaning head and a brushroll. The cleaning head includes a cleaning head body having an agitator chamber including an opening on an underside of the cleaning head body. The brushroll is rotatably mounted to the cleaning head body such that a portion of the brushroll extends below the underside for directing debris into the opening. The brushroll includes an elongated body extending laterally between a first and second end region, a slit opening extending between the first and second end region, angular stationary teeth extending proximate to an edge of the slit opening, and a cutting blade configured to be at least partially received within the slit opening and to move laterally between the first and second end regions. The cutting blade bar includes teeth that are configured to engage with the stationary teeth to cut hair. |
US11707170B2 |
Surface cleaning apparatus having a brush motor internal of a rotating brush and brush motor for driving a rotatable brushing member
A surface cleaning apparatus is provided. The surface cleaning apparatus includes a dirt inlet, a rotatable brushing member, and a brush motor drivingly connected to the rotatable brushing member. The brush motor includes a plurality of field coils, a first motor sub-unit, a second motor sub-unit, and a motor controller. The first motor sub-unit includes a first rotor portion, a first stator portion, and a first field coil. The second motor sub-unit includes a second rotor portion, a second stator portion, and a second field coil. The first and second rotor portions are rotatable about a motor axis and are drivingly connected to the brushing member. The second motor sub-unit is axially spaced along the motor axis from the first motor sub-unit. The motor controller is operable to direct electric current through the plurality of field coils generating magnetic fields and driving rotation of the rotor portions. |
US11707167B2 |
Stick vacuum with indexing vacuum head assembly
Systems and methods for providing a vacuum cleaner with sliding vacuum head assembly. The vacuum head assembly comprises, for example, a vacuum motor, a dust bin, and a fan. The vacuum clean is configured for cleaning high and low surfaces based on a position of the vacuum head assembly along the vacuum tube. |
US11707155B2 |
Means for stirring contents of a pot through a covered lid
A stir-through lid providing a tortuous opening extending from or near the center of the stir-through lid circuitously extending until just inward of the periphery of the stir-through lid. The tortuous opening is substantially filled with bristles extending from both edges of the tortuous opening so that the distal ends of the bristles abut and/or interlock. The bristles are flexible, resilient, and biased in a radial, un-urged position so that when a utensil is introduced through the bristles, the bristles are self-minimizing as they biasedly engage the introduced utensil. Finally, the tortuous opening is dimensioned and adapted to enable the introduced utensil to reach the entirety of the bottom of the cookware the lid operatively associates with, including the corners thereof. |
US11707154B2 |
Programmable controlled intelligent cooking machine and feeding and cooking control method thereof
The present invention discloses a programmable controlled intelligent cooking machine which has an electrical control device and an automatic ingredient feeding device connected with the electrical control device; the automatic ingredient feeding device is adapted for receiving a standard package box with a plurality of compartments stocked with ingredients; the electrical control device is adapted for receiving preset recipe command and sending corresponding control command according to the recipe command; the automatic ingredient feeding device is adapted for providing major ingredients and accessory ingredients stocked in respective compartments of the standard package box according to a preset feeding sequence in the received corresponding control command; the combinations of feeding sequence for each Chinese dish can change. The present invention further discloses a feeding and cooking control method of a programmable controlled intelligent cooking machine. |
US11707151B2 |
Method and system to decouple steam pressure from temperature to control shear imparted on product flow
A cooking system for cooking a product flow utilizing steam. A supply of steam is provided at a supply pressure that is regulated by a control unit to a regulated pressure. The supply of steam is provided to a plurality of steam injection cookers which are positioned within a product supply pipeline that receives a product flow. The product flow is cooked as the product flow passes through the product supply pipeline and the plurality of cookers. Each of the steam injection cookers includes a steam modulator that controls the amount of steam injected. By regulating the steam pressure and the steam modulator, the control unit can modify the amount of shear created within the product flow and control the temperature of the fluid. The cooking system further includes a clean-in-place system that can inject a cleaning solution into the steam supply pipeline and the plurality of steam injection cookers. |
US11707148B2 |
Surface mountable storage assembly
A surface mountable storage assembly for storing and organizing purses and handbags includes a housing, which defines an interior space. The housing has a top, which is open, and a front, which has an aperture positioned therein. Contents, such as purses and handbags, can be inserted into the housing through the top. A panel is engaged to the housing and extends over the aperture. The panel is substantially transparent so that the contents of the housing are visible therethrough. A fastener engaged to a back of the housing engages a surface to mount the housing thereto. |
US11707146B2 |
Pineapple drinking vessel and related methods
A handle attachable to a cored-out pineapple is disclosed herein, resulting in a unique drinking vessel, particularly, as preparation of a tropical style drink. The solution provides for secure affixation as well as easy attachment and removal. Additionally, an efficient method for attaching a handle to a pineapple or other hollowed out fruit is also introduced herein. |
US11707143B2 |
Display system
A display includes a riser and a cap where articles, such as jewelry elements and their holders, can be placed. The riser has a riser base and a riser side and the cap includes a cap side and a cap platform, wherein the cap side is in at least one of sliding and removable engagement with the riser side. In an alternative embodiment, the riser has a riser guide coupled with the riser side or the riser base, and the display further includes a drawer. The drawer has a drawer top, a drawer side, a drawer side guide coupled with the drawer side, and a drawer top guide. The cap has a cap platform and, at least one of a groove in the cap platform and a cap platform wide coupled with the cap platform. The groove and/or the cap platform guide is in at least one of sliding and removable engagement with the drawer top guide. In yet another embodiment, the display further includes removable light fixtures having light emitting diodes. |
US11707141B2 |
Anti-theft pusher with incremental distance detection
A retail merchandise pusher is configured for sliding along a pusher assembly track. The pusher assembly is mountable to a retail merchandise shelf. The pusher includes a housing, a spring drum rotatably mounted within the housing, and a coil spring mounted to the spring drum. The coil spring is coilable and uncoilable upon rotation of the spring drum. A controller is coupled to a sensor arrangement within the housing. The sensor arrangement has a spring drum sensor for detecting rotation of the spring drum. A direction sensor detects a direction of rotation of the spring drum. An incremental distance sensor detects incremental movement of the pusher. The controller is configured to calculate, based on data from the sensor arrangement, a total distance and direction of travel by the pusher, and to generate an alarm when the pusher travels more than a threshold distance within a predetermined period of time. |
US11707140B1 |
Base unit for plastic playyard or barrier
A base unit includes first and fourth connectors that are obliquely positioned relative to each other such that a first connector of a first base unit is engagable to a fourth connector of a second base unit. The present base unit further includes second and third connectors that are obliquely positioned relative to each other such that a second connector of the first base unit is engagable to a third connector of the second base unit. A set of base units may form a self-standing playyard enclosure or one or more of the base units may be clamped by the jaws of a bracket that in turn is pivotably engaged to a wall mount. |
US11707138B1 |
Sofa armrest structure and sofa
A sofa armrest structure and a sofa are provided. A connection pipe is provided with a connection through hole. A first connection hole is formed in a first fixing frame and corresponds to the connection through hole. A second connection hole is formed in a second fixing frame and corresponds to the connection through hole, and an internal thread structure is formed in the second connection hole. One end of a connection rod is provided with a nut, and the other end of the connection rod is provided with an external thread structure. The end with the external thread structure of the connection rod passes through the connection through hole and the first connection hole and is connected to the internal thread structure in the second connection hole through the external thread structure. An inner chamber protection layer is detachably arranged on a fixing frame body through hook-and-loop fasteners. |
US11707130B2 |
Fluid-filled cleaning head
A cleaning head for a personal care appliance includes an elastic bladder having a bladder wall enclosing a fluid. The bladder wall has an inner base portion with a base thickness, which may be non-uniform, and a plurality of spaced projections extending outwardly from the inner base portion. The bladder is fixedly attached to a receiver portion of a bladder support, and a retainer is provided for attaching the bladder support to the personal care appliance such that the bladder support is drivably engaged by the personal care appliance. At least some of the plurality of spaced projections are configured to dynamically engage and disengage with neighboring ones of the plurality of spaced projections during use. |
US11707126B2 |
Cosmetic container
A cosmetic container includes a cosmetic container unit having a cosmetic storage space unit in which cosmetic storage space is formed; a ball-rolling support unit provided at one end of the cosmetic container unit to form a circular ring-shaped ball-rolling support concave groove; a massage ball holder which has a ball support hole surface unit having at least one ball support hole formed therein and is coupled to the cosmetic container unit such that the ball support hole is aligned to the ball-rolling support concave groove; and a massage ball installed to roll in a state in which a partial area thereof is exposed to the outside through the ball support hole and a part thereof is inserted in the ball-rolling support concave groove. |
US11707123B2 |
Stowable table
A stowable table mountable to a handle of luggage is disclosed. In an example, the stowable table includes a rigid or semi-rigid main panel, a pair of flap portions mounted to a first side of the main panel, and a first restraint system mounted to the first side of the main panel between the pair of flap portions to secure the main panel to a handle grip of the handle. Each flap portion has a folding axis relative to the main panel that is spaced apart from the folding axis of the other flap portion to define a region that accommodates the handle between the pair of flap portions. The stowable table further includes a second restraint system that tensions the pair of flap portions toward each other, and spans the distance between the pair of flap portions on each side of the region to surround the handle. |
US11707122B2 |
Retention device
Embodiments of a retention device are described. In an embodiment, the retention device includes a retention base having a stem protruding outwardly from a first surface of the retention base. Additionally, the retention device may include a retention closure configured to engage the retention base, the retention closure having a hole for receiving the stem. The retention device may also include a receiver coupled to the stem, the receiver configured to receive a retention member for retaining the retention closure in engagement with the retention base. |
US11707118B2 |
Elastic articulation for a watch assembly
An arrangement includes two components (3, 4; 3′, 4′) of a timepiece component and an axis of rotation (A1; A1′), the two components (3, 4; 3′, 4′) being linked to one another by an elastic articulated link (100; 100′) about the axis of rotation (A1; A1′), the arrangement also includes an elastic element (10, 10′; 10″) such that the relative movement of the two components (3, 4; 3′, 4′) takes place against the elastic element (10, 10′; 10″), wherein the elastic element (10, 10′; 10″) includes at least two superposed springs (10a, 10b, 10a′, 10b′; 10a″, 10b″), each of these at least two springs (10a, 10b, 10a′, 10b′; 10a″, 10b″) taking the form of a distinct element. |
US11707115B2 |
Automated footwear lacing systems, devices, and techniques
The specification discusses various lacing engine configurations for use in an automated footwear platform. For example, lacing engines with mechanisms to detect lace cable position and/or lace cable tensions are discussed. In an example, the lacing engine can include a housing, a lace spool and a detection mechanism. The lace spool can be at least partially disposed within the housing, and be adapted to collect a portion of the lace cable in response to rotation in a first direction during tightening of the footwear platform. The detection mechanism can detect a state of the lace cable manipulated by the lacing engine. |
US11707112B2 |
Footwear heel spring device
A device configured to surround a portion of a foot-receiving cavity at a heel region of an article of footwear comprises a control bar having a center segment, a first side arm extending from the center segment, and a second side arm spaced from the first side arm and extending from the center segment. The control bar may include a series of slats. A base supports the control bar and is connected to the first side arm and the second side arm. The control bar is biased to an unstressed position with the center segment a first distance from the base, and elastically bends under an applied force to a loaded position with the center segment a second distance from the base less than the first distance. The device stores potential energy that returns the control bar to the unloaded position upon removal of the applied load. |
US11707111B2 |
Footwear heel spring device
A device configured to surround a portion of a foot-receiving cavity at a heel region of an article of footwear comprises a control bar having a center segment, a first side arm extending from the center segment, and a second side arm spaced from the first side arm and extending from the center segment. The control bar may include a series of slats. A base supports the control bar and is connected to the first side arm and the second side arm. The control bar is biased to an unstressed position with the center segment a first distance from the base, and elastically bends under an applied force to a loaded position with the center segment a second distance from the base less than the first distance. The device stores potential energy that returns the control bar to the unloaded position upon removal of the applied load. |
US11707110B2 |
Fluid-filled chamber with a stabilization structure
A chamber may include a first barrier portion, a second barrier portion, a peripheral bond, an interior bond, and a fold. The first barrier portion defines a first surface of the chamber. The second barrier portion defines a second surface of the chamber, the first surface being opposite the second surface. The peripheral bond joins the first barrier portion and the second barrier portion to form an interior void within the chamber and seal a fluid within the interior void. The interior bond is spaced inward from the peripheral bond and joins the first barrier portion and the second barrier portion. Additionally, the fold is in the second barrier portion and extends away from the interior bond and through a majority of a thickness of the chamber. |
US11707107B2 |
Footwear having sensor system
A shoe has a sensor system operably connected to a communication port. Performance data is collected by the system and can be transferred for further use via the communication port. The shoe may contain an electronic module configured to gather data from the sensors. The module may also transmit the data to an external device for further processing. Users can use the collected data for a variety of different uses or applications. |
US11707106B2 |
Footwear with stabilizing sole
An article of footwear is provided and includes an upper and a sole secured to the upper and including a stabilizing member extending outwardly from the upper, where the stabilizing member includes a groove that separates the stabilizing member into a medial balancing member and a lateral balancing member so that the medial balancing member and the lateral balancing member move independently of each other to provide balance and stability on different terrains. The medial balancing member and a lateral balancing member also include a slot and a plate inserted into each slot. |
US11707104B1 |
Heat press apparatuses, systems, and methods
A heat press includes a handle portion and a curved heat plate. That handle portion may be configured to be grasped by a user, and the curved heat (i.e., having a curved engagement surface) may be configured to engage a heat-activated design implement to transfer a design of the heat-activated design implement to a curved surface of a workpiece. Also disclosed herein, according to various embodiments, is a heat press stand having a curved floor and a hat form for supporting a workpiece (e.g., a hat) during a heat-activated design transfer using the heat press. Associated methods are also disclosed herein. |
US11707102B2 |
Body protection devices, particularly protective helmets
Body protection devices, particularly protective helmets are provided, which comprise a shell of plastic material or of fiber-reinforced plastic material, wherein the shell comprises an outer coating layer formed of a polyacrylic or polyepoxide polymeric matrix including graphene fillers. Processes for the production of body protection devices are also provided. |
US11707098B2 |
Coupler for coupling to an article of wear
A coupler for coupling to a provided article of wear comprises a base plate and a clip. The coupler may be configured to provide a mount interface on an article of wear for an accessory to mount to. The base plate may comprise one or more structures configured to engage one or more respective portions of the clip over the provided article of wear. The clip may be shaped to interlock with the structures of the base plate. The clip may engage the base plate in a series of actions. The series of actions may be repeated in reverse to disengage the clip from the base plate. The series of actions for disengaging the clip from the base plate may reduce a likelihood of the clip in being unintentionally decoupled from the base plate, thereby increasing a likelihood that the coupler remains coupled to an article of wear. |
US11707096B2 |
JSW refillable dust mask
An invention to house a disposable dust mask or N95 mask in an independent comfortable and reusable face mask frame. |
US11707091B2 |
Atomizing nozzle and electronic atomizing inhaler
An atomizer of an electronic atomizing inhaler, includes a casing body, provided with a cap at the opening of the front end, with a gas-outlet aperture on the cap, and provided with a rear closure at the opening of the rear end, with a gas-inlet aperture on the rear closure; a liquid-container and a heater provided in the cavity formed by the casing body, the cap and the rear closure, an airflow-passage being provided between the casing body and the liquid-container; a liquid-guiding device closing the mouth part of the liquid-container, with no liquid-storage medium provided in the liquid-container; and a heater provided on the top of the rear closure, contacting the lower surface of the liquid-guiding device. An electronic atomizing inhaler is also provided. |
US11707090B2 |
Permeable element based vaporization process and device
The present invention discloses an atomizer. The atomizer includes a concentrate reservoir volume that is in fluid communication with a concentrate vaporization assembly. The concentrate vaporization assembly includes a frit adapted to absorb concentrate from the concentrate reservoir volume. The concentrate vaporization assembly further includes a heating element adapted to heat the frit and absorbed concentrate. The atomizer further includes a vapor collection and discharge assembly including a vapor accumulation chamber in fluid communication with the frit and a vapor evacuation channel in fluid communication with the vapor accumulation chamber and in fluid communication with an egress port. The heating element is activated by a user control of a switch on a battery, which causes the concentrate contained within the frit filter to vaporize, and the user inhales resulting vapor by inhaling at the egress port of the vapor evacuation channel. |
US11707086B2 |
Washing device and system for smoking devices
A washing device and system is herein disclosed. The washing device includes a washing tub, a shaking system, a plate bracket, a first plate, a second plate, and a controller. The shaking system is mounted at a lower end of the washing tub. The plate bracket is mounted on the shaking system. The first plate defines a first set of holes and is movably mounted to a first side of the plate bracket. The second plate defines a second set of holes and is movably mounted to a second side of the plate bracket. The controller is operable to selectively activate and control the shaking system. In use, the first plate and the second plate support a smoking device therebetween, with cleaning fluid being agitated via the shaking system to clean the smoking device. |
US11707081B2 |
Food orientor
A method of automatically orienting symmetric and asymmetric food items, such as apples for example, is provided. Individual items of food are manipulated by a programmable manipulator within the view of one or more depth imaging cameras. Digital three dimensional characterizations of the surface of the food items are generated by the depth imaging camera or cameras and are utilized by a computer connected to the depth imaging camera or cameras to locate the stem and blossom of each food item. Asymmetric food items, such as apples with dropped shoulders as well as symmetric food items can be properly oriented and processed automatically. |
US11707079B2 |
Process for manufacturing an infant formula product with hydrolysed protein
The present invention concerns a process for manufacturing an infant formula product comprising: (a1) providing an aqueous mixture having a protein component and a carbohydrate component, (a2) subjecting the aqueous mixture to a protein hydrolysis step, (a3) subjecting the aqueous mixture to a heat treatment step; (b) mixing the heat-treated aqueous mixture comprising hydrolyzed protein with a lipid component; (c) subjecting the aqueous mixture comprising the lipid component, the carbohydrate component and the heat-treated hydrolyzed protein component to a homogenization and emulsification step to obtain a homogenized oil-in-water emulsion having a total solids content in the range of 45-80 wt %; (d) conveying the homogenized emulsion into an extruder, independently adding digestible carbohydrates and optionally dietary fibres to the extruder and extruding the contents of the extruder to obtain an extruded material; (e) preparing an infant formula product from the extruded material. The invention further concerns Infant formula product obtainable by the process according to the invention and to a modular system suitable for performing the process according to the invention. |
US11707072B2 |
Food products and systems and methods of making same
Food products and systems and methods for their production involve microfiltration (“MF”) of fluid skim to form a MF retentate, combining the MF retentate with cream and subjecting the combination to ultrafiltration (“UF”) to form a UF retentate. Prior to UF, the composition is formed of non-acidified components. Following UF, the UF retentate is acidified and forms a food product including a high solids content. The solids content may be further increased using evaporation. The resulting cheese or cheese base contains a lower whey protein ratio in a fat:casein:whey protein ratio compared to systems and methods that do not employ MF. |
US11707067B2 |
Hair grooming implement cleaning solution with stabilizer
A new composition and method for cleaning hair grooming implements is provided. The composition comprises about 1.1% Sodium Hypochlorite, about 2.5% Sodium Hydroxide, about 0.5% Lithium Perchlorate and about 95.9% water. A concentrated version of the solution may be formed and later diluted for use. The addition of surfactant to the solution increases stability and efficiency. |
US11707066B2 |
Disinfection formulation and disinfection method
An anticoccidial disinfection formulation containing a compound represented by general formula (I) below as an active ingredient: R1—N═C═S (I) [In formula (I), R1 represents an alkenyl group having 2 to 8 carbon atoms or the like] This compound has a high sporulation inhibitory activity against coccidian oocysts and is thus effective for eradicating coccidians and for disinfecting rearing facilities and rooms of host animals, such as a livestock barn and a poultry house. |
US11707064B2 |
Methods of killing nematodes
Provided herein are methods for killing nematodes, said method comprising contacting said nematodes with an effective nematodes killing amount of a fatty-ammonium salt polysaccharide inclusion complex, and optionally a carrier. The fatty-ammonium salt starch inclusion complexes comprise one or more of a variety of fatty amines. |
US11707060B2 |
Mobile blind
A mobile blinds apparatus that installs along a raised platform for hunting is presented. The mobile blinds apparatus contains at least one rod, at least one blinds sheet, and at least one blinds anchor. Each of the at least one rod contains a mounting end. The mounting end is terminally positioned adjacent to the at least one rod. Each of the at least one blinds sheet traverses along each of the at least one rod. Each of the at least one blinds anchor is connected adjacent to the mounting end. |
US11707059B2 |
Tree stand and method of use thereof
A tree stand includes a ladder portion having first and second rails, a tree-engaging member configured to engage a tree, and a mechanism being selectively variable in length operatively interconnecting the member and the first and second rails and controlling the distance between the member and the first and second rails. A platform is pivotably connected to the first and second rails. |
US11707056B2 |
Animals, repertoires and methods
The present invention is directed to the concept of sectoring antibody gene segment repertoires in order to enable the development of novel, synthetic antibody chain repertoires not seen in nature. The present invention is also directed to the realisation of the inventors that sectoring can also alter gene segment expression by providing new arrangements of gene segment clusters relative to other gene segments and regulatory elements in transgenic immunoglobulin loci, thereby providing for new synthetic antibody chain sequence repertoires. The invention also relates to gene segment inversion. |
US11707053B1 |
Automated poultry watering system
An automated poultry watering system includes a hollow water tank having a bottom wall, at least one outer wall and an open top in communication within an internal water reservoir. Mounted on the outer wall are a plurality of watering stations for providing fresh water to poultry. Each watering station includes a bowl and a spring-biased lever that, when depressed, opens a valve to allow water from the reservoir to flow into the bowl. Within the reservoir is a refill valve that replenishes the tank with water from a municipal water source whenever the water level drops below a predetermined level. |
US11707046B2 |
Petunia variety ‘KLEPH20580’
A Petunia plant designated KLEPH20580 is disclosed. Embodiments include seeds of Petunia KLEPH20580, plants of Petunia KLEPH20580, to plant parts of Petunia KLEPH20580, and methods for producing a plant by crossing Petunia KLEPH20580 with itself or with another variety. Embodiments also relate to Petunia varieties, breeding varieties, plant parts, and cells derived from Petunia KLEPH20580, methods for producing other Petunia lines or plant parts derived from Petunia KLEPH20580, and the Petunia plants, varieties, and their parts derived from use of those methods. Embodiments further include hybrid Petunia seeds, plants, and plant parts produced by crossing Petunia KLEPH20580 with another Petunia variety or another plant type. |
US11707045B2 |
Soybean cultivar EE1660343
The present invention is in the field of soybean variety EE1660019, EE1660070, EE1660299, EE1660534, EE1660343, EE1660277, EE1600331, or AR1502197 breeding and development. The present invention particularly relates to the soybean variety EE1660019, EE1660070, EE1660299, EE1660534, EE1660343, EE1660277, EE1600331, or AR1502197 and its seed, cells, germplasm, plant parts, and progeny, and methods of using EE1660019, EE1660070, EE1660299, EE1660534, EE1660343, EE1660277, EE1600331, or AR1502197 in a breeding program. |
US11707044B2 |
Soybean variety 01083999
The invention relates to the soybean variety designated 01083999. Provided by the invention are the seeds, plants and derivatives of the soybean variety 01083999. Also provided by the invention are tissue cultures of the soybean variety 01083999 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety 01083999 with itself or another soybean variety and plants produced by such methods. |
US11707042B2 |
Soybean cultivar 00330037
A soybean cultivar designated 00330037 is disclosed. The invention relates to the seeds of soybean cultivar 00330037, to the plants of soybean cultivar 00330037, to the plant parts of soybean cultivar 00330037, and to methods for producing progeny of soybean cultivar 00330037. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 00330037. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 00330037, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 00330037 with another soybean cultivar. |
US11707038B1 |
Maize inbred 1PPFG56
A novel maize variety designated 1PPFG56 and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety 1PPFG56 with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into 1PPFG56 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety 1PPFG56 or a locus conversion of 1PPFG56 with another maize variety. |
US11707033B1 |
Maize inbred 1PNZQ23
A novel maize variety designated 1PNZQ23 and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety 1PNZQ23 with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into 1PNZQ23 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety 1PNZQ23 or a locus conversion of 1PNZQ23 with another maize variety. |
US11707031B1 |
Maize inbred 1PZTR12
A novel maize variety designated 1PZTR12 and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety 1PZTR12 with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into 1PZTR12 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety 1PZTR12 or a locus conversion of 1PZTR12 with another maize variety. |
US11707024B1 |
Rubber tree rain guard seal assembly
The main objective of this invention is to improve the efficiency and service life of a rubber tree rain guard seal. The performance of existing rubber tree rain guard seals depends on a fixed mechanical and or chemical attachment of the seal to the tree. These methods of attachment prevent the seal from expanding with the circumferential growth of the tree resulting in premature seal failure and damage to the tree within a year of operation. In this invention the seal is comprised of five components that are not fixed to the tree, allowing the seal to expand along with tree growth. An adjustable outer seal connector regulates the pressure required to establish consistent sealing contact against the tree, thus providing extended service life of the seal assembly. The seal assembly comes apart for easy maintenance. |
US11707020B1 |
Cotton bale strapping apparatus and methods of use
The present invention provides improved throughput in cotton baling machines by utilizing an electronically actuated apparatus for reliably, efficiently and precisely moving a chute frame into and out of position adjacent to a compressed cotton bale. Embodiments of the invention may include an electronic actuator that may be operated using a programmable logic control (PLC), and a control shaft having at least three distinct stops corresponding to raised, lowered and intermediate positions of the chute frame. Embodiments of the invention may be used to replace existing pneumatic apparatus, and may include an adapter for installing an electronic actuator to the mounts of the replaced pneumatic piston. |
US11707018B2 |
Adjustable handle assembly for a walk-behind mower
A handle adjustment assembly is attached to a walk-behind lawn mower, wherein the handle adjustment assembly is rotatably adjustable relative to a deck of the mower to allow the handle to be adjusted to multiple different heights relative to the ground at distinct operative positions. The handle adjustment assembly is also rotatable to allow the handle to be adjusted to a stored position adjacent to the deck, wherein the mower can be stored in a substantially vertical orientation. |
US11707017B1 |
Method for improving soda saline-alkaline paddy fields by stirring and discharging slurry and application thereof
A method for improving paddy fields by stirring and discharging slurry, including steps of rotary tillage scarifying, irrigation and paddy field soaking, slurry stirring, slurry layering, slurry discharging, airing, and water storing. The method for improving paddy fields by stirring and discharging slurry can quickly and greatly reduce soil salinity, with a cost lower than 1,000 yuan/hm2, a yield of 5,065 kg/hm2 to 6,304 kg/hm2; it saves the step of water harrowing before conventional rice planting and transplanting, and offers simple operation and promising prospect of replication and popularization, providing important support for increasing grain in soda saline-alkaline areas in the western Songnen Plain. |
US11707016B2 |
Cross-grower study and field targeting
A computer-implemented method of targeting grower fields for crop yield lift is disclosed. The method comprises receiving, by a processor, crop seeding rate data and corresponding crop yield data over a period of time regarding a group of fields associated with a plurality of grower devices; receiving, by the processor, a current seeding rate for a grower's field associated with one of a plurality of grower devices; determining, whether the grower's field will be responsive to increasing a crop seeding rate for the grower's field from the current seeding rate to a target seeding rate based on the crop seeding rate data and corresponding crop yield data; preparing, in response to determining that the grower's field will be responsive, a prescription including a new crop seeding rate and a specific hybrid to be implemented in the grower's field. |
US11707013B2 |
Combined depth gauge wheel and scraper for a planter
A depth gauge wheel for a row planter. The depth gauge wheel sets the planting depth for the seeds planted by the row planter. The depth gauge wheel sets planting depth by setting the cutting depth of the disk opener of the row planter. The depth gauge wheel also scrapes mud from the disk blade of the disk opener. The depth gauge wheel includes a rim, a tire attached to the rim and a ring attached to the rim. The tire contacts the surface of the ground to set the cutting depth of the disk opener and the ring scrapes mud from the disk blade of the disk opener. |
US11707011B2 |
Single disk fertilizer opener for an agricultural planter
A single disk fertilizer opener assembly for opening a trench in soil includes a frame support and a cutting disk for forming the trench. The cutting disk is coupled to an axle and rotates about the axle as the assembly moves in a working direction. The assembly also includes a first arm pivotally coupled to the frame support and the axle, and a second arm pivotally coupled to the frame support at a location spaced from the first arm. A bracket is coupled to the axle and the second arm, and a scraper is coupled to the bracket and disposed substantially perpendicularly to the working direction. |
US11707009B2 |
Cultivator
A cultivator includes at least one cultivator row unit, each of the at least one cultivator row unit having a support assembly for securing the cultivator row unit to a tool bar, a shank, an earth working tool operatively connected to the shank, and at least one assembly for providing discrete incremental adjustment for at least one of (a) an angle of the earth working tool, (b) a depth of the earth working tool, and (c) a gauge wheel depth. |
US11711989B2 |
Phase change memory
An embodiment of the invention may include a semiconductor structure. The semiconductor structure may include a phase change element located above a heater. The heater may include a conductive element surrounding a dielectric element. The dielectric element may include an air gap. |
US11711988B2 |
Elementary cell comprising a resistive memory and associated method of initialization
An aspect of the invention relates to an elementary cell that includes a breakdown layer made of dielectric having a thickness that depends on a breakdown voltage, a device and a non-volatile resistive memory mounted in series, the device including an upper selector electrode, a lower selector electrode, a layer made in a first active material, referred to as active selector layer, the device being intended to form a volatile selector; the memory including an upper memory electrode, a lower memory electrode, a layer made in at least one second active material, referred to as active memory layer. |
US11711986B2 |
Superconductor-semiconductor fabrication
A mixed semiconductor-superconductor platform is fabricated in phases. In a masking phase, a dielectric mask is formed on a substrate, such that the dielectric mask leaves one or more regions of the substrate exposed. In a selective area growth phase, a semiconductor material is selectively grown on the substrate in the one or more exposed regions. In a superconductor growth phase, a layer of superconducting material is formed, at least part of which is in direct contact with the selectively grown semiconductor material. The mixed semiconductor-superconductor platform comprises the selectively grown semiconductor material and the superconducting material in direct contact with the selectively grown semiconductor material. |
US11711985B2 |
System and method for superconducting multi-chip module
A method for bonding two superconducting integrated circuits (“chips”), such that the bonds electrically interconnect the chips. A plurality of indium-coated metallic posts may be deposited on each chip. The indium bumps are aligned and compressed with moderate pressure at a temperature at which the indium is deformable but not molten, forming fully superconducting connections between the two chips when the indium is cooled down to the superconducting state. An anti-diffusion layer may be applied below the indium bumps to block reaction with underlying layers. The method is scalable to a large number of small contacts on the wafer scale, and may be used to manufacture a multi-chip module comprising a plurality of chips on a common carrier. Superconducting classical and quantum computers and superconducting sensor arrays may be packaged. |
US11711975B2 |
Near-infrared absorbers, near-infrared absorbing/blocking films, photoelectric devices, organic sensors, and electronic devices
A near-infrared absorber includes a compound represented by Chemical Formula 1. A near-infrared absorbing/blocking film, a photoelectric device, an organic sensor, and an electronic device may include the near-infrared absorber. In Chemical Formula 1, X1, X2, Y1, Y2, Ar, Ar1, and Ar2 are the same as defined in the detailed description. |
US11711970B2 |
Organic electroluminescent device
To provide an organic electroluminescent device in which energy efficiency is improved. An organic electroluminescent device includes a pair of electrode layers formed of an anode layer and a cathode layer, and a luminescent layer arranged between the pair of electrode layers, in which the luminescent layer includes a host material and a dopant material, and the dopant material is an anthracene-based compound represented by formula (1), and the luminescent layer further includes a polycyclic aromatic compound represented by formula (2) or a multimer of a polycyclic aromatic compound having a plurality of structures represented by formula (2). |
US11711969B2 |
Organic electroluminescent materials and devices
A novel compound is disclosed which includes a ligand LA of Formula II, wherein: ring B is independently a 5-membered or 6-membered carbocyclic or heterocyclic ring; X1 to X4 are each independently selected from the group consisting of C, N, and CR; at least one pair of adjacent X1 to X4 are each C and fused to Formula V where indicated by “”; X5 to X12 are each independently C or N; the maximum number of N within a ring is two; Z and Y are each independently selected from the group consisting of O, S, Se, NR′, CR′R″, SiR′R″, and GeR′R″; RB and RC each independently represents zero, mono, or up to a maximum allowed substitutions to its associated ring; each of RB, RC, R, R′, and R″ is independently hydrogen or a substituent selected from the group consisting of deuterium, halogen, alkyl, cycloalkyl, heteroalkyl, heterocycloalkyl, arylalkyl, alkoxy, aryloxy, amino, silyl, alkenyl, cycloalkenyl, heteroalkenyl, alkynyl, aryl, heteroaryl, acyl, carboxylic acid, ether, ester, nitrile, isonitrile, sulfanyl, sulfinyl, sulfonyl, phosphino, boryl, and combinations thereof; and two substituents can be joined or fused to form a ring; the ligand LA is complexed to a metal M through the two indicated dash lines of each Formula; and the ligand LA can be joined with other ligands to form a tridentate, tetradentate, pentadentate, or hexadentate ligand. |
US11711967B2 |
Switchable photovoltaic devices
The present disclosure relates to a composition that includes a scaffold having an internal space and a mixture positioned within the space, where the mixture includes a first phase having a metal halide perovskite and a second phase including at least one of a perovskite precursor and/or a switching molecule, the composition is capable of reversibly switching between a first state having at least one of a first transparency and/or a first color and a second state having at least one of a second transparency and/or a second color. |
US11711963B2 |
Display panel, mask, method for manufacturing display panel, and display device
The present invention provides a mask, a display panel, a method for manufacturing a display panel, and a display device. The display panel has a hollow region and a display region surrounding the hollow region. The display panel includes a plurality of organic light-emitting devices arranged only in the display region. Each of the plurality of organic light-emitting devices includes an anode layer, a cathode layer, a light-emitting layer and a functional layer. The functional layer includes a plurality of uneven portions. |
US11711962B2 |
Flexible display apparatus having alignment mark and method of assembling the same
A flexible display apparatus includes a flexible display panel including a flexible substrate, a display area of the flexible substrate including a thin film transistor, an organic light emitting layer and a sensor electrode, and a peripheral area of the flexible substrate including a first alignment mark in which respective portions of two metal layers are stacked; a window on a first surface of the flexible display panel; and a protective film on a second surface of the flexible display panel. The first alignment mark is aligned with a reference point of the window and with a reference point of the protective film. |
US11711951B2 |
Display device including a conductive layer overlapping a driving voltage line
A display device includes: a plurality of pixels each including a driving thin film transistor and a storage capacitor, wherein each of the pixels further includes: a driving semiconductor layer including a driving channel region, a driving source region, and a driving drain region; a first electrode layer, a portion of the first electrode layer overlapping the driving channel region; a second electrode layer overlapping the first electrode layer; a node connection line having a first side connected to the first electrode layer; a pixel electrode overlapping the first electrode layer and the second electrode layer; and a shielding layer between the first electrode layer and the pixel electrode and overlapping the first electrode layer, the node connection line, and the pixel electrode. |
US11711947B2 |
Display device having a transparent mask that includes a transparent oxide
A display device includes a plurality of first electrodes electrically connected to pixel circuits disposed on a substrate; a pixel defining layer defining a plurality of opening regions, each of the opening regions exposing a portion of each of the first electrodes; a plurality of light emitting layers respectively disposed on the first electrodes in the opening regions; a second electrode covering the light emitting layers and the pixel defining layer; an encapsulation layer disposed on the second electrode; and a plurality of light blocking patterns disposed on the encapsulation layer between the opening regions adjacent to each other in a first direction. |
US11711946B2 |
Substrate having a printing area, light emitting device, and method for manufacturing the substrate
The present disclosure provides a substrate comprising a printing area, wherein the printing area comprises a flat surface and a plurality of separation structures projecting from the flat surface, wherein the plurality of separation structures divide the printing area into a plurality of micro-areas, and in each of the micro-areas, a circular region containing no separation structure has a maximum diameter between 5 μm and 10 μm. The present disclosure further provides a light emitting device comprising the substrate and a method for manufacturing the substrate. |
US11711945B2 |
Display device
A display device is disclosed that may include a first active layer disposed on a substrate, a scan line disposed on the first active layer, extending in a first direction and including a first protruding portion protruding in a second direction crossing the first direction, a first compensation control line disposed on the first active layer, extending in the first direction and spaced apart from the scan line in the second direction, and a second active layer disposed on the scan line and the first compensation control line, overlapping the scan line and the first compensation control line and including a second protruding portion protruding in the first direction. The first protruding portion may be positioned outside the second active layer in the first direction in a plan view. |
US11711941B2 |
Organic light emitting display panel and organic light emitting display device including the same
Embodiments of the disclosure relate to an organic light emitting display panel and an organic light emitting display device including the same, and more specifically, to an organic light emitting display panel and an organic light emitting display device which include: an insulation film with at least one concave portion including a flat portion and an inclined portion surrounding the flat portion in at least one subpixel, a first electrode disposed on the concave portion, an organic layer disposed on the first electrode, a second electrode disposed on the organic layer, an encapsulation layer disposed on the second electrode, and at least one structure disposed on the encapsulation layer, overlapping at least one light emitting area, and having at least a side surface where a light reflecting member is disposed, thereby enhancing light extraction efficiency. |
US11711940B2 |
Organic light-emitting display with stepped portion surrounding through hole
An organic light-emitting display including a substrate, an insulating layer on the substrate, the substrate and the insulating layer having an opening therethrough penetrating, a pixel array on the insulating layer, the pixel array including a plurality of pixels that surround the opening, a first pixel adjacent to the opening from among the plurality of pixels includes a pixel electrode layer, an intermediate layer on the pixel electrode layer, and an opposite electrode layer on the intermediate layer, and a stepped portion on the substrate and adjacent to the opening, the stepped portion having an under-cut step, wherein the intermediate layer including an organic emission layer, and wherein at least one of the intermediate layer and the opposite electrode layer extends toward the opening and is disconnected by the stepped portion. |
US11711937B2 |
Display apparatus and method of manufacturing the same
A display apparatus includes a display panel including pixels and a cover window disposed on the display panel. The cover window includes a flat portion having a first thickness, and a folding portion having a second thickness that is less than the first thickness of the flat portion, the folding portion being adjacent to the flat portion. A first stress profile of the flat portion of the cover window that is a stress change along a depth direction from a surface of the flat portion of the cover window is different from a second stress profile of the folding portion of the cover window that is a stress change along a depth direction from a surface of the folding portion of the cover window. |
US11711935B2 |
Display panel
A display panel includes: a display area and a peripheral area outside the display area; a substrate; a plurality of pixel electrodes spaced apart from each other on the substrate in the display area; a plurality of emission layers respectively arranged on the plurality of pixel electrodes; an opposite electrode on the plurality of emission layers and overlapping the display area; and a thin-film encapsulation layer on the opposite electrode and comprising at least one organic encapsulation layer and at least one inorganic encapsulation layer, wherein edges of the opposite electrode comprise a concave edge recessed from the peripheral area toward the display area and a convex edge protruding from the display area toward the peripheral area in a plan view. |
US11711932B2 |
Photoelectric conversion element including first electrode, second electrodes, photoelectric conversion film, and conductive layer and method for manufacturing the same
A method for manufacturing a photoelectric conversion element includes providing a base structure including a semiconductor substrate having a principal surface, a first electrode located on or above the principal surface, second electrodes which are located on or above the principal surface and which are one- or two-dimensionally arranged, and a photoelectric conversion film covering at least the second electrodes; forming a mask layer on the photoelectric conversion film, the mask layer being conductive and including a covering section covering a portion of the photoelectric conversion film that overlaps the second electrodes in plan view; and partially removing the photoelectric conversion film by immersing the base structure and the mask layer in an etchant. |
US11711930B2 |
Photoelectric devices and image sensors and electronic devices
A photoelectric device includes a first photoelectric conversion layer including a heterojunction that includes a first p-type semiconductor and a first n-type semiconductor, a second photoelectric conversion layer on the first photoelectric conversion layer and including a heterojunction that includes a second p-type semiconductor and a second n-type semiconductor. A peak absorption wavelength (λmax1) of the first photoelectric conversion layer and a peak absorption wavelength (λmax2) of the second photoelectric conversion layer are included in a common wavelength spectrum of light that is one wavelength spectrum of light of a red wavelength spectrum of light, a green wavelength spectrum of light, a blue wavelength spectrum of light, a near infrared wavelength spectrum of light, or an ultraviolet wavelength spectrum of light, and a light-absorption full width at half maximum (FWHM) of the second photoelectric conversion layer is narrower than an FWHM of the first photoelectric conversion layer. |
US11711929B2 |
Field-effect transistor, method for manufacturing same, and wireless communication device
A field-effect transistor comprises, on a substrate, a source electrode, a drain electrode, and a gate electrode; a semiconductor layer in contact with the source electrode and the drain electrode; wires individually electrically connected to the source electrode and the drain electrode; and a gate insulating layer that insulates the semiconductor layer from the gate electrode, wherein a connecting portion between the source electrode and the wire forms a continuous phase, and a connecting portion between the drain electrode and the wire forms a continuous phase, the portions constituting the continuous phases contain at least an electrically conductive component and an organic component, and integrated values of optical reflectance at a region of a wavelength of 600 nm or more and 900 nm or less on the wires are higher than integrated values of optical reflectance at a region of a wavelength of 600 nm or more and 900 nm or less on the source electrode and the drain electrode. |
US11711927B2 |
Filamentary type non-volatile memory device
A filament type non-volatile memory device, includes a first electrode, a second electrode and an active layer extending between the first electrode and the second electrode, the active layer electrically interconnecting the first electrode to the second electrode, the device being suitable for having: a low resistive state, in which a conducting filament electrically interconnecting the first electrode to the second electrode uninterruptedly extends from end to end through the active layer, the filament having a low electric resistance, and a highly resistive state, in which the filament is broken, the filament having a high electric resistance. The device further includes a shunt resistance electrically connected in parallel to the active layer, between the first electrode and the second electrode. |
US11711926B2 |
Memory array and memory structure
A memory array and structure are provided. The array includes driving elements arranged in array; memory cells arranged in array and respectively corresponding to the driving elements, where one end of each memory cell is coupled to a first end of the corresponding driving element; word lines and bit lines arranged to intersect with each other, where each word lines is coupled to control ends of the driving elements in the same word line, and each bit line is respectively coupled to the other ends of the memory cells. For each word line, the first end of one driving element is connected to the first end of at least one other driving element in the same word line by a metal line, so as to form share driving elements. |
US11711924B2 |
Methods of forming structures containing leaker-devices and memory configurations incorporating leaker-devices
Some embodiments include an integrated assembly having first electrodes with top surfaces, and with sidewall surfaces extending downwardly from the top surfaces. The first electrodes are solid pillars. Insulative material is along the sidewall surfaces of the first electrodes. Second electrodes extend along the sidewall surfaces of the first electrodes and are spaced from the sidewall surfaces by the insulative material. Conductive-plate-material extends across the first and second electrodes, and couples the second electrodes to one another. Leaker-devices electrically couple the first electrodes to the conductive-plate-material and are configured to discharge at least a portion of excess charge from the first electrodes to the conductive-plate-material. Some embodiments include methods of forming integrated assemblies. |
US11711913B2 |
Bonded semiconductor devices having programmable logic device and NAND flash memory and methods for forming the same
First semiconductor structures are formed on a first wafer. At least one of the first semiconductor structures includes a programmable logic device, an array of static random-access memory (SRAM) cells, and a first bonding layer including first bonding contacts. Second semiconductor structures are formed on a second wafer. At least one of the second semiconductor structures includes an array of NAND memory cells and a second bonding layer including second bonding contacts. The first wafer and the second wafer are bonded in a face-to-face manner, such that the at least one of the first semiconductor structures is bonded to the at least one of the second semiconductor structures. The first bonding contacts of the first semiconductor structure are in contact with the second bonding contacts of the second semiconductor structure at a bonding interface. The bonded first and second wafers are diced into dies. At least one of the dies includes the bonded first and second semiconductor structures. |
US11711909B2 |
Electronic device
An electronic device includes a top plate having a first surface and a second surface that is positioned at an elevation that is lower than an elevation of the first surface, the second surface extending from a first end part of the top plate to a second end part of the top plate, a bottom plate provided under the top plate, and a circuit board placed between the top plate and the bottom plate and mounted with an electronic component. The top plate has opposing first and second edges and opposing third and fourth edges that are perpendicular to the first and the second edges, the first end part being formed at the first edge and the second end part being formed at the second edge. |
US11711906B2 |
Temperature management system for autonomous vehicles
Techniques are described for managing temperature in an autonomous vehicle. An exemplary method comprises performing autonomous driving operations that operate the autonomous vehicle in an autonomous mode, receiving one or more messages from a temperature sensor associated with an electrical device located on or in the autonomous vehicle while the autonomous vehicle is operated in the autonomous mode, determining a cooling technique to reduce the temperature of electrical device, and performing the cooling technique. |
US11711903B1 |
Server rack flood shroud
Systems and techniques for deploying a deployable water barrier to protect server racks and components housed thereon are provided. The deployable water barrier is deployed in response to water detected at the server rack. The deployable water barrier is deployed by a barrier deployment mechanism, causing the barrier to expand and cover a front and/or a back side of the server rack. |
US11711901B2 |
Display device and electronic device having the same
A display device includes a display module having a display region and a non-display region, and a window module disposed on the display module. The window module includes a thin glass substrate, a window protective layer disposed on the thin glass substrate, and a bezel pattern disposed on a surface of the thin glass substrate or disposed on a surface of the window protective layer. The bezel pattern overlaps the non-display region. The edge of the thin glass substrate does not overlap the bezel pattern in a plan view, and the edge of the thin glass substrate is not aligned with the outer edge of the bezel pattern in a plan view. |
US11711899B2 |
Installation structures for tiled displays and tiled displays
Installation structures for tiled displays and tiled displays are provided. A tiled display includes a plurality of sub-display panels each of which is installed on a respective installation structure. The installation structure includes: a frame body, on which a corresponding sub-display panel is installed; a movable part provided on an outer side of the frame body; and an adjustment rod, an end of which penetrates through the frame body and cooperates with the movable part, where the adjustment rod is rotatable relative to the frame body, and rotation of the adjustment rod can drive the movable part to move close to or away from the frame body. The tiled display includes the installation structure for the tiled display. |
US11711898B2 |
Methods and systems for aligning a component
There is provided a method which includes placing a component on a substrate and extending an alignment member through an opening in the substrate. Once the alignment member is extended through the opening, the component is moved to abut against the alignment member to align the component relative to the substrate. After the component is aligned relative to the substrate, the component is secured to the substrate and the alignment member is retracted through the opening. |
US11711896B2 |
Electronic device and manufacturing method thereof
An electronic device is provided, the electronic device includes a driving substrate, the driving substrate includes a plurality of circular grooves and a plurality of rectangular grooves, a plurality of disc-shaped light-emitting units, at least one disc-shaped light-emitting unit is disposed in at least one circular groove, and the at least one disc-shaped light-emitting unit includes an alignment element positioned on a top surface of the at least one disc-shaped light-emitting unit, a diameter of the at least one disc-shaped light-emitting unit is defined as R, a diameter of the alignment element is defined as r, a width of at least one rectangular groove among the rectangular grooves is defined as w, and a height of the at least one rectangular groove is defined as H, and the at least one disc-shaped light-emitting unit and the at least one rectangular groove satisfy the condition of (R+r)/2>(w2+H2)1/2. |
US11711892B2 |
Method of manufacture and use of a flexible computerized sensing device
A thin, flexible computerized sensing platform which can be affixed to a structure to be sensed, which has excellent mechanical coupling between the sensors and the object to be sensed, which can be self-powered and rechargeable, and which can be environmentally sealed, and a method for assembling and utilizing the same. |
US11711890B2 |
Asymmetric board
The present application provides an asymmetric board, which includes the first master board, the second master board, and the insulating dielectric layer sandwiched between the first master board and the second master board, and the depth control grooves are disposed in the connection position between the units on the asymmetric board, and located on the surface of the second master board and extending a toward the side of the first master board, the depth control grooves provide space for the expansion of the second master board, reduce the stress of the units, and reduce the warping of the second master board. When the number of the depth control grooves in the first direction and/or the second direction is greater than 0, the depths of the depth control grooves increase by X from a center to an edge of the asymmetric board, and the X is greater than or equal to 0. |
US11711887B2 |
Substrate structure
An object of the present disclosure is to be able to further reduce the size of a substrate structure including a plurality of elements. The substrate structure includes: a base substrate that includes a first conductive plate and a second conductive plate; a first element connected to the first conductive plate and the second conductive plate; and a second element connected to the first conductive plate and the second conductive plate. The first conductive plate and the second conductive plate are disposed on the same plane on the base substrate in a state of being electrically insulated from each other, the first element is mounted on a first main surface of the base substrate, and the second element is mounted on a second main surface that is on the opposite side to the first main surface relative to the base substrate. |
US11711886B2 |
Vehicular camera module with focus athermalization
A vehicular camera module includes a front camera housing portion having an imager, a lens having a plurality of optical elements, and an imager printed circuit board. The imager is disposed at a front side of the imager printed circuit board and the lens is optically aligned with the imager. A rear camera housing portion is mated with the front camera housing portion to form a camera housing. A thermal element is disposed between the imager printed circuit board and the camera housing. The thermal element has a coefficient of thermal expansion (CTE) of 13 ppm/° C. or less. With the vehicular camera module disposed at a vehicle, circuitry of the vehicular camera module is in electrical connection with a wire harness of the vehicle. |
US11711882B2 |
Body current compensation system (body CCS)
ProblemAll conductive bodies and particularly humans bodies, living in an electrified environment are traversed by alternating currents. Especially with the rise of electromobility, these currents are also present outside the typical house or office or factory environment, influencing the body almost during the whole 24 hours life cycle.SolutionThe invention proposes simple, contactless means to protect the body, by compensating the induced currents from the electrified environment. An isolated, intermediate conductive plate between the ground and the body is used to sense and minimize the induced currents. A coil at the periphery of the intermediate plate is used to sense and compensate the induced magnetic field, in its simplest embodiment. |
US11711881B2 |
Method of quickly setting DMX address of light fixture
A method of quickly setting a DMX address of a light fixture, the controller sending a DMX address to an i-th light fixture through a first signal line; the i-th light fixture setting DMX address as the received DMX address, calculating a DMX address of an (i+1)th light fixture based on the received DMX address, and sending the DMX address of the (i+1)th light fixture to the (i+1)th light fixture through the first signal line; the (i+1)th light fixture setting DMX address thereof as the received DMX address, and sending a feedback signal to the i-th light fixture through the first signal line; the first light fixture to the i-th light fixture each sending a counting signal or a UID code or a successfully set DMX address to the controller through the first signal line if the i-th light fixture does not receive the feedback signal within a set time. |
US11711880B2 |
Visual tracking system and method
The present invention is directed to a user-operated spotlight system and method for lighting a performer on a stage or performance space; the user-operated spotlight system comprising a screen which displays an image of the stage and a cursor, a screen cursor positioner adapted to be operated to move the cursor on the screen, a processor connected to the screen, and, a plurality of controllable spotlights which are connected to the processor and which plurality of controllable spotlights can be moved by a user moving the cursor on the screen. The advantage of providing such a user-operated spotlight system is that a single user can operate a plurality of spotlights. |
US11711874B2 |
Load-dependent active gain control for power factor correction
An active gain control circuit includes a dynamic voltage divider having a variable resistance configured to attenuate a rectified input line voltage to produce a reference signal, a filter-divider circuit configured to extract a DC-level attenuated reference voltage from the reference signal, and an operational amplifier configured to receive the DC-level attenuated reference voltage and a regulation voltage, and to generate a gate control signal based on a difference between the regulation voltage and the DC-level attenuated reference voltage, the variable resistance of the dynamic voltage divider being controlled by the gate control signal, and a comparison voltage generator configured to attenuate a comparison voltage to generate the regulation voltage. |
US11711868B2 |
System and method for radio frequency band selection for new radio standalone and non-standalone services
A method, a system, and a non-transitory storage medium are described in which a radio frequency band selection service is provided. The radio frequency band selection service may include a default service band, a default coverage band, and a threshold value that allows an end device to select a radio frequency band to camp on when in an idle mode, select a radio frequency band to obtain service when in a connected mode, and select stand-alone or non-stand-alone services. |
US11711866B1 |
Service prioritization using citizens broadband radio service based on embedded subscriber identity modules
A Citizens Broadband Radio Service (CBRS) system can receive, from a mobile device, a request to establish a communicative connection, and in response to receiving the request, cause an embedded subscriber identity module (eSIM) of the device to be provisioned with a priority level of wireless service. The system can change the priority level of the eSIM based, at least in part, on assessment of the device's activity in accordance with one or more prioritization criteria, and cause establishment or adjustment of the communicative connection of the device in accordance with the priority level. |
US11711860B2 |
Device pairing by cognitive computing
A computer-implemented method and a computer program product for device pairing by cognitive computing. A cognitive computing system creates a knowledge corpus about the historical activities of pairing devices of a user. The cognitive computing system predicts needs of device pairing of the user, based on analysis of the historical activities. The cognitive computing system identifies devices that can be paired in a surrounding area. An augmented reality device tracks an eye direction of the user at a device, extrapolates the eye direction to create an eye focus direction of the user, obtains from the cognitive computing system an eye focus line with an arrow pointing to the device, and creates an augmented reality overlay which shows the eye focus line. The augmented reality device pairs a user currently used device and the device, upon user approval. |
US11711855B2 |
Random access method, terminal, and network device
The present disclosure provides a random access method, a terminal, and a network device. The random access method of the present disclosure comprises: receiving configuration information concerning a currently activated downlink bandwidth part (BWP) or a serving cell; detecting a random access response (RAR) in a random access procedure according to the configuration of a control resource set (CORESET) in the configuration information of the currently activated downlink BWP or the configuration information of the serving cell. |
US11711853B2 |
Systems and methods for dynamic prioritized transmission and receipt of data packets to and from a radio access network during an attach procedure
A user equipment (UE) may receive, during release from a radio access network (RAN), resource information associated with attaching to the RAN, wherein the resource information is received based on the device being authenticated. The UE may store the resource information in a data structure associated with the UE, and may receive, when the UE includes a payload of data packets to transmit to the RAN, a signal from the RAN. The UE may determine, based on the signal, whether the RAN is a same RAN that provided the resource information, and may determine whether a strength of the signal from the RAN satisfies a threshold when the RAN is the same RAN that provided the resource information. The UE may attach to the RAN when the strength of the signal satisfies the threshold, and may provide the payload to the RAN via a random access channel of the RAN. |
US11711850B2 |
Access method and apparatus
The application provide an access method, including: sending, to an access point, a first frame that carries uplink transmission requirement information; and if a second frame that carries information about an uplink transmission resource is received from the access point within agreed time period, sending uplink multi-user transmission data to the access point, where the uplink multi-user transmission data is transmitted on the uplink transmission resource; or if the second frame is not received within an agreed time period, accessing, by a station, a channel in a contention access manner that is based on carrier sense CSMA/CA. |
US11711846B2 |
Multiple starting and ending positions for scheduled downlink transmission on unlicensed spectrum
Systems and methods are disclosed herein that relate to multiple candidate starting points for a transmit burst in unlicensed spectrum. In some embodiments, a method of operation of a radio access node for performing a transmit burst in an unlicensed spectrum comprises transmitting a transmit burst in an unlicensed spectrum, wherein the transmit burst spans multiple subframes/slots and the transmitting of the transmit burst starts at one of a plurality of candidate starting points defined in at least a first subframe/slot of the transmit burst that occurs after successful completion of a Listen-Before-Talk (LBT) procedure for the transmit burst. In this manner, a radio access node (e.g., an enhanced or evolved Node B (eNB) in Long Term Evolution (LTE)) has flexibility to transmit a downlink transmit burst starting at different starting positions based on LBT outcome. |
US11711843B2 |
Base station, user equipment, circuitry, mobile telecommunications system and method for interrupt processing of lower priority data transmission
A user equipment for a mobile telecommunications system has circuitry configured to communicate with at least one base station, wherein the circuitry is further configured to: interrupt processing of a lower priority data transmission when a higher priority data transmission has to be processed, when it is determined that an available processing power is below a predetermined threshold. |
US11711841B2 |
On-demand system information broadcasting system
A communication system is disclosed in which a base station manages the transmission of on-demand system information to optimise the trade-off between the additional signalling overhead associated with on-demand transmission and the resource usage inefficiencies associated with the sometimes unnecessary transmission of system information on a periodic basis. The base station manages switching from on-demand transmission to periodic transmission, and vice versa, based on one or more utilisation thresholds. |
US11711838B2 |
Wireless telecommunications apparatuses and methods for allocating downlink resources
There is provided a method of transmitting downlink control-related information to a terminal in a wireless telecommunications system. The method comprises allocating downlink resources in a first set of resources for sending the downlink control-related information; determining that a further downlink transmission will be transmitted using at least part of the allocated downlink resources thereby identifying a collision between the downlink control-related information transmission and the further downlink transmission; upon identifying a collision, allocating a second set of resources for sending the downlink control-related information; and transmitting the downlink control-related information using at least the second set of resources. |
US11711837B2 |
Method and device in a node used for wireless communication
The present disclosure provides a method and a device in a node for wireless communications. A first receiver, which receives a first signaling; receives a first signal; receives a second signaling; and a second signal; a first transmitter, which transmits a first bit block set in a target time-frequency resource group; herein, the first signaling indicates scheduling information of the first signal, while the second signaling indicates scheduling information of the second signal; the first bit block set comprises a first bit block and a third bit block, the first bit block comprises information (bit(s)) indicating whether the first signal is correctly received, a second bit block comprises information (bit(s)) indicating whether the second signal is correctly received; a sum of size of the first bit block and a first value is used together with the first signaling to determine the target time-frequency resource group. |
US11711836B2 |
Method, device, storage medium, and system for determining time-domain resource
A method, device, storage medium and system for determining a time-domain resource determination are provided. The method includes that: allocation information for scheduling a time-domain resource is received from a network device (S401), the time-domain resource to be scheduled including a time-domain resource required by channel transmission; a time-domain position is determined for the time-domain resource to be scheduled based on a preset rule according to UL/DL time-domain resource configuration information and the allocation information; and channel transmission is performed with the network device through the time-domain resource to be scheduled according to the time-domain position corresponding to the time-domain resource to be scheduled. |
US11711834B2 |
Method and device for transmitting physical downlink control channel based on configuration information
A wireless communication method and a network device are provided. The method includes operations as follows. The network device sends configuration information to a terminal device. The configuration information is used to configure a time-domain position of a first resource, the first resource is used to transmit a physical downlink control channel, the configuration information includes first configuration information and second configuration information, the first configuration information indicates at least one first time-domain unit, each first time-domain unit includes the first resource, the second configuration information indicates at least one second time-domain unit in the first time-domain unit indicated by the first configuration information, and each second time-domain unit includes a part or all of the first resource. The network device transmits the physical downlink control channel to the terminal device on the first resource. |
US11711832B2 |
Linking search space sets for physical downlink control channel repetitions
Methods, systems, and devices for wireless communications are described. Linking multiple search space sets for physical downlink control channel (PDCCH) repetition may be enabled in a system. A user equipment (UE) may receive an indication of a configured search space set association from a base station. The association may indicate, to the UE, a configuration between a first PDCCH candidate and a second PDCCH candidate. The first PDCCH candidate may correspond to a first search space set, while the second PDCCH candidate may correspond to a second search space set. The UE may monitor the first and second search space set based on the configuration. The UE may combine the first PDCCH candidate with the second PDCCH candidate monitored in the first and second search space set based on capabilities of the UE and the configuration. The UE may decode the combined PDCCH candidates along with individual PDCCH candidates. |
US11711824B2 |
Scheduling and hybrid automatic repeat request operation and codebook design for new radio carrier aggregation
Methods, apparatus, and systems are provided for signalling transmissions using carriers of different numerologies. In one example, a baseband processor of a base station is configured to perform operations including encoding a first signal to be transmitted on a physical downlink control channel (PDCCH) on a first component carrier with a first subcarrier spacing. The first signal includes downlink control information (DCI) indicating resources for a second signal to be transmitted on a second component carrier with a second subcarrier spacing. Respective numerologies of the first component carrier and the second component carrier are different from one another in accordance with the first subcarrier spacing and the second subcarrier spacing. The baseband processor is configured to cause transmission of the first signal on the PDCCH. |
US11711817B2 |
Rate matching for a physical downlink shared channel (PDSCH)
Aspects of the present disclosure provide apparatus, methods, processing systems, and computer readable mediums for performing rate matching for a physical downlink shared channel (PDSCH). An example method generally includes monitoring for at least first and second downlink control information (DCI) formats for scheduling a physical downlink shared channel (PDSCH), determining a bitwidth of a rate matching indicator field of at least one of the first DCI format or the second DCI format, and performing PDSCH rate matching for a PDSCH scheduled by a DCI of the first or second DCI format based, at least in part, on the rate matching indicator field in the DCI or a format of the DCI. |
US11711813B2 |
Downlink control channel signaling for an aperiodic channel state information trigger
Embodiments described herein relate to downlink (DL) control channel signaling for an aperiodic channel state information (A-CSI) trigger. In one example, a user equipment (UE) communicates with a network to receive first configuration signaling to identify a first downlink control information (DCI) in a physical downlink control channel (PDCCH). The UE also receives, from the network, the first DCI. The first DCI is appended with cyclic redundancy check (CRC) bits that are scrambled by a common radio network temporary identifier (RNTI) and is to indicate an aperiodic channel state information (A-CSI) trigger. Next, the UE receives, from the network, channel state information (CSI) reference signals in one or more occasions that follow an occasion in which the first DCI is received and generates and transmits a CSI report in a physical uplink control channel (PUCCH) based on the CSI reference signals. |
US11711811B2 |
Multiplexing control information in a physical uplink data channel
For multiplexing control information in a physical uplink data channel, a user equipment (UE) includes receiving a configuration for a first set of values and receiving a downlink control information (DCI) format scheduling a transmission of a physical uplink shared data channel (PUSCH) over a set of resource elements (REs) and including a field providing an index. The method further includes determining a first value from the first set of values based on the index, determining a first subset of REs from the set of REs, for multiplexing first uplink control information (UCI), based on the first value, and transmitting the first UCI in the PUSCH. |
US11711803B2 |
Time domain resource allocation for downlink shared channel
A mechanism for time domain resource allocation for downlink shared channel, in which the time domain resource is allocated according to CORESET configurations when SS/PBCH block and RMSI CORESET are multiplexed with Type 1, Type 2 or Type 3 pattern. |
US11711801B2 |
Method and user equipment for transmitting uplink signals
The present disclosure relates to a communication method and system for converging a 5th-Generation (5G) communication system for supporting higher data rates beyond a 4th-Generation (4G) system with a technology for Internet of Things (IoT). The present disclosure may be applied to intelligent services based on the 5G communication technology and the IoT-related technology, such as smart home, smart building, smart city, smart car, connected car, health care, digital education, smart retail, security and safety services. The present disclosure provides a method for transmitting uplink signals, a user equipment (UE), and a base station. The UE determines an LBT type and a starting position of signal transmission according to scheduling information and LBT type of a previous subframe, a current subframe, and a subsequent subframe and whether there is a gap between these subframes. |
US11711799B2 |
Wireless device reporting
There is disclosed a method for operating a wireless device in a wireless communication network. The method comprises configuring, by the wireless device, a reporting time window for transmitting a report to the wireless communication network and determining, by the wireless device, whether data transmission from the wireless device to the wireless communication network is scheduled for a transmission time within the reporting time window, as well as transmitting the report together with the scheduled data transmission if it is determined that such is scheduled for a transmission time within the reporting time window. There are also disclosed corresponding methods and devices. |
US11711798B2 |
Method and apparatus for uplink transmission in communication system
A method and an apparatus for uplink transmission in a communication system. An operation method of a terminal includes: receiving, from a base station, first SFI information indicating n flexible symbol(s); receiving, from the base station, second SFI information re-indicating m symbol(s) of the n flexible symbol(s) as uplink (UL) symbol(s); and transmitting an SRS to the base station through the m symbol(s) re-indicated as a UL symbol among the n flexible symbol(s) indicated as a flexible symbol. Therefore, performance of the communication system can be improved. |
US11711796B2 |
Base station and user equipment for time division duplexing configuration deconfliction
The present disclosure provides a new radio base station for a mobile telecommunications system. The new radio base station has a circuitry configured to communicate with at least one user equipment and at least one LTE base station and to establish a new radio cell. The circuitry is further configured to transmit a time division duplexing configuration of the new radio cell to the LTE base station for identifying, based on the received time division duplexing configuration, a coexistence and intermodulation influence on an LTE receiver of the at least one user equipment. |
US11711795B2 |
Apparatus and method for altruistic scheduling based on reinforcement learning
The present disclosure relates to an apparatus and method of altruistic scheduling based on reinforcement learning. An altruistic scheduling apparatus according to an embodiment of the present disclosure includes: an external scheduling agent for determining a basic resource share for each process based on information of a resource management system; an internal scheduling agent for determining a basic resource allocation schedule for each process based on information including the basic resource share and a resource leftover based on the basic resource allocation schedule; and a leftover scheduling agent for determining a leftover resource allocation schedule based on information including the resource leftover. According to an embodiment of the present disclosure, it may be expected that reinforcement learning will not only mitigate the diminution of fairness of an altruistic scheduler but also further improve other performance indicators such as completion time and efficiency. |
US11711787B2 |
Transmission and reception configuration and signaling
One or more transmission parameters for data transmission may be determined for wireless communications. A wireless device may determine transmission parameters for data transmission based on configuration associated with control signaling. For example, the transmission parameters (e.g., transmission beam, transmission power, etc.) may be determined based on a selected spatial relation, among multiple spatial relations, corresponding to a control channel. |
US11711786B2 |
Optimization of resource unit and segment parser design for aggregated and multi-resource unit operations in extreme high-throughput systems
A method pertaining to optimization of resource unit (RU) and segment parser design for aggregated and multi-RU operations in extreme high-throughput (EHT) systems involves coding data for a station (STA) to provide a stream of coded bits. The method also involves processing the stream of coded bits to provide processed bits, including parsing the stream of coded bits to a combination of multiple RUs assigned to the STA in a proportional round-robin fashion. The method further involves transmitting the processed bits to the STA over the combination of multiple RUs. |
US11711785B2 |
System and method for sidelink resource allocation in user equipment groups
Embodiments of the disclosure provide methods and systems for sidelink resource allocation in user equipment (UE) groups. The method includes, receiving, by a UE, from a radio access network (RAN) node, a first resource configuration message including configuration information for sidelink resources indicated by a sidelink resource grant and conditions for using sidelink resources of the sidelink resource grant. The method further includes receiving, from a second UE of the UE group, a second sidelink resource configuration message, the second sidelink resource configuration message including an activation indicator to activate at least a portion of the sidelink resources indicated by the sidelink resource grant. The method further includes determining the sidelink resources to be used for sidelink transmissions by combining the first and second sidelink resource configuration messages. The method further includes using the determined sidelink resources for data transmissions. |
US11711784B2 |
Schemes for SSB to paging coreset mapping in NR
The present invention relates to a user device, a base station, and data transmission and reception methods to be performed by a user device and a base station in a communications system. The user device comprises circuitry which, in operation, calculates the starting location of a paging region comprising resources in which user devices are paged, the paging region including paging information for paging said user device; and determines an offset with respect to the starting location of the paging region, the offset indicating the location of the paging information for paging said user device relative to the starting location of the paging region. |
US11711781B1 |
Multicast aided cooperative beamforming wireless system
A cooperative wireless system using a multicast protocol to facilitate coordinating coherent addition and subtraction of wireless signaling or other beams originating from a plurality of antenna units at a target location is contemplated. The system may utilize multicast-based regulation and distribution of transmission control parameters necessary for the antenna units to synchronize the wireless signaling in a manner sufficient to enable the coherent addition and subtraction thereof at the target location. |
US11711777B2 |
Method and apparatus for maintaining uplink synchronization and reducing battery power consumption
A Node-B sends a polling message to a wireless transmit/receive unit (WTRU). The WTRU sends an uplink synchronization burst in response to the polling message without contention. The Node-B estimates an uplink timing shift based on the synchronization burst and sends an uplink timing adjustment command to the WTRU. The WTRU then adjusts uplink timing based on the uplink timing adjustment command. Alternatively, the Node-B may send a scheduling message for uplink synchronization to the WTRU. The WTRU may send a synchronization burst based on the scheduling message. Alternatively, the WTRU may perform contention-based uplink synchronization after receiving a synchronization request from the Node-B. The WTRU may enter an idle state instead of performing a handover to a new cell when the WTRU moves to the new cell. A discontinuous reception (DRX) interval for the WTRU may be set based on activity of the WTRU. |
US11711771B2 |
Method for evaluating the energy consumption of a service unit in a communications network
A method is described of evaluating the energy consumption of a service unit rolled out, or intended for being rolled out, on a given infrastructure of a communications network. The method includes determining the energy consumption W_no measured on the infrastructure in the absence of the service unit, determining the energy consumption W_yes measured on the infrastructure in the presence of the service unit, and obtaining the energy consumption induced by rolling out the service unit by calculating the difference (W_yes−W_no). The disclosed technology is applicable to 5G networks. |
US11711768B2 |
Method and apparatus for power control for wireless transmissions on multiple component carriers associated with multiple timing advances
A method and apparatus for power control for wireless transmissions are disclosed. A wireless transmit/receive unit (WTRU) may reduce transmission power to channels for carrier aggregation such that a total transmit power of the WTRU is smaller than or equal to a maximum transmission power level in all symbols of a transmission. Further, transmission power may be allocated to the channels for carrier aggregation based on priority. Also, transmission power may be allocated to a physical uplink control channel (PUCCH) or a physical uplink shared channel (PUSCH) with uplink control information over a PUSCH without uplink control information. Moreover, transmission power may be allocated to a PUCCH or a PUSCH over a sounding reference signal (SRS) transmission. Additionally, the WTRU may transmit data over one or more channels, of the channels for carrier aggregation, at the respective transmission power allocated to the one or more channels. |
US11711765B2 |
Method and apparatus for transmitting indication signaling, method and apparatus for receiving indication signaling, network side device, and user equipment
A method and an apparatus for transmitting indication signaling, a method and an apparatus for receiving indication signaling, a network side device and user equipment are provided. The method includes: transmitting indication signaling on a target physical resource or a target downlink control channel, wherein the indication signaling includes monitoring information for at least one UE, and the monitoring information includes at least one of: first indication information, used to indicate an activity state for at least one subsequent discontinuous reception (DRX) cycle; second indication information, used to indicate a DRX parameter configuration for the at least one subsequent DRX cycle; third indication information, used to indicate monitoring information of a downlink control channel to be monitored; fourth indication information, used to indicate a monitoring state in at least one subsequent paging occasion. |
US11711764B2 |
Autonomous wake on radio scheduler that schedules deterministic radio events to reduce involvement of primary processor
A wireless communication system including a radio, a processing circuit including a processor and wake on radio circuitry. The wake on radio circuitry uses programmed descriptors to autonomously schedule transitioning into and out of sleep mode to periodically awaken and turn on the radio and perform at least one radio frequency deterministic function while the processor remains in a low power state. The deterministic functions may include a receive function, a transmit function, or a combination of both. The descriptors may be programmed according to any one of different scheduling modes supported by different communication protocols including a timeslot mode and a constant-interval mode. The wake on radio circuitry includes a scheduler that coordinates with protocol circuitry of the radio for performing one or more deterministic functions. The scheduler may program a sleep controller for scheduling sleep modes between communication sessions for performing the deterministic functions. |
US11711760B2 |
Carrier selection in wireless network
According to an example aspect of the present invention, there is provided a method comprising: receiving, from a network node, before entering a power saving state, an indication of a dependency between frequencies and time instances; identifying at least one frequency based on the indicated dependency and a moment of time; and selecting a cell utilizing the identified at least one frequency. |
US11711755B1 |
System and method for remotely assessing, analyzing, evaluating, and ranking mobile network operator and country compatibility against mobile device spectrum and technology capabilities
A compatibility system for determining a technical compatibility of one or more electronic devices and one or more mobile network operators is disclosed. The compatibility system obtains data from a plurality of data sources and integrate the data to generate a platform that determines ability of at least one of: the electronic devices and the mobile network operators for a communication between each other. The compatibility system determines device attributes and network attributes by integrating the compatibility system with data related to electronic devices and mobile network operators respectively. The compatibility system evaluates radio bands supported by the electronic devices and mobile network operators and identifies potential carriers of the mobile network operators, and a plurality of known potential countries globally, which are compatible with the radio bands of the one or more electronic devices in order to determine the compatibility of the electronic devices and the mobile network operators. |
US11711753B2 |
Channel discovery in a small-cell network
During operation, the radio node may, using a first interface circuit, listen for transmissions from one or more second radio nodes. Based at least in part on the transmissions, the radio node may determine a first list of discovered channels associated with the radio node and the one or more second radio nodes. Then, the radio node may, using a second interface circuit, provide the first list of discovered channels to the one or more second radio nodes. Moreover, the radio node may, using the second interface circuit, receive one or more second lists of discovered channels from the one or more second radio nodes. Next, the radio node may aggregate the first list of discovered channels and the second list of discovered channels into a list of active channels. Furthermore, the radio node may, using the first interface circuit, provide the list of active channels to an electronic device. |
US11711751B2 |
Communication method and communications apparatus
This application provides a communication method and a communications apparatus. The method includes: determining a system frame number of a radio system frame in which a to-be-sent first broadcast channel PBCH is located, to obtain a first transport block, where the first processing manner is used to indicate some bits of the system frame number of the radio system frame in which the first PBCH is located, and the first MIB includes remaining bits, other than the some bits, of the system frame number of the radio system frame in which the first PBCH is located; and sending, by using the first PBCH, the first transport block in the radio system frame. |
US11711750B2 |
Control search space overlap indication
A user equipment (UE) may receiving, from a base station, a synchronization signal block (SSB) of a set of quasi-collocated (QCL) SSBs, the SSB comprising an indication of a parameter indicating information associated with a plurality of downlink control channel locations corresponding to the set of QCL SSBs. The UE may determine, based at least in part on the parameter, the plurality of downlink control channel locations corresponding to the set of QCL SSBs. The UE may receive a downlink grant for a system information based at least in part on monitoring one or more downlink control channel locations of the plurality of downlink control channel locations. The UE may receive the system information based at least in part on the downlink grant. The UE may establish a connection with the base station based at least in part on the SSB and the received system information. |
US11711747B2 |
Millimeter wave directional discovery signal design
Methods, systems, and devices for wireless communication are described. A transmitting device may select an orthogonal metric based at least in part on at least one of each direction of a plurality of directions to transmit millimeter wave discovery signals or a location parameter associated with the transmitting device. The transmitting device may transmit, in the each direction of the plurality of directions, the millimeter wave discovery signals, where the each transmitted millimeter wave discovery signal has a different orthogonal metric applied that was selected based at least in part on the at least one of the each direction or the location parameter. |
US11711744B2 |
Method and apparatus for interaction between an edge computing system and a mobile communication network for providing edge computing service
The disclosure relates to a 5G or pre-5G communication system for supporting a higher data rate after a 4G communication system such as LTE. A method according to an embodiment of the disclosure is a control method in an edge enabler server (EES) of a mobile edge computing system, and may include subscribing to a user plane path change event at an edge application server (EAS); determining an application context relocation (ACR) based on receiving a user plane path management event notification from the mobile communication network in case of subscribing to the user plane path change event for the EAS; transmitting an ACR request message to the EAS; receiving an EAS response message from the EAS; and transmitting an application function (AF) acknowledgment message to a first node of the mobile communication network in response to receiving the EAS response message from the EAS. |
US11711743B1 |
Architecture and protocols to support industrial internet of things and wireless programmable logic controller communications
Methods, systems, and devices for wireless communications are described. A wireless device may establish connectivity between the wireless device and a user equipment (UE) via a first communication path, and between the wireless device and the UE via a second communication path that includes a relay device. The wireless device may transmit, via the first communication path, a first message in a first format to the UE, including first data, and transmit, via the second communication path to the relay device, a second message in a second format and including the first data, the second format indicating that the relay device is to relay the first data to the UE. The relay device may receive, via a first portion of the second communication path, the first message and may transmit, to the UE via a second portion of the second path, a second message including the first data. |
US11711741B2 |
Methods and systems of an all purpose broadband network with publish subscribe broker network
An example system includes a server communicatively connected to a cellular base transceiver station having an RF coverage area and configured for RF communication with a first entity that is a transceiver device in the RF coverage area, wherein the server comprises a first publish-subscribe broker that is part of a publish-subscribe broker network that comprises one or more publish-subscribe brokers, wherein a second entity connected to any of the one or more publish-subscribe brokers in the publish-subscribe broker network accepts communications from the transceiver device if the second entity subscribes to data packets published by the transceiver device, and wherein the data packets published by the transceiver device are routed through the publish-subscribe broker to which the second entity is connected. |
US11711740B2 |
Handover execution notification of a wireless device
A first base station receives, from a wireless device, a measurement result of a cell of a second base station, and sends, to the wireless device and based on the measurement result, a command of a conditional handover towards the cell of the second base station. The command comprises at least one handover execution condition comprising at least one of a reference signal received power, a reference signal received quality, a first time value indicating a time offset for a decision of a handover execution, or a second time value indicating a time duration when the command of the conditional handover is valid. The first base station receives, from the wireless device and based on the wireless device determining that at least one criteria of the at least one handover execution condition is met by the cell, a handover execution notification indicating a random access procedure. |
US11711736B2 |
Apparatus, system and method for DC (dual connectivity)
A UE (10) provides information on potential S′eNB(s). The information is forwarded from an MeNB (20_1) to an M′eNB (20_2) such that the M′eNB (20_2) can determine, before the handover happens, whether the M′eNB (20_2) will configure a new SeNB (S′eNB) and which S′eNB the M′eNB (20_2) will configure. In one of options, the MeNB (20_1) derives a key S′-KeNB for communication protection between the UE (10) and the S′eNB (30_1), and send the S′-KeNB to the M′eNB (20_2). In another option, the M′eNB (20_2) derives the S′-KeNB from a key KeNB* received from the MeNB (20_1). The M′eNB (20_2) sends the S′-KeNB to the S′eNB (30_1). Moreover, there are also provided several variations to perform SeNB Release, SeNB Addition, Bearer Modification and the like, in which the order and/or timing thereof can be different during the handover procedure. |
US11711734B2 |
Dynamic protocol stack reset during radio handover
An apparatus of a base station (BS) of a radio access network (RAN) comprises memory and processing circuitry. The processing circuitry includes a central unit (CU) portion and a distributed unit (DUI) portion that implement a BS multi-layer protocol stack divided between the CU portion and the DU portion. The processing circuitry initiates a handover to change a serving cell of user equipment (UE). The handover includes a change in a portion of logical layers of the BS multi-layer protocol stack, and the processing circuitry encodes an information element for transmission to the UE indicating logical layers of a UE multi-layer protocol stack implemented in the UE to be reset by the UE in association with the handover. |
US11711727B1 |
Provisioning radio-based networks on demand
Disclosed are various embodiments for provisioning radio-based networks on demand. In one embodiment, a request to provision a radio-based network to cover an area is received. At least one radio access network operated by at least one communication service provider that covers the area is determined. A capacity is provisioned in the radio access network(s) for the radio-based network to cover the area. At least a portion of a core network is provisioned for the radio-based network in a cloud provider network. |
US11711726B1 |
System, method, and apparatus for providing optimized network resources
Systems, methods, and apparatuses for providing optimization of network resources. The system is operable to monitor the electromagnetic environment, analyze the electromagnetic environment, and extract environmental awareness of the electromagnetic environment. The system extracts the environmental awareness of the electromagnetic environment by including customer goals. The system is operable to use the environmental awareness with the customer goals and/or user defined policies and rules to extract actionable information to help the customer optimize the network resources. |
US11711722B2 |
Detecting airwave congestion and using variable handshaking granularities to reduce airwave congestion
A wireless sensing system includes a gateway node configured to wirelessly communicate with a plurality wireless nodes in an environment, and a first set of the plurality of wireless nodes, each wireless node of the first set configured to wirelessly communicate with the gateway node and to wirelessly communicate with other wireless nodes of the plurality of wireless nodes, each wireless node of the first set comprising a same first group identifier. The gateway node is configured to address the first set of the plurality of the wireless nodes by addressing all wireless nodes in the environment that broadcast the first group identifier. |
US11711717B2 |
Mobile network conditional policy execution based on UE geographic location
A network device receives, from a policy control function (PCF), at least one set of multiple user equipment device (UE)-location based conditional policy rules. The network device selects a first one of the multiple UE-location based conditional policy rules based on a first geographic location of a first UE, and controls data traffic associated with the first UE using the selected first one of the plurality of UE-location based conditional policy rules. |
US11711714B2 |
Systems and methods for client device roaming in a wireless network to provide lossless video transmission services
A device may receive threshold data identifying threshold ranges, and may receive, from a first access point of multiple access points, first network data identifying first quality measurement indicators associated with a first link. The device may determine whether a first quality of the first link is good, fair, or poor based on comparing the first network data and the threshold data, and may provide, to the first access point and when the first quality is determined to be poor, a request for second network data identifying second quality measurement indicators associated with multiple links between the device and the multiple access points. The device may receive, from the first access point, the second network data, and may select one of the multiple access points based on the second network data. The device may utilize a link associated with the one of the multiple access points to receive video data. |
US11711713B2 |
Starting a bandwidth part inactivity timer of an active bandwidth
A wireless device receives configuration parameters comprising a value for a bandwidth part inactivity timer. Downlink control information, indicating a resource assignment, is received on a primary cell. The bandwidth part inactivity timer of an active bandwidth part of the primary cell is started in response to determining that no random access procedure is ongoing on a secondary cell. A switch from the active bandwidth part to a default bandwidth part is made in response to an expiry of the bandwidth part inactivity timer. |
US11711707B2 |
Communication system and method for correlating wireless communication performance with vehicle system configurations
Systems and methods for correlating wireless communication performance with vehicle system configurations determine wireless message characteristics of wireless messages communicated with vehicles in vehicle systems and locations along a route where the wireless message characteristics were determined. The wireless message characteristics and the locations can be determined during movement of the vehicle systems along a route. Relative positions of the vehicles in the vehicle systems is obtained, and a signal propagation profile is determined based on the wireless message characteristics, the locations where the wireless message characteristics were determined, and the relative positions of the vehicles. The signal propagation profile can represent relationships between the wireless message characteristics, the relative positions of the vehicles, and the locations along the route. This profile can be used to control movement and/or communication of other rail vehicle systems, to generate trip plans for other vehicle systems, to diagnose communication faults, and the like. |
US11711705B2 |
Method and system for forming a network of network devices
A method and a system for forming a network of network devices, the method including providing a plurality of network devices in a physical environment, each of the plurality of network devices being controllable by a mobile network module connectable to the network devices. A network configuration device with a memory unit for storing device configuration data connects a mobile network module to the network configuration device. The mobile network module reads out the device configuration data stored in the memory unit of the network configuration device. The mobile network module connects to a network device and configuring the network device, based on the device configuration data. |
US11711703B2 |
Antenna monitoring system for distributed antenna systems
A communication system includes a signal source for transmitting downlink signals and receiving uplink signals to and from an indoor signal coverage area; and a distributed antenna system interposed between the signal source and the indoor signal coverage area. The distributed antenna system includes an antenna monitoring unit connected to at least one service antenna through a distribution network. The at least one antenna transmits and receives the downlink signals and the uplink signals to and from at least one terminal unit within the indoor coverage area. The antenna monitoring unit includes an RFID transceiver that communicates with at least one RFID tag attached to the at least one antenna and detects the location of a point of anomaly with respect to that one antenna when a signal from the at least one RFID tag is not received by the RFID transceiver, or when a power level measured by the RFID tag and reported back to the RFID transceiver falls below a predetermined threshold level. |
US11711692B2 |
Hardware-trusted ledger client for distributed ledgers that serve wireless network slices
A wireless communication network serves a wireless user device with a wireless communication service from a wireless network slice that includes a Virtual Network Function (VNF). The VNF maintains hardware-trust with a distributed ledger. The distributed ledger maintains hardware-trust with the VNF. The VNF delivers the wireless communication service to the wireless user device from the wireless network slice. The VNF generates slice data that characterizes the service delivery. When the VNF maintains the hardware-trust with the distributed ledger, the VNF transfers the slice data to the distributed ledger. When the distributed ledger maintains the hardware-trust with the VNF, the distributed ledger stores the slice data. |
US11711691B2 |
Applying network policies on a per-user basis
In one example, an Access Point (AP) configures a first mapping of a first cellular network connection to a first local access network group, and further configures a second mapping of a second cellular network connection to a second local access network group. The AP determines whether a user device is authorized to use the first cellular network connection or the second cellular network connection. If the user device is authorized to use the first cellular network connection, the AP associates, for the user device, a first user device identifier with the first local access network group. If the user device is authorized to use the second cellular network connection, the AP associates, for the user device, a second user device identifier with the second local access network group. |
US11711689B2 |
Secure localized connectionless handoffs of data
A connectionless system for handing off data, content or information includes a proximity detection component that allows devices to detect other local devices within range. Devices within range may use advertisement and scanning to exchange communications so that one device can handoff data, content, or information to another device without having to connect, e.g., pair, with the other device(s). |
US11711688B2 |
Overheating protection method for user equipment, device, user equipment, and base station
An overheating protection method for user equipment includes: sending a first signaling to a base station, the first signaling carrying indication information indicating that the user equipment has a capability of reporting a temporary capability of the user equipment; receiving a second signaling returned by the base station in response to the first signaling; and when the user equipment is overheated due to a wireless link configuration being too high, sending a third signaling for adjusting the wireless link configuration to the base station, the third signaling carrying assistance information indicating the base station to solve an overheating problem of the user equipment. |
US11711687B2 |
Method and apparatus for sending and receiving multi-carrier information in multi-carrier communication system
A method for sending and receiving multi-carrier information in a communication system supporting a multi-carrier includes sending by a base station system information to the terminal via a broadcast message, the system information regarding multi-carriers that the base station is able to support; receiving a unicast message from the terminal, the unicast message including information related to carriers that the terminal is able to support or prefers in the multi-carrier list included in the system information; and sending multi-carrier allocation information including a primary carrier and a second carrier that the terminal will use, to the terminal via a unicast message. |
US11711686B2 |
Method for controlling display of SIM card function menu and storage device for the same
The present disclosure provides a method of controlling a display of a SIM card function menu, the method including: determining whether a preset command corresponding to a corresponding preset function is received from the SIM card; and uninstalling a default function module corresponding to the preset function, in response to no preset command corresponding to the preset function being received from the SIM card. The present disclosure further provides a device having a storage function and a terminal. |
US11711684B2 |
Method and apparatus for provisioning physical signals and channels in a wireless network
Provisioning and communicating physical signals and channels in NR networks having a first subset of transmit and receive points that use a first cell ID and a second subset of transmit and receive points that use a second cell ID. Operations include transmitting from, and receiving from, a first transmit and receive point a first signal or channel wherein the first signal or channel is based on a first user equipment (UE) specific parameter assigned via the first subset of transmit and receive points and transmitting from, and receiving from, the first transmit and receive point the plurality of transmit and receive points a second signal or channel wherein the second signal or channel is based on a second UE specific parameter assigned via the second subset of transmit and receive points. A transmit and receive point and a UE for implementing the operations are also disclosed. |
US11711683B2 |
Sidelink discovery procedure
Methods, systems, and devices for wireless communications are described. In a first case, a first user equipment (UE) may transmit to a second UE a sidelink discovery message preamble corresponding to a sidelink discovery message. The first UE may identify resources for transmission of the sidelink discovery messages based on the sidelink discovery message preamble. The first UE may either transmit the sidelink discovery message to the second UE or may receive the sidelink discovery message from the second UE using the identified resources for the transmission of the sidelink discovery message. In some cases, the second UE may transmit sidelink control information (SCI) to the first UE, and may transmit a sidelink discovery message to the first UE based on resources identified in the SCI. In some cases, the first UE may transmit the sidelink discovery message without transmission of a preamble or a SCI. |
US11711680B2 |
Vehicle-to-vehicle maneuver sharing and coordinating
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment may transmit a maneuver message for a maneuver of a vehicle associated with the UE; perform a negotiation, with one or more other UEs, associated with the maneuver message, wherein the negotiation includes at least one of: indicating, in the maneuver message, one or more remote vehicle maneuvers, or receiving, from a UE of the one or more other UEs, a response to the maneuver message indicating a suggested maneuver for the vehicle of the UE; and perform an action based at least in part on performing the negotiation. Numerous other aspects are provided. |
US11711679B2 |
Context aware cloud service availability in a smart city by renting temporary data centers
The present invention may include a computer identifies an event in an area. The computer predicts a demand for one or more cloud services for the event. The computer identifies a vehicle in an area of the event, where the vehicle have a dynamic vehicle cloud server and the computer caches the one or more cloud services for the event to the dynamic vehicle cloud server. |
US11711675B2 |
Internet of things gateway systems and methods for oil and gas fields
Certain aspects of the present disclosure provide for wireless sensor packages to monitor various oilfield equipment health status, such as bearing wear and detect out-of-balance condition on reciprocating rod lifts (RRLs). Equipment health data can be collected, analyzed and stored by an IoT gateway, which is a small form-factor, ruggedized, low-power Intel processor computer running a novel message-oriented middleware software stack that leverages the MQTT protocol. Data may subsequently be transmitted to a cloud service via the internet via to a datacenter through SCADA, for analysis and action. |
US11711671B2 |
Systems and methods for determining mobile device status
Method and system for determining a status of a mobile device of a user are disclosed. For example, the method includes receiving first sensor data at a first time from an application installed on a mobile device of a user, determining a first location of the mobile device, immediately subsequent to receiving the first sensor data at the first time, receiving second sensor data at a second time from the application, the second time following the first time by a time interval, determining a second location of the mobile device, determining a distance between the first location and the second location, determining whether the distance corresponding to the time interval exceeds a predetermined threshold, and determining whether a trip log indicative of at least one trip during the time interval is received from the application. |
US11711663B2 |
Audio content playback method and apparatus for portable terminal
An audio content playback method for a portable terminal. The audio content playback method includes checking a channel that is supportable by audio content that is currently engaged in group's simultaneous playback, in group's simultaneous playback of the audio content. The method includes allocating a channel to each of devices included in a group based on position information of each device included in the group or based on an input state in a user interface environment that is preset for channel allocation for each device included in the group, and transmitting the allocated channel information to each device included in the group to allow the device to select its allocated channel and play the audio content. |
US11711662B2 |
Privacy device for smart speakers
Systems, apparatuses, and methods are described for a privacy blocking device configured to prevent receipt, by a listening device, of video and/or audio data until a trigger occurs. A blocker may be configured to prevent receipt of video and/or audio data by one or more microphones and/or one or more cameras of a listening device. The blocker may use the one or more microphones, the one or more cameras, and/or one or more second microphones and/or one or more second cameras to monitor for a trigger. The blocker may process the data. Upon detecting the trigger, the blocker may transmit data to the listening device. For example, the blocker may transmit all or a part of a spoken phrase to the listening device. |
US11711659B2 |
Bone conduction audio apparatus
A bone conduction audio apparatus includes at least one ear hook assembly. A main circuit board is provided in the ear hook assembly. Each ear hook assembly includes an operating unit, a line concentrator and a bone conduction transducer. Each operating unit is electrically connected with corresponding line concentrator by contact springs or connecting wires, and connected with the main circuit board via the line concentrator. Each bone conduction transducer is electrically connected with the main circuit board via corresponding line concentrator. A controller of the main circuit board receives touch signals from all operating units to determine and initiate relating earphone operating. The bone conduction audio apparatus adopts bilateral triggering interaction mechanism. The line concentrator is combined with the suspended bone conduction transducer. |
US11711657B2 |
Demodulation in a contact hearing system
In embodiments of the invention, the present invention is directed to a contact hearing system including: a transmit coil positioned in an ear tip wherein the transmit coil includes an electrical coil wound on a ferrite core; a receive coil positioned on a contact hearing device wherein the receive coil includes an electrical coil without a core; a load connected to the receive coil; and a demodulation circuit connected to the receive coil and the load wherein the demodulation circuit includes a voltage doubler and a peak detector. |
US11711654B2 |
Bone conduction speaker
The present disclosure relates to a magnetic circuit assembly of a bone conduction speaker. The magnetic circuit assembly may generate a first magnetic field. The magnetic circuit assembly may include a first magnetic element, and the first magnetic element may generate a second magnetic field. The magnetic circuit may further include a first magnetic guide element and at least one second magnetic element. The at least one second magnetic element may be configured to surround the first magnetic element and a magnetic gap may be configured between the second magnetic element and the first magnetic element. A magnetic field strength of the first magnetic field within the magnetic gap may exceed a magnetic field strength of the second magnetic field within the magnetic gap. |
US11711651B2 |
Bidirectional channel control systems, methods, devices and computer readable storagemeduums
A bidirectional channel control system, method, device, and non-transitory computer-readable storage medium based on Digital Enhanced Cordless Telecommunications is provided. The system comprises a transmitter, at least one receiver, an audio channel, and a text message control channel. The transmitter is configured to send an audio data stream to the at least one receiver through the audio channel. The transmitter is configured to send a control command to the one receiver through the text message control channel in a one-to-one single-point text message mode, and to receive a feedback result from the one receiver in response to the control command. Alternatively, the transmitter is configured to send a control command to each of the at least one receiver based on DECT protocol through the text message control channel in at least one of a one-to-many broadcast messaging mode and a one-to-one single-point messaging mode, and to receive a feedback result from each of the at least one receiver in response to the control command in the one-to-one single-point messaging mode. |
US11711650B2 |
Troubleshooting of audio system
A method, system, and apparatus for troubleshooting one or more multimedia devices of an audio system have been disclosed herein. An audio loopback device transmits a test signal to a first multimedia device. The first multimedia device, after receiving the test signal, generates a response signal. The audio loopback device triggers a priority controller based on an unsuccessful detection of the response signal. The priority controller troubleshoots a communicative coupling by at least changing a mode of operation of at least one of a first multimedia device or a second multimedia device from a first mode of operation to a second mode of operation. The first mode of operation or the second mode of operation may be utilized by the first multimedia device to establish the communicative coupling with the second multimedia device for delivering an audio signal of the second multimedia device on an audio device. |
US11711649B2 |
Method for audio signal noise cancellation, apparatus for audio signal processing, and electronic device
A method for audio signal noise cancellation is provided. In response to current noise cancellation coefficients being required to be updated to new noise cancellation coefficients, the digital signal processor calculates the new noise cancellation coefficients and writes the new noise cancellation coefficients into an idle storage module in the at least two storage modules, and the digital signal processor sends an update request for updating the noise cancellation coefficients to the active noise cancellation module. The update request carries position information configured to indicate a position of the storage module to which the new noise cancellation coefficients is written. The active noise cancellation module reads the new noise cancellation coefficients in the storage module indicated by the position information based on the position information carried in the update request, and performs noise cancellation processing according to the new noise cancellation coefficients after a current noise cancellation processing cycle ends. |
US11711645B1 |
Headset sound leakage mitigation
An audio system for a headset includes a plurality of speakers and an audio controller. The plurality of speakers may be in a dipole configuration that cancel sound leakage into a local area of the headset. The controller filters audio content presented by the plurality of speakers to further mitigate leakage of audio content into the local area. The audio determines sound filters based on environmental conditions, such as ambient noise levels, as well as based on the audio content being presented. |
US11711644B2 |
Earphone and worn detection device thereof
Disclosed by the present application are an earphone and a worn detection device thereof. The detection device comprises a sensing panel used for forming a battery encapsulated metal shell, a detection chip connected to an input end and the sensing panel and a control chip connected to an output end of the detection chip; a battery is arranged in an earphone handle of the earphone; the detection chip is used for detecting a sensing signal of the sensing panel and determining a wearing state of the earphone according to the sensing signal; and the control chip is used to adjust the working state of the earphone according to the wearing state. When a user wears the earphone, the earphone handle of the earphone contacts the skin of the user, a capacitance effect is formed between the sensing panel and the skin of the user, and a sensing signal is generated. The detection chip determines the wearing state of the earphone by means of the sensing signal, and the control chip adjusts the working state of the earphone according to the wearing state. The present application reuses the encapsulated metal shell as the sensing panel, which is conducive to the miniaturization of the earphone and the improvement of the sensitivity and reliability of detecting the wearing state. |
US11711641B2 |
RF immune microphone
The present disclosure relates to microphone devices. One microphone assembly includes a transducer and a housing. The microphone assembly includes an integrated circuit coupled to the transducer. The housing includes a port, a base, and a cover. The cover includes an inner wall and an outer wall. The inner wall and outer wall can be coupled to the base. The inner wall and the base are mechanically coupled and define an enclosed volume. The transducer is disposed in the enclosed volume. |
US11711638B2 |
Audience monitoring systems and related methods
Audience monitoring systems and related methods are described herein. An example audience monitoring system includes a beacon to be disposed proximate a media presentation device. The beacon is to transmit a ping signal. The system also includes a portable metering device to be carried by a person. The portable metering device includes a microphone to receive an audio signal and a processor to determine a distance value indicative of a distance between the portable metering device and the beacon based on the ping signal. |
US11711635B2 |
Image sensor and pixel array which generate a pixel signal based on a plurality of pixels, and operation method of the image sensor
An image sensor includes a pixel array including a first pixel and a second pixel which are connected to a first column line, and a row driver configured to control a read operation of the second pixel. A voltage of the first column line is determined based on a higher voltage among a voltage of a floating diffusion node of the first pixel and a voltage of a floating diffusion node of the second pixel during the read operation of the second pixel. |
US11711632B2 |
Image sensor including two boosting drivers
An image sensor comprises a row driver, a first row line which is connected to the row driver, first to fourth pixels connected to the first row line, first to fourth column lines connected to the first to fourth pixels and configured to receive respective first to fourth output signals from the first to fourth pixels, a boosting circuit connected to the first to fourth column lines, a second row line connected to the boosting circuit, first and second boosting drivers connected, respectively, to first and second terminals of the second row line. The boosting circuit may adjust voltage of the first and second output signals based on a first boosting enable signal received from the first boosting driver and may adjust a voltage of the third and fourth output signals based on a second boosting enable signal received from the second boosting driver. |
US11711631B2 |
Dynamic vision sensor architecture
A dynamic vision sensor (DVS) or change detection sensor reacts to changes in light intensity and in this way monitors how a scene changes. This disclosure covers both single pixel and array architectures. The DVS may contain one pixel or 2-dimensional or 1-dimensional array of pixels. The change of intensities registered by pixels are compared, and pixel addresses where the change is positive or negative are recorded and processed. Analyzing frames based on just three values for pixels, increase, decrease or unchanged, the proposed DVS can process visual information much faster than traditional computer vision systems, which correlate multi-bit color or gray level pixel values between successive frames. |
US11711629B2 |
Solid-state image pickup device and electronic apparatus
The present disclosure relates to a solid-state image pickup device and an electronic apparatus by which a phase-difference detection pixel that avoids defects such as lowering of sensitivity to incident light and lowering of phase-difference detection accuracy can be realized. A solid-state image pickup device as a first aspect of the present disclosure is a solid-state image pickup device in which a normal pixel that generates a pixel signal of an image and a phase-difference detection pixel that generates a pixel signal used in calculation of a phase-difference signal for controlling an image-surface phase difference AF function are arranged in a mixed manner, in which, in the phase-difference detection pixel, a shared on-chip lens for condensing incident light to a photoelectric converter that generates a pixel signal used in calculation of the phase-difference signal is formed for every plurality of adjacent phase-difference detection pixels. The present disclosure is applicable to a backside illumination CMOS image sensor and an electronic apparatus equipped with the same. |
US11711623B2 |
Video stream processing method, device, terminal device, and computer-readable storage medium
A video stream processing method, a device, a terminal device, and a computer-readable storage medium are provided, including steps for acquiring a first video stream through a first camera and acquiring a second video stream through a second camera in response to receiving a slow-motion shooting instruction, the slow-motion shooting instruction carrying a frame rate of a slow-motion video stream; encoding the first video stream and the second video stream into a third video stream with a third frame rate, the third frame rate being greater than the first frame rate, and the third frame rate being greater than the second frame rate; and acquiring a fourth video stream with a fourth frame rate through performing a frame interpolation algorithm on the third video stream, the fourth frame rate being the same as the frame rate of the slow-motion video stream. |
US11711618B2 |
Image processing apparatus, image processing method, and program
There is provided an image processing apparatus including a display image generation section configured to generate display image data by performing a display projection process in a case where panorama image data to be a display target is judged to be a full circumference panorama image. |
US11711616B2 |
Portable system including motorized base controller and transmitter for tracking a moving target
A system including a motorized base unit with a smart device mount for automatically orienting the smart device camera toward a moving target to track the moving target and take pictures or video. The target (e.g., a child playing soccer) wears a tracking tag comprising a GPS chip and transmitter packaged inside an athletic pad. The base unit includes a motorized mast for mounting a smart device. The base unit receives the transmitted GPS data, calculates updated pointing angle and angular velocity for the smart phone based on update location information from the remote tag sensor, calculates the correct angle that the smart phone should be pointed at, translates the new pointing directions to a control signal that turns the mast, which in turn causes the smart device camera to “follow” or track the target. |
US11711613B2 |
Image alignment for computational photography
Image frames for computational photography may be corrected, such as through rolling shutter correction (RSC), prior to fusion of the image frames to reduce wobble and jitter artifacts present in a video sequence of HDR-enhanced image frames. First and second motion data regarding motion of the image capture device may be determined for times corresponding to the capturing of the first and second image frames, respectively. The rolling shutter correction (RSC) may be applied to the first and second image frames based on both the first and second motion data. The corrected first and second image frames may then be aligned and fused to obtain a single output image frame with higher dynamic range than either of the first or second image frames. |
US11711604B2 |
Camera module array and assembly method therefor
The present application provides a camera module array, comprising at least two camera modules, wherein at least one of the camera modules has a free-form lens sheet, and the free-form lens sheet performs active alignment according to an actual imaging result received by a photosensitive chip, so that a difference between an actual reference direction of the free-form lens sheet and a reference direction determined by an optical design is not greater than 0.05 degrees. The present application further provides a corresponding assembly method for camera module array. In the present application, a TTL of the camera modules can be reduced by means of the free-form lens sheet so as to, for example, make a TTL of a wide-angle module equal or approximately equal to a TTL of a telephoto module, so that a dual-camera module composed of the wide-angle module and the telephoto module is easily mounted in a terminal device such as a mobile phone. The present application can also effectively improve the mounting precision of the free-form lens sheet. |
US11711603B1 |
Modular camera with interchangeable image head and sub-system bases
An image head including a housing, side rails, a port, and internal componentry. The housing includes a first side and a second side located opposite the second side. The side rails are located on or within the first side, the second side, or both and the side rails are configured to provide sliding directional control of the image head when connecting to a base. The port is configured to electrically connect the image head to the base. The internal componentry includes a printed circuit board; an integrated lens and sensor assembly (ISLA) configured to generate an image; and memory located on the printed circuit board configured to store the image. |
US11711601B2 |
Double barrels lens, lens module and assembling method therefor
The disclosure provides a double barrels lens, a lens module, and an assembling method therefor. The double barrels lens includes a first barrel and a second barrel. The first barrel comprises a first end, a second end and a lens group. External screw threads are provided on an outer surface of the second end. The second barrel includes a first end surface, a second end surface and an inner surface with internal screw threads. The internal screw threads of the second barrel are engaged with the external screw threads of the first barrel. A distance H between an optical center of the lens group and the second end surface of the second barrel, a focal length f of the lens group, and a correction coefficient α meet the expression: H=f+α. |
US11711599B2 |
Camera module
A camera module comprising: a housing; a lens assembly that is fixed to the housing and comprises at least one lens; a circuit board that is arranged inside the housing and comprises a first circuit board and a second circuit board, on which image sensors arranged to face the lens are mounted, respectively; and a first shield can arranged inside the housing so as to support edges of the first and second circuit boards. |
US11711597B2 |
Polygonal optical mechanism and optical system
An optical mechanism is provided. The optical mechanism includes an immovable part, a movable part, a drive assembly, and a guidance assembly. The movable part is connected to an optical element. The movable part is movable relative to the immovable part. The drive assembly drives the movable part to move relative to the immovable part. The guidance assembly guides the movable part to move along a first axis. |
US11711594B2 |
Dual image sensor package
An image sensor device includes two or more image sensor arrays (or two or more regions of an image sensor array) and a low-power processor in a same package for capturing two or more images of an object, such as an eye of a user, using light in two or more wavelength bands, such as visible band, near-infrared band, and short-wave infrared band. The image sensor device includes one or more lens assemblies and/or a beam splitter for forming an image of the object on each of the two or more image sensor arrays. The image sensor device also includes one or more filters configured to select light from multiple wavelength bands for imaging by the respective image sensor arrays. |
US11711593B2 |
Automated generation of banner images
Example systems and methods for automated generation of banner images are disclosed. A program identifier associated with a particular media program may be received by a system, and used for accessing a set of iconic digital images and corresponding metadata associated with the particular media program. The system may select a particular iconic digital image for placing a banner of text associated with the particular media program, by applying an analytical model of banner-placement criteria to the iconic digital images. The system may apply another analytical model for banner generation to the particular iconic image to determine (i) dimensions and placement of a bounding box for containing the text, (ii) segmentation of the text for display within the bounding box, and (iii) selection of font, text size, and font color for display of the text. The system may store the particular iconic digital image and banner metadata specifying the banner. |
US11711592B2 |
Distribution of multiple signals of video content independently over a network
A stereoscopic production solution, e.g., for live events, that provides 3D video asset distribution to multiple devices and networks is described. In some embodiments, live or recorded 3D video content may be accessible by different service providers with different subscribers/users and protocols across a network of the content provider. A first video signal corresponding to a first video feed for one eye of a viewer may be received and a second video signal corresponding to a second video feed for the second eye of the viewer may be received. The first video signal and the second video signal may be encoded. The encoded first video signal and the encoded second video signal may be transmitted independently over a network. The two video signals may be received and frame synced at an off-site location for eventual rendering to a display device. |
US11711587B2 |
Using manifest files to determine events in content items
Systems, methods, apparatuses are described for monitoring events in a plurality of different services. A system may monitor manifest files for one or more content items. Manifest files may contain manifest file tags indicating events and insertion opportunities. Events and/or insertion opportunities may be detected, and a switch from one content item to another content item, based on customized user priority preferences, may be caused. |
US11711585B2 |
Mobile terminal and video display apparatus
A mobile terminal has a communication processing unit that transmits, to a video display apparatus for displaying a broadcasted video content, a request for setting a viewing schedule of the video content. A storage unit stores a starting time of the video content for which the setting of the viewing schedule has been requested; and an information provision unit provides information to a user of the mobile terminal. A control unit determines whether the video display apparatus is existent around the mobile terminal. At a first predetermined time before the starting time, the information provision unit notifies the user of the first predetermined time. If the video display apparatus is not existent around the mobile terminal at a second predetermined time before the starting time, the information provision unit then notifies the user that it is the second predetermined time before the starting time. |
US11711584B2 |
Methods and systems for generating a notification
Methods and systems are disclosed herein for a media guidance application that alerts a user to the appearance of objects in media content that may be of interest to the user. For example, as media content progresses, the media guidance application may determine objects that may interest a user. The media guidance application may record the number of determined objects and present the number to the user as well as supplemental content associated with each object. |
US11711583B2 |
Learning activity duration for providing content during activity
Methods and systems are described for recognizing an activity and providing content for consumption during the activity. The methods and systems use an activity engine to learn a duration of an activity by receiving input with a start cue indicating a start of an activity and receiving input with a stop cue indicating an end of the activity. The activity engine determines an average or estimated duration for the activity based on the time difference between the start cue and the stop cue so that when the activity engine receives a third input and identifies the start cue, a content curation engine identifies one or more content items with a total runtime substantially similar to the average or estimated duration for the activity and provides the content for consumption. |
US11711582B2 |
Electronic apparatus and control method thereof
An electronic apparatus includes a processor. The processor is configured to: obtain information about weighted values respectively assigned to a plurality of items having values that represent content features of a plurality of pieces of content, wherein the weighted values are assigned as higher weight values to items corresponding to the content features preferred by according to genres of content; identify a user content viewed by a user of the electronic apparatus; calculate similarities in values of the plurality of items, respectively, between a plurality of pieces of recommendable content and the user content, respectively; calculate recommendation scores of the plurality of pieces of content, based on the calculated similarities and the weighted values assigned to the items according to the genres; and perform a recommendation operation for one or more content pieces, of which the calculated recommendation score is equal to or higher than a preset ranking. |
US11711581B2 |
Multimodal sequential recommendation with window co-attention
A multimodal recommendation identification system analyzes data describing a sequence of past content item interactions to generate a recommendation for a content item for a user. An indication of the recommended content item is provided to a website hosting system or recommendation system so that the recommended content item is displayed or otherwise presented to the user. The multimodal recommendation identification system identifies a content item to recommend to the user by generating an encoding that encodes identifiers of the sequence of content items the user has interacted with and generating encodings that encode multimodal information for content items in the sequence of content items the user has interacted with. An aggregated information encoding for a user based on these encodings and a system analyzes the content item sequence encoding and interaction between the content item sequence encoding and the multiple modality encodings to generate the aggregated information encoding. |
US11711579B1 |
Navigation integrated content stream
Techniques for generating an interactive and dynamically updated content stream are described herein. Data assets that correspond to video segments provided by a plurality of content providers may be maintained. A video segment may correspond to a first portion of a full video segment for a piece of content from the plurality of content providers. A content stream may be generated that includes video segments provided by the plurality of content providers based at least in part on the data assets. The content stream may be presented via an application. Second input may be received via the application during presentation of the content stream that corresponds to a navigation command for displaying different content. The content stream may be updated to at least one of removing certain video segments or adding new video segments to the content stream based at least in part on the second input. |
US11711578B2 |
Concurrent presentation of non-programming media assets with programming media content at client device
A system is provided for concurrent presentation of non-programming media assets with programming media content at a client device. The client device receives a response for occurrence of an event opportunity point from the media presentation and distribution system based on a selection criteria for the event opportunity point. A display view of the client device is modified, and a non-programming media asset is presented from a second media stream for a defined duration and different version of the programming media content in first partition, concurrently with the programming media content over second partition. The different version of the programming media content corresponds to the programming media content encoded based on a region within the modified display view allocated to the first partition. The presentation is based on user preference for specific item in the programming media content and user selection of the non-programming media asset displayed in past engagement. |
US11711571B2 |
Client-side offload of graphics effects processing
A server offloads graphics effects processing to a client device with graphics processing resources by determining a modification to a graphics effects operation, generating a portion of a rendered video stream using the modification to the graphics effects operation, and providing an encoded representation of the portion of the rendered video stream to the client device, along with metadata representing the modification implemented. The client device decodes the encoded representation to recover the portion of the rendered video stream and selectively performs a graphics effects operation on the recovered portion to at least partially revert the resulting graphics effects for the portion to the intended effects without the modification implemented by the server. |
US11711569B2 |
Method and device for adapting the video content decoded from elementary streams to the characteristics of a display
The present disclosure relates to a method and device for adapting a video content decoded from elementary streams to the characteristics of a display from at least one type of metadata giving information regarding said elementary streams. Such a method comprises:—obtaining (102) an additional information (HDR DESCR.) indicating the presence of one particular type of metadata;—determining if said video content decoded from elementary streams is display-able on said display (11) from said additional information (HDR DESCR.) and the characteristics of the display (EDID); and—if said video content decoded from elementary streams is determined as being displayable, selecting (105) a process from said additional information and the characteristics of the display and adapting (106) the video content according to the selected process. |
US11711566B2 |
Vehicle and method of controlling the same
A vehicle includes a plurality of broadcast reception antennae; a speaker; and an audio-video-navigation (AVN) device electrically connected to the plurality of broadcast reception antennae and the speaker; wherein the AVN device is configured to receive broadcast signals of a plurality of different frequencies from the plurality of broadcast reception antennae, synthesize the broadcast signals of different frequencies, and provide the synthesized broadcast signal to the speaker to output a sound corresponding to the synthesized broadcast signals. |
US11711563B2 |
Methods and systems for graphics rendering assistance by a multi-access server
An illustrative multi-access server receives a request from a client system, the request indicating a requested rendering operation. The multi-access server also accesses input data from an asset data source. The multi-access server performs a rendering pass on the input data, the rendering pass performed in accordance with the requested rendering operation to generate a render pass output dataset. The render pass output dataset is representative of a renderable image depicting image content in a first form having limited quality or detail. The render pass output dataset is also configured for use in generating fully-rendered image data that depicts the image content in a second form having additional quality or detail beyond the limited quality or detail of the first form. Corresponding methods and systems are also disclosed. |
US11711558B2 |
User classification based on user content viewed
A method implemented by one or more computing systems includes accessing content viewing data associated with a first user account, wherein the first user account is associated with one or more client devices. The content viewing data includes temporal-based content viewing data. The method further includes determining, using one or more sequence models, a set of content viewing features based on the temporal-based content viewing data, and concatenating the content viewing features into a single computational array. The method further includes providing, through one or more dense layers of a deep-learning model, the single computational array to an output layer of the deep-learning model, and calculating, based on the output layer, one or more probabilities for one or more labels for the first user account. Each label includes a predicted attribute for the first user account. |
US11711553B2 |
Transmission parameter control for segment delivery
A method of delivering a video sequence in a network, the sequence including a plurality of temporal segments encoded at a plurality of qualities, the method including storing a dataset indicating the relative size of segments of the video stream; computing in dependence on that dataset a time schedule for delivery of the segments, the time schedule indicating a target delivery time for each segment sufficient to deliver all the segments in the sequence in time for decoding and being independent of the encoded quality of each segment; for each segment: setting one or more transmission parameters for the segment in dependence on the target delivery time for the segment and the relative size of the segment; and delivering the segment over the network using the one or more transmission parameters. |
US11711550B2 |
Method and apparatus for supporting teleconferencing and telepresence containing multiple 360 degree videos
The disclosure relates to a 5th Generation (5G) or 6th Generation (6G) communication system for supporting a higher data transmission rate. The method of a first entity performing a media resource function (MRF) includes transmitting, to a second entity, a session description protocol (SDP) offer message for an SDP negotiation associated with a conference providing a plurality of 360-degree videos, and receiving, from the second entity, an SDP answer message. Wherein the SDP offer message includes a plurality of media descriptions for the plurality of 360-degree videos, and wherein, in case that a first 360-degree video of the plurality of 360-degree videos is originated from one of a plurality of sources at a conference location of the conference, a first media description for the first 360-degree video includes a content attribute for identifying a source from which the first 360-degree video is originated. |
US11711547B2 |
Use and signaling of refining video coding tools
An example method of video processing includes performing a conversion between a video picture of a video and a bitstream representation of the video. The bitstream representation conforms to a format rule. The format rule specifies that applicability of a Decoder-side Motion Vector Refinement coding tool and a Bi-Directional Optical Flow coding tool for the video picture are indicated separately in the bitstream representation. |
US11711544B2 |
Point cloud compression with supplemental information messages
A system comprises an encoder configured to compress attribute information and/or spatial for a point cloud and/or a decoder configured to decompress compressed attribute and/or spatial information for the point cloud. To compress the attribute and/or spatial information, the encoder is configured to convert a point cloud into an image based representation. Also, the decoder is configured to generate a decompressed point cloud based on an image based representation of a point cloud. Additionally, an encoder is configured to signal and/or a decoder is configured to receive a supplementary message comprising volumetric tiling information that maps portions of 2D image representations to objects in the point. In some embodiments, characteristics of the object may additionally be signaled using the supplementary message or additional supplementary messages. |
US11711540B2 |
Method for encoding video using effective differential motion vector transmission method in omnidirectional camera, and method and device
The present invention relates to an image encoding and decoding technique for a high-definition video compression method and device for an omnidirectional security camera, and more specifically, to a method and a device whereby a differential motion vector is effectively transmitted, and an actual motion vector is calculated using the transmitted differential motion vector, and thus motion compensation is performed. |
US11711536B2 |
Method and device for inducing motion information between temporal points of sub prediction unit
According to the present invention, there is provided A method of encoding a three-dimensional (3D) image, the method comprising: determining a prediction mode for a current block as an inter prediction mode; determining whether a reference block corresponding to the current block in a reference picture has motion information; when the reference block has the motion information, deriving motion information on the current block for each sub prediction block in the current block; and deriving a prediction sample for the current block based on the motion information on the current block. |
US11711535B2 |
Video-based point cloud compression model to world signaling information
Apparatuses, methods, and computer programs are disclosed to implement video-based cloud compression model to world signaling. An example apparatus includes at least one processor; and at least one non-transitory memory including computer program code; wherein the at least one memory and the computer program code are configured to, with the at least one processor, cause the apparatus at least to perform: provide first signaling information comprising information related to a world domain, wherein the world domain is a point cloud frame that is represented by a number of points in a first volumetric coordinate system; and provide second signaling information comprising information related to a conversion of a model domain to the world domain, wherein the model domain represents the point cloud frame by a number of points in a second volumetric coordinate system. |
US11711534B2 |
Method for encoding/decoding image signal, and device therefor
An image decoding method according to the present invention comprises the steps of: referring to a first flag for indicating whether intra block-based delta pulse code modulation (BDPCM) signaled through a sequence parameter set is permitted, so as to determine whether a second flag for indicating whether the intra BDPCM is applied to a current block is parsed; determining whether the intra BDPCM is applied to the current block on the basis of the second flag; determining an intra BDPCM mode of the current block when it is determined that the intra BDPCM is applied to the current block; and acquiring a residual sample of the current block on the basis of the intra BDPCM mode. |
US11711533B2 |
Method and apparatus for processing video signals using reduced transform
Provided is a method for decoding a video signal based on a reduced transform, which includes: checking whether a transform skip is applied to a current block; obtaining a transform index indicating a transform kernel of the current block from the video signal when the transform skip is not applied to the current block; determining a region where a primary transform is applied to the current block based on the transform kernel indicated by the transform index and a size of the current block; and performing an inverse primary transform on the region to which the primary transform is applied by using the transform kernel indicated by the transform index. |
US11711520B2 |
Video signal processing method and device
According to the present invention, there is provided a method of decoding an image, the method including: deriving an initial motion vector of a current block; determining a motion refinement vector of the current block; and determining a motion vector of the current block on the basis of the initial motion vector and the motion refinement vector. Herein, the initial motion vector is derived from any one of merge candidates included in a merge candidate list for the current block. |
US11711519B2 |
Method and apparatus for encoding/decoding video using maximum size limitation of chroma transform block, and method for transmitting bitstream
An image encoding/decoding method and apparatus are provided. An image decoding method performed by an image decoding apparatus may include determining a prediction mode of a current block, generating a prediction block of the current block based on inter prediction mode information, based on the prediction mode of the current block being an inter prediction mode, generating a residual block of the current block based on a transform block of the current block, and reconstructing the current block based on the prediction block and the residual block of the current bloc. |
US11711517B2 |
Method and system for processing luma and chroma signals
The present disclosure provides systems and methods for processing video content. The method can include: receiving data representing a first block and a second block in a picture, the data comprising a plurality of chroma samples associated with the first block and a plurality of luma samples associated with the second block; determining an average value of the plurality of luma samples associated with the second block; determining a chroma scaling factor for the first block based on the average value; and processing the plurality of chroma samples associated with the first block using the chroma scaling factor. |
US11711514B2 |
Joint transform coding of multiple color components
There is included a method and apparatus comprising computer code configured to cause a processor or processors to perform receiving video data in an AOMedia Video 1 (AV1) format comprising data of at least two chroma prediction-residual signal blocks, a transformation between at least one signal block, having a size less than or equal to a combination of the chroma prediction-residual signal blocks, and the chroma prediction-residual signal blocks, and decoding the video data based on an output of the transformation comprising the at least one signal block having the size less than or equal to the combination of the chroma prediction-residual blocks. |
US11711510B2 |
Palette mode coding in prediction process
Devices, systems and methods for video processing are described. An example method for video processing includes determining, for a conversion between a current block of a video and a bitstream representation of the video, a number of intra-coded neighboring blocks of the current block for a combined inter and intra prediction mode according to a rule that specifies a manner of treating a block coded using a palette coding mode in counting the number of intra-coded neighboring blocks for the combined inter and intra prediction mode. The method also includes performing the conversion based on the determining. |
US11711509B2 |
Early video equipment failure detection system
A video camera system including: one or more video cameras; a video recorder in communication with each of the one or more video cameras; a video analytics module, the video analytics module being a computer program product embodied on a computer readable medium, the computer program product including instructions that, when executed by a processor, cause the processor to perform operations including: obtaining video parameters of a plurality of video frames received at the video recorder, the plurality of video frames being transmitted from the one or more video cameras to the video recorder; determining an abnormality within the video parameters; and identifying a malfunctioning video camera of the one or more video cameras that produced the abnormality within the video parameters. |
US11711498B2 |
Efficient conjugate illumination system for LCD projector and projection method thereof
An efficient conjugate lighting system for an LCD projector, includes an LED light source, a square cone condenser, a collimating lens, a quarter-wave plate, a brightness-enhancing polarizer, an LCD light valve, a field lens and a projection lens which are provided in sequence according to a direction of light travel; wherein the efficient conjugate lighting system for the LCD projector further comprises a reflecting mirror provided at an entrance port of the square cone condenser; a light-transmitting surface of the entrance port of the square cone condenser is bisected along a horizontal centerline or a vertical centerline to form a first sub-light-transmitting surface and a second sub-light-transmitting surface; a light-emitting surface of the LED light source is provided on the first sub-light-transmitting surface, and the reflector is provided on the second sub-light-transmitting surface. |
US11711496B2 |
Wireless camera network
A wireless camera network is disclosed. The wireless camera network includes a first camera and one or more other cameras. After an input is received by the first camera, the first camera records images or video, and the first camera wirelessly transmits a start signal to one or more other cameras to also start recording images or video and to also wirelessly transmit the start signal. |
US11711491B2 |
Video image de-interlacing method and video image de-interlacing device
A video image de-interlacing method is provided. The method-includes: acquiring a single frame of original video image; extracting odd field data and even field data in an original video image; performing N-1 times of down-sampling on the odd field data to obtain N-1 odd field data with different resolutions and performing N-1 times of down-sampling on the even field data to obtain N-1 even field data with different resolutions; combining odd field data and even field data with the same resolution to obtain a down-sampled image; and inputting the original video image and the down-sampled image to the de-interlacing network for de-interlacing. |
US11711488B2 |
Configurable storage granularity for video/image recording
A memory system having multiple address tables to translate logical addresses to physical addresses at different granularity levels is disclosed. For example, a first address table is associated with a first block size of translating logical addresses for accessing system files and application files; and a second address table is associated with a second block size of translating logical addresses for storing and/or retrieving data from an image sensor of a surveillance camera. A user interface can be used to access a configuration option to specify the second block size; and a user may indicate a typical size of an image or video file to be recorded by the surveillance camera to calculate the second block size and thus configure the second address table for a partition to record the image or video files. |
US11711487B2 |
Comprehensive video collection and storage
A video collection system comprising a body-wearable video camera, a camera dock, and a video collection manager. The camera dock is configured to interface with the body-wearable video camera having a camera-memory element. The camera dock includes a dock-memory element configured to receive and store video data from the camera-memory element. The video collection manager is communicatively coupled with the camera dock. The camera dock sends at least a portion of the video data to the video collection manager. |
US11711484B2 |
System and method for image stitching
A system for stitching images together is disclosed. The images are sometimes referred to as frames, such as frames in a video sequence. The system comprises one or more imagers (e.g. cameras) that work in coordination with a matching amount of custom code modules. The system achieves image stitching using approximately one third the Field of View (FOV) of each imager (camera) and also by increasing the number of imagers to be above a predetermined threshold. The system displays these stitched images or frames on a computer monitor, either in a still-image context but also in a video-context. Normally these tasks would involve a great detail of computation, but the system achieves these effects while managing the computational load. In stitching the images together, it is sometimes necessary to introduce some image distortion (faceting) in the combined image. The system ensures no gaps in any captured view, and assists in achieving full situational awareness for a viewer. |
US11711479B2 |
Printing system
A printing system includes: a first printing unit that performs printing on a medium on the basis of first printing data; a first inventing unit that is located downstream from the first printing unit in a transportation direction specific to the medium and performs an inverting operation that is an operation of inverting front and back sides of the medium; a second printing unit that is located downstream from the first inverting unit in the transportation direction and performs printing on the medium on the basis of second printing data; and a control unit that determines whether the first inverting unit needs to perform the inverting operation, on the basis of whether the second printing data indicates a printing page for the front or back side of the medium. |
US11711474B2 |
Reading device and image forming apparatus
A reading device and an image forming apparatus. The reading device includes a reader disposed at a scanning position, the reader being configured to read an image formed on a surface of a sheet, a movement mechanism to move the reader between the scanning position and a separated position away from the scanning position, and a reference plate disposed at a first position facing a reading face of the reader, the reference plate being configured to obtain a reference value to be used when the reader reads the image. In the reading device, the reference plate rotates around an axis from a second position facing a side of the reader to the first position or from the first position to the second position in conjunction with movement of the reader from the scanning position to the separated position by the movement mechanism The image forming apparatus includes the reading device. |
US11711473B2 |
Image forming apparatus
An image forming apparatus that is capable of wireless communication with an operation device and that can be operated by the operation device via the wireless communication, the image forming apparatus comprising: an image forming unit configured to perform image formation on a sheet based on a print execution instruction sent from the operation device via the wireless communication; a reading unit configured to perform reading of an image formed on the sheet based on a scan execution instruction sent from the operation device via the wireless communication; and a controller that, during a period of time from the time one user logs in the image forming apparatus until the user logs out, (1) is configured to prohibit the print execution instruction using an operation device by other user who has logged in using the operation device, and (2) is configured to permit the scan execution instruction using the operation device. |
US11711469B2 |
Contextualized speech to text conversion
Methods, computer program products, and systems are presented. The methods, computer program products, and systems can include, for instance: determining, in performance of an interactive voice response (IVR) session, prompting data for presenting to a user, and storing text based data defining the prompting data into a data repository; presenting the prompting data to the user; receiving return voice string data from the user in response to the prompting data; generating a plurality of candidate text strings associated to the return voice string of the user; examining the text based data defining the prompting data; augmenting the plurality of candidate text strings in dependence on a result of the examining to provide a plurality of augmented candidate text strings associated to the return voice string data; and evaluating respective ones of the plurality of augmented candidate text strings associated to the return voice string data; and selecting one of the augmented candidate text strings as a returned transcription associated to the return voice string data. |
US11711467B2 |
System and methods for chatbot and search engine integration
A system and method for chatbot and search engine integration comprising chatbot crawler engine configured to detect all possible paths through a conversational flow between a chatbot and a user, and also comprising a chatbot search integration manager configured to receive a processed conversation flow from the chatbot crawler engine, parse the conversation flow to identify keywords and features, and build an indexable data structure which can be integrated into search engines in order to expose the information and data contained within the chatbot's knowledge base. This integration may allow search engine users to be redirected to a website hosting the chatbot when an indexed data structure comprises information relevant to a search engine query. |
US11711464B2 |
Spam telephone call reducer
Methods, systems, and apparatus, including computer programs encoded on a computer storage medium, for implementing a spam telephone call reducer are disclosed. In one aspect, a method includes the actions of receiving first telephone call data that reflects telephone calls received by a first user and second telephone call data that reflects telephone calls received by a second user. The actions further include comparing the first telephone call data and the second telephone call data. The actions further include determining that the first user received more spam telephone calls than the second user. The actions further include determining a first characteristic of the first user and a second characteristic of the second user. The actions further include determining an action that increases a similarity of the first characteristic to the second characteristic. The actions further include performing the action on the first characteristic. |
US11711463B2 |
Telephone advertisement system, telephone advertisement method, and computer readable medium storing telephone advertisement program
A telephone advertisement system acquires, in response to receiving a telephone talk request from a caller to a callee, callee information indicating a callee from a caller terminal device of the caller. The telephone advertisement system acquires, based on the acquired callee information, advertisement content associated with a condition corresponding to an attribute of the callee among a plurality of pieces of advertisement content, each of the plurality of piece of advertisement content associated with a condition of a person to whom respective advertisement content is presented, the condition of the person stored in a predetermined storage. The telephone advertisement system transmits the acquired advertisement content to the caller terminal device to cause the caller terminal device to present the advertisement content within an invitation period during which the callee is being invited to answer an incoming call. |
US11711461B1 |
System and method for flagging and decommissioning compromised telephone numbers prior to use for outbound calling
A system and method for flagging and decommissioning compromised telephone numbers prior to use for outbound calling which employ a dialing system having access to a set of direct inward dial numbers which define or correspond to telephone number identifiers, a plurality of discrete call receiving devices which operate on different telephone networks, and a server which confirms whether calls placed by the dialing system were flagged as undesirable by the call receiving devices and can modify the set of direct inward dial numbers based on such a confirmation. Through this configuration, the server is able to identify in real time whether the telephone numbers defined by or corresponding to each of the direct inward dial numbers in the set of direct inward dial numbers is compromised or is otherwise undesirable for outbound calling and then flag and decommission such a compromised telephone number. |
US11711460B2 |
Method and device for managing incoming calls in a communication terminal
A method for managing an incoming call in a communication terminal is described, the incoming call having an associated call identifier. The method can comprise checking the routing of an outgoing call to the call identifier associated with the incoming call, and classifying the incoming call on the basis of the result of the checking of the routing, the incoming call being classified as a malicious incoming call if the checking of the routing reveals that the outgoing call is not able to be routed. The method can be used, for example, to detect malicious calls or spam. |
US11711459B2 |
Adaptable communication techniques for electronic devices
Improved approaches for users of electronic devices to communicate with one another are disclosed. The electronic devices have audio and/or textual output capabilities. The improved approaches can enable users to communicate in different ways depending on device configuration, user preferences, prior history, etc. In one embodiment, the communication between users is achieved by short audio or textual messages. |
US11711457B2 |
System for providing sound source reproduction information
The present invention relates to a system for providing sound source reproduction information and has an object to provide a system for providing sound source reproduction information, in which the sound source reproduction information is provided for each user in the order of their distance from each user, and a user selectively browses sound source information of other users reproduced in the vicinity thereof and generates a synchronization request signal for the sound source information, such that reproduction of the sound source may be synchronized between users without performing any settings with each other. |
US11711456B2 |
Flexible display device and flexible display apparatus
A flexible display device and a flexible display apparatus are provided. The flexible display device includes a flexible display module; an attaching frame fixed and connected with the flexible display module; a bending component disposed below the flexible display module, and fixed and connected with the attaching frame; and an elastic layer disposed between the flexible display module and the bending component, and attached on a bottom of the flexible display module. The elastic layer is bendable around a bending axis. Thus, the characteristics of easy assembling and flatness can be improved. |
US11711450B2 |
System, method, and computer program product for improved embedded application data management
Embodiments of the present disclosure provide for improved interoperable data management between a user-accessed software application and an embedded software application. In some contexts, a user-accessed application provides both its own functionality as well as enabling access to functionality of an embedded application. The embedded application is accessed via a data-driven connection that provides several technical advantages and addresses various data interoperability and persistence problems. In some embodiments, a user-accessed application may be configured to provide functionality of multiple embedded applications consistent with the innovations herein described. |
US11711448B2 |
Compression schemes for relaying prior to decoding
Certain aspects of the present disclosure provide compression schemes for relaying prior to decoding. A method that may be performed by a wireless relay node includes receiving, from a transmitter node, a first packet intended for a receiver node, compressing pre-decoded samples of the first packet according to a compression scheme, and transmitting, to the receiver node, a second packet including the compressed pre-decoded samples. |
US11711445B2 |
Configurable access-based cache policy control
Various embodiments of the present disclosure relate to a computer-implemented method of receiving a header associated with an object, where the header includes a limit value that specifies a quantity of times the object is to be served from a cache device before revalidation, and a current count value that specifies a number of times that the object has been served since a most-recent revalidation or load, receiving a request for the object from a requesting device, and upon determining that the current count value is below the limit value, serving the object to the requesting device from the cache device, or upon determining that the current count value matches the limit value, transmitting a request for revalidating the object. |
US11711442B2 |
Push notification delivery system
An example method for delivery of push notifications includes receiving a push notification including a message and a destination, creating a send token, sending a push notification derived from the received push notification and the send token, and receiving push information concerning a processing of the sent push notification which is identified by the send token. An example system for delivering push notifications includes a server system having a processor, memory, and a network interface, where the memory stores program instructions including code segments for receiving a received push notification via the network interface. In this example, the program instructions further includes code segments for creating a send token, code segments for sending a sent push notification derived from the received push notification and the send token via the network interface, and code segments for receiving received push information concerning a processing of the sent push notification are provided. |
US11711441B2 |
Method and apparatus for publishing video synchronously, electronic device, and readable storage medium
Embodiments of the present invention provide a method and apparatus for publishing a video synchronously, an electronic device, and a readable storage medium. The method comprises: receiving a video publishing request by means of a first video publishing platform, wherein the video publishing request comprises a video identification, a user identification, and a video synchronization identification of a video to be published, and the video synchronization identification is used for identifying a second server corresponding to at least one second video publishing platform required to synchronously publish said video; and in response to the video publishing request, sending the video publishing request to a first server corresponding to the first video publishing platform, so that the first server sends, on the basis of the video synchronization identification, the video identification and the user identification to the second server. |
US11711434B2 |
Information transmission method and device
One or more implementations of the present specification provide an information transmission method. Target information selected by a user of a first computing device is obtained by the first computing device. A unique identifier is obtained by the first computing device and from a second computing device, subsequent to the second computing device receiving the unique identifier from a server. The unique identifier is associated with the second computing device according to a mapping relationship. The unique identifier and the target information are sent to the server. The server identifies the second computing device associated with the unique identifier from the mapping relationship and forwards the target information to the second computing device. |
US11711432B1 |
Remote management of application settings
In various implementations, a computer-implemented method for remotely managing settings of applications includes receiving a network communication from a managed device, the received network communication including a client-side hash value. The method further includes identifying settings for an application on the managed device in response to the receiving of the network communication, where the identified settings include configuration instructions for the application. Based on a comparison between the received client-side hash value and a server-side hash value that corresponds to the identified settings, at least some of the identified settings are transmitted to the managed device. The transmitting of at least some of the identified settings can be based on the comparison indicating a mismatch between the received client-side hash value and the server-side hash value. The method may also include completing processing of the received network communication after the transmitting of the at least some of the identified settings. |
US11711431B2 |
Internet of things configurable event and action sequencing framework
Internet of Things (IoT) configurable event and action sequencing mechanisms for interconnecting various IoT events together to achieve an event and action sequencing process that may efficiently enable complex uses of the data available in IoT systems. |
US11711427B2 |
Data acquisition system and method
Provided are a data acquisition system and method. The system includes: data acquisition units, to acquire a plurality of pieces of data related to a target object within a data acquisition period; and a controller, communicatively connected to the data acquisition units, to set, according to an ith data acquisition period, a sampling interval time of the ith piece of data, and to set a polling interval time according to a minimum data acquisition period of the data acquisition units. Upon the controller starting to perform polling on the data acquisition units through n_1 polling interval times until a condition is satisfied for the first time, the controller performs first polling, for the ith piece of data, on a data acquisition unit of the data acquisition units for acquiring the ith piece of data. |
US11711425B1 |
Broadcast and scatter communication operations
According to an aspect, a computer-implemented method for performing distributed communication operations includes receiving a request, by a first computing system, to perform a distributed communication operation and obtaining, by the first computing system, a tree structure for performing the distributed communication operation, wherein the first computing system is a root node of the tree structure. The method also includes creating, by the first computing system, a message having header information and a payload for the distributed communication operation and transmitting, by the first computing system, a portion of the message to each child node of the first computing system, wherein the portion transmitted to each child node is unique. |
US11711421B2 |
System and method using peer-to-peer connections for a distribution interaction session
A system for facilitating a distribution interaction session between two or more user devices through peer-to-peer connections comprises a processor associated with a server. The processor is configured to receive a request from a first user device to initiate a distribution interaction session between the first user device and a second user device via a distribution interaction application. The first user device has established a peer-to-peer connection with the second user device based on geolocation information. The processor is further configured to initiate the distribution interaction session from the distribution interaction application and to receive account information from the first user device through data streaming between the first user device and the server. The processor is further configured to determine an account associated with a first user based on the received account information and to conduct the distribution interaction session between the first user and a second user. |
US11711420B2 |
Automated management of resource attributes across network-based services
A provider network hosting multiple network-based services that implement different resources for a client may provide automated management of resource attributes across the multiple network-based services. A client may send a request to a resource attribute service implemented at the provider network to add a resource attribute to different resources implemented among different network-based services that satisfy resource metadata selection criteria. In response to receiving the request, resource metadata maintained for the different resources implemented among the different network-based resources, which may include one or more previously applied resource attributes, may be evaluated to identify those resources that satisfy the resource metadata selection criteria. For those resources that satisfy the resource metadata selection criteria, the resource attribute may be added to the resource metadata maintained for the different resources. |
US11711418B2 |
Providing content to co-located devices with enhanced presentation characteristics
Methods, systems, and apparatus include computer programs encoded on a computer-readable storage medium, including a method for providing content. A user of an initiating device is identified. Profile information for the identified user is located. The initiating device includes a display for presenting content to the user. An indication is received from an application running on the initiating device of an intent by the user to receive a first content item on a separate but co-located presentation device having enhanced presentation characteristics for presenting content. Additional content items are selected for delivery along with the first content item. The selection includes identifying a second different content item based on the profile information for the identified user and the enhanced presentation characteristics. The first and second different content items are delivered directly to the co-located presentation device without delivering the first and second different content items to the initiating device. |
US11711417B2 |
Method and system for providing watermark to subscribers
A method for providing watermark to subscribers is provided. The method comprises observing a request for a first content from a subscriber, determining if the subscriber can receive a watermark, generating a second content comprising the watermark if the subscriber can receive a watermark, causing the subscriber to fetch the first content, and causing the subscriber to fetch the second content comprising the watermark overlaying the first content. |
US11711416B2 |
Signal processing method and signal processing apparatus
A signal processing method includes obtaining, by a signal processing apparatus, a network delay time with respect to a device connected to the signal processing apparatus via a network, obtaining an input signal, determining an allowable upper limit of a delay time for an output signal corresponding to the obtained input signal based on the obtained network delay time and a total allowable delay time, selecting a signal processing having a longest delay time that is less than or equal to the allowable upper limit of the delay time, performing the selected signal processing on the obtained input signal, and transmitting the obtained input signal on which the selected signal processing has been performed, as the output signal, to the device connected to the signal processing apparatus via the network. |
US11711414B2 |
Triggering changes to real-time special effects included in a live streaming video
Method for triggering changes to real-time special effects included in a live streaming video starts with a processor transmitting in real-time a video stream captured by a camera via a network. The processor causes a live streaming interface that includes the video stream to be displayed on the plurality of client devices. The processor receives a trigger to apply one of a plurality of special effects to the video stream and determines a first special effect of the plurality of special effects is associated with the trigger. The processor applies in real-time the first special effect to the video stream to generate a video stream having the first special effect and transmits in real-time the video stream having the first special effect via the network. The processor causes the live streaming interface that includes the video stream having the first special effect to be displayed on the plurality of client devices. Other embodiments are disclosed. |
US11711410B2 |
Systems and methods for encoding and sharing content between devices
Systems and methods for sharing content between devices are disclosed. To request a shared piece of media content, a playback device generates and sends a request to content server. The playback device includes information in the request that indicates the playback capabilities of the device. The content server receives the request and determines the playback capabilities of the playback device from the information in the request. The content server then determines the assets that may be used by the playback device to obtain the media content and generates a top level index file for the playback device that includes information about the determined assets. The top level index file is then sent to the playback device that may then use the top level index file to obtain the media content using the indicated assets. |
US11711401B2 |
Digital trust broker and end to end trust assurance in multi-domain, multi-operator and cloud networks for high security environments
System and methods of brokering trust across multiple Authentication and Authorization methods in a multi-domain, multi-operator, private and public cloud networks are identified. A Digital Trust Broker (DTB) is disclosed that brokers trust between infrastructure authentication methods that use digital certificates (PKI) and operator/enterprise Authentication/Authorization methods through interaction with multiple operator/service provider control and management platforms. The Digital Trust Broker interacts with vendor management and security platforms for associating device manufacturing, assembly, supply-chain, and logistics attributes for assuring trust of compute, network, storage and other system components that a high security enterprise or service provider acquires and installs in their networks. Additionally, methods of generating enhanced certificates for secure network slices and other Cloud and SDN hosted virtual network functions as trust assured services are also disclosed. |
US11711400B2 |
Electronic access control system
Systems and methods for providing controlled access to a system by a user device include receiving, from a user device, a request including a current context. The method includes receiving a request for access to a computing resource, the request including a current context, the current context defining a user space and a resource space. The user device evaluates the current context against a security policy. The user device determines that the user device is permitted to access the computing resource based on the request in response to the evaluating the current context against the security policy. In response to determining that the user device is permitted to access the computing resource, accessing the computing resource as requested. |
US11711398B2 |
Distributed network security service
A distributed network security service is disclosed. The disclosed platform comprises an external service that facilitates security operations for a private network. Data from nodes of the private network is received and analyzed by the service. An output is automatically generated by the service in response to a detected security event in the analyzed data that facilitates remediating the security event at least at one or more of the nodes of the private network, wherein a latency exists between the security event occurring on the private network and being remediated during which time an entity responsible for the security event has access to the private network before being blocked. |
US11711397B2 |
Network routing and security within a mobile radio network
In an example embodiment, A PICNEEC is provided. It includes one or more Virtual Customized Rules Enforcer (VCRE) instances, each VCRE instance corresponding to a group of mobile devices and defining a set of policies personalized for the group of mobile devices. Each VCRE is configured to, upon receiving a data packet communicated between a packet-based network and a mobile device in the corresponding group via a radio network, execute one or more policy rules stored in the VCRE instance to the data packet prior to forwarding the data packet. Each VCRE instance is controlled independently of one another via direct accessing of the VCRE instance by a different customer of the mobile network provider. |
US11711395B2 |
User-determined network traffic filtering
A device processes a communication between a source and user equipment. The user equipment is one of a plurality of user equipment connected to a network and the user equipment is associated with an entity. The device determines that the communication is associated with an anomalous traffic pattern. The device implements a provisional blocking of traffic between the source and the plurality of user equipment connected to the network and generates a filtering rule based on determining the anomalous traffic pattern, where the filtering rule prescribes that traffic between the source and the second user equipment is to be blocked. The device transmits a notification to the entity associated with the user equipment that requests that the entity affirm the filtering rule, and the device blocks traffic between the source and the user equipment based on the entity affirming the filtering rule. |
US11711393B2 |
Methods and systems for managing website access through machine learning
A method may include obtaining a request to unblock a predetermined website in a network and that is associated with a predetermined list. The predetermined list may be used to determine whether a respective user device among various user devices can access one or more websites. The method may further include determining an impact level of the predetermined website for an organization using a machine-learning algorithm and website gateway data. The method may further include determining a probability of a security breach using the machine-learning algorithm and threat data. The method may further include determining whether to unblock the predetermined website based on the impact level and the probability of a security breach. The method may further include transmitting, in response to determining that the predetermined website should be unblocked, a command that modifies the predetermined list to enable the respective user device to access the predetermined website. |
US11711392B2 |
System for attack protection in IoT devices
An Internet of Things device is herein disclosed. The Internet of Things device comprises a communications module having circuitry to communicatively connect to a computer network, a memory operable to store data, a processor coupled to the memory and the communications module and operable to execute instructions stored in the memory, and an activity module, including at least one of a sensor and a control device. The activity module operates under control of the processor to perform a designated activity with at least one of the sensor and the control device. The activity module further communicates on the computer network via the communications module. The processor curtails a volume of communication of the communications module on the computer network if a measured value of a system parameter exceeds a threshold value. |
US11711390B1 |
Techniques for data routing and management using risk classification and data sampling
Techniques described and suggested herein include various systems and methods for determining risk levels associated with transiting data, and routing portions of the data in accordance with the determined risk levels. For example, a risk analyzer may apply risk classifiers to transiting data to determine overall risk levels of some or all of the transiting data. A traffic router may route transiting data according to determined risk profiles for the data. A sandbox may be implemented to compare, for a given input, expected and observed outputs for a subset of transiting data, so as to determine risk profiles associated with at least the subset. |
US11711387B2 |
Security management device, security management method, and computer program executed by security management device
A security management device includes a management unit, a determination unit, and an output unit. The management unit is configured to manage an anomaly location of an anomaly in a system in which a plurality of electronic controllers are connected through a network, and an anomaly amount in the anomaly location. The determination unit is configured to determine whether or not to implement countermeasures against the anomaly based on the anomaly location and the anomaly amount. The output unit is configured to output an instruction based on a determination result by the determination unit. |
US11711386B2 |
Multi-state messenging anomaly detection for securing a broadcast network
An electronic device is disclosed, which is connectable with a CAN bus or other broadcast network. The electronic device programmed to compute expected periods and period variability metrics for historical accumulations of messages for different message headers and to identify periodic message headers based on the period variability metrics, and is further programmed to detect a temporal anomaly as a deviation of a period of a most recent set of two or more messages with a periodic message header from the expected period for the periodic message header, and to generate an alert indicating the detected temporal anomaly. The electronic device may be further programmed to maintain a state machine for a vehicle (or other platform) including the CAN bus and perform state-aware anomaly detection. |
US11711385B2 |
Real-time detection of anomalous content in transmission of textual data
Aspects of the disclosure relate to real-time detection of anomalous content in a transmission of textual data. A computing platform may monitor, in real-time and via a computing device, a transmission of textual data from a user device. Then, the computing platform may scan, via the computing device, a content of the textual data. The computing platform may then perform, via the computing device and based on the scanning, textual analysis of the scanned content. Subsequently, the computing platform may detect, in real-time and based on the textual analysis, an anomalous pattern indicative of secure enterprise information. Then, the computing platform may trigger, via the computing device, one or more security actions to prevent the transmission of the secure enterprise information. |
US11711382B2 |
Method and system of deducing state logic data within a distributed network
A method and system for securing an operating domain that spans one or more distributed information technology networks is disclosed. In the present invention, a state machine reference monitor, comprising a monitor port operatively connected to one or more network traffic capture devices positioned across a distributed network of an operating domain, with each traffic capture interception network device in communication with a central server. Each interception network device along with the central server having a processor and a memory comprising instructions, which when executed by each device processor perform the method of extracting logic state data and deducting ancillary logic state data across the distributed operating domain. |
US11711379B2 |
Distributed digital security system
A distributed security system can include instances of a compute engine that can execute either locally in security agents on client devices or as cloud instances in a security network. Event data can be processed by elements of the distributed security system according to centrally-defined ontological definitions and/or configurations. Bounding managers of local security agents can control how much event data is sent to the security network. A storage engine in the security network can store event data received from client devices, can route event data to other elements of the security network, including cloud instances of the compute engine. An experimentation engine of the security network can also at least temporarily adjust other elements of the distributed security system during experiments or tests. |
US11711373B2 |
Platform-based authentication for external services
Providing access to an external application includes receiving login credentials to access a client instance, wherein the login credentials are associated with a user account, causing the client instance to provide a link to an external application in the client instance, detecting a request to navigate to the external application from the link, generating a authentication record for the user account and the external application, storing information for the user account based on the authentication record, and generating a URL for the external application based on the authentication record. Providing access to the external application also includes receiving, from a remote client device hosting the external application, an authorization request comprising nonce information, determining that the user account is authorized to access the external application based on the authentication table, and providing access to the external application. |
US11711372B2 |
Network resource privacy negotiation system and method
A method for accessing a network resource including detecting an attempt by a user via a computing device to access a service enabled by a computing system via a network and transmitting via the network to the computing system a first request to access the service in response to detecting the attempt by the user to access the service, the first request including at least one empty personally identifiable data structure. A failure to access the service responsive to the first request is determined. A second request to access the service in response to the first failure to access the service is transmitted via the network to the computing system, the second request including artificial personally identifiable information, and access to the service from the computing system is received for the user. |
US11711367B2 |
Continuing a media access control security (MACsec) key agreement (MKA) session upon a network device becoming temporarily unavailable
A network device may communicate with another network device via a media access control security (MACsec) key agreement (MKA) communication link, wherein an MKA session has been established between the network device and the other network device. The network device may determine that the other network device is unavailable. The network device may cause, based on determining that the other network device is unavailable, an MKA state of the network device to be placed in a paused state. The network device may receive, after causing the MKA state of the network device to be placed in the paused state, a packet from the other network device via the MKA communication link. The network device may determine, based on the packet, that the MKA session has not ended. The network device may continue, based on the MKA session having not ended, the MKA session by reactivating the MKA state. |
US11711365B2 |
Integrated circuit performing fast unbreakable cipher
An authentication and encryption protocol is provided that can be implemented within a single clock cycle of an integrated circuit chip while still providing unbreakable encryption. The protocol of the present invention is so small that it can co-exist on any integrated circuit chip with other functions, including a general purpose central processing unit, general processing unit, or application specific integrated circuits with other communication related functionality. |
US11711359B2 |
Authentication based on a physical key
A device may obtain registration data associated with a registration of an individual. The registration data may include an image that depicts a physical key and a reference object. The device may process the image to identify a first feature of the physical key and a first measurement of the first feature based on the size of the reference object. The device may store first feature data based on the first feature and the first measurement. The device may obtain second feature data based on a second feature of the physical key and a second measurement of the second feature identified from an insertion of the physical key into a keyhole of an authentication mechanism. The device may determine whether the first feature data corresponds to the second feature data. The device may authenticate the individual based on determining that the first feature data corresponds to the second feature data. |
US11711358B2 |
Expedited user authentication
A system for granting access to an account at an access device includes a computer server having a hardware processor and a memory storing a software code. The hardware processor executes the software code to receive a login request from the access device through a first communications socket, open a second communications socket between the access device and the computer server, transmit a verification request message including a required call-to-action to a verification device through a third communications socket, and receive a verification response message verifying that the required call-to-action has been completed at the verification device. Upon receiving the verification response message, the software code sends an access token for accessing the account to the access device through the second communications socket, receives the access token from the access device, and grants the access device access to the account. |
US11711354B2 |
System and method for cloud-based analytics
A system and method in accordance with example embodiments may include systems and methods for a cloud-based analytics platform. The cloud-based analytics platform may allow the manual and automatic uploading to and/or downloading from a cloud server. The platform may include single sign-on (SSO) capabilities such that a user may have one set of credentials to access data from the cloud-based analytics and/or data stored locally. The platform may include data validation and processing in order to provide real-time feedback on uploads based on file type, file size, access rights, extracted data, and transformed data. |
US11711352B2 |
Systems and methods to prevent private data misuse by insider
Described embodiments provide systems and methods for protecting private data or confidential information. A device can receive a request from a client for a page from a server that includes confidential information to be verified with an owner of the confidential information. The device may be intermediary between the client and the server. Prior to providing the page to the client for rendering, the device may replace a first user interface (UI) element having the confidential information in the page, with a second UI element to obfuscate the confidential information. The device may receive an activation of the second UI element to request the owner to verify the confidential information from the client. The device may send to the client an update to the page to include an indication of whether the confidential information has been correctly verified with the owner. |
US11711350B2 |
Systems and processes for vaultless tokenization and encryption
A system for vaultless tokenization and encryption includes an iframe service for collecting data and a tokenization service for (de)tokenizing and encrypting/decrypting data. The system is accessible to users and partners that submit requests causing various functions to be executed by the system. The functions include, but are not limited to, providing (de)tokenization and/or encryption services, and managing and creating templates for iframe collection, (de)tokenization, and encryption/decryption. A template service facilitates generation of templates that parametrize collection of original data via served iframe elements, tokenization and/or encryption of original data, and detokenizing and/or decrypting tokens to recover original data. An iframe service is configured for providing a virtual terminal, an iframe that provides users direct access to (de)tokenization and/or decryption/encryption services. Access to system services is managed via identifiers that include authentication credentials and parameters for performing (de)tokenization and/or encryption/decryption processes. |
US11711349B2 |
Methods and systems for secure cross-platform token exchange
Systems and methods are disclosed for cross-platform token exchange. One method comprises receiving a primary token exchange request from an upstream entity, generating an ancillary detokenization request based on the primary token exchange request, and transmitting the ancillary detokenization request to an input token vault. An ancillary detokenization response comprising sensitive data may then be received from the input token vault, and one or more ancillary tokenization requests may be generated based on the ancillary detokenization response and the primary token exchange request. The one or more ancillary tokenization requests may be transmitted to one or more output token vaults. Subsequently, one or more ancillary tokenization responses may be received from the one or more output token vaults, each ancillary tokenization response comprising an output token. A primary token exchange response may be generated based on the one or more ancillary tokenization responses and transmitted to the upstream entity. |
US11711346B2 |
System and method for neutral application programming interface
Systems and methods for neutral application programming interfaces are disclosed. In one embodiment, the disclosure relates to a system for neutral application programming interfaces. The system may comprise a device. The device may be configured to receive a request. The request may comprise an outer payload and an inner payload. The device may be further configured to parse the outer payload based on a common definition of the outer payload. The device may be further configured to extract information of an action from the outer payload. The device may be further configured to parse the inner payload based on a definition of the action. The device may be further configured to process the action. |
US11711345B2 |
Split tunnel-based security
There is disclosed in one example a computing apparatus, including: a hardware platform including a processor and a memory; a network interface; an operating system including a native internet protocol (IP) stack; and a security agent, including instructions encoded within the memory to instruct the processor to: establish a split virtual private network (VPN) tunnel with a remote VPN service; receive outgoing network traffic; direct a first portion of the outgoing traffic to the VPN tunnel, including determining that the first portion includes an outgoing domain name service (DNS) request; and direct a second portion of the outgoing traffic to the native IP stack. |
US11711341B2 |
System for securing a cyber-physical method
The invention relates to an industrial system comprising machines, systems for controlling machines connected by a first communication network, and a gateway intended to connect the first communication network to a second communication network. The gateway comprises a memory and comprises a processor configured to copy to the memory first data transmitted over the second communication network and relating to the operation of the machines. |
US11711339B1 |
Network plugin for multiple network interfaces
A new host is detected being added to a network cluster, wherein each of a plurality of hosts are on the network cluster. Available interfaces on each of the plurality of hosts on the network cluster are detected responsive to detecting the new host being added. A classless inter-domain routing (CIDR) range is calculated for hosts and interfaces on the network cluster using the available interfaces. Pod routes with interface range and L3 host routes are set for each host. |
US11711335B2 |
Communication method applied to edge computing scenario, storage medium, and electronic device
A communication method is provided. The method includes transmitting a network address assignment request to the network address translation entity after establishing a general packet radio service (GPRS) tunneling protocol (GTP) tunnel between the first user-plane function entity and the second user-plane function entity, such that the network address translation entity assigns a network address to the GTP tunnel, notifying the network address assigned by the network address translation entity to the GTP tunnel to the central data network, controlling a data packet to be transmitted by the edge service node to the central data network to be transmitted through the GTP tunnel, the network address translation entity replacing a source address of the data packet with the network address, and transmitting the data packet to the central data network after the data packet arrives at the network address translation entity. |
US11711332B2 |
System and method for conversation-based notification management
A method for dynamic notification management at a head mounted display (HMD) includes presenting, at the HMD, an augmented reality display, receiving, at a processor controlling the HMD, a notification from an application for display at the HMD, receiving, at the processor at a first time, first sensor data from one or more of a camera or a microphone, determining, based on the first sensor data, a first value of one or more factors associated with a probability that a user of the HMD is currently in a real-world conversation, determining an importance value of the received notification at the first time, and determining whether to display the notification from the application based on a comparison of the first value of the one or more factors associated relative to the importance value of the received notification. |
US11711331B2 |
Cross-channel orchestration of messages
Disclosed embodiments herein related to a message management server that provides a platform for message publishers to build message series with different messages that are transmitted to message recipients via different channels. A message publisher may specify triggering conditions for a message series. The message management server may automatically identify message recipients to receive an initial message. The message management server may continue to monitor event notifications related to the message recipients and send subsequent messages in the series to the message recipients when conditions are met. Each message may be sent via a different channel as specified by the message recipients. The platform may include a graphical user interface to provide previews of the messages as rendered in various end user device models when the messages are delivered via the specified channels. |
US11711329B2 |
Occasionally-connected computing interface
Described are computer-based methods and apparatuses, including computer program products, for allowing a user to switch between interfacing with a service through a network or through short message service (SMS). A chat service is executed through which a first user at a first computer can communicate directly with a second user at a second computer. A request is received from the first computer to enable the first user to interface with the chat service through a mobile device of the first user using SMS instead of through the network using the first computer. The chat service is configured to interface with the mobile device through SMS, including communicating chat information through SMS to the first user's mobile device, and communicating control information through SMS to the first user's mobile device such that the first user can control a full functionality of the chat service using SMS. |