最新美国发明专利第2021-02-02期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US10907222B2	Primers for detecting influenza by using lamp, and use thereof Disclosed are: a primer set enabling the specific detection, by an isothermal amplification method, of an influenza A virus, an influenza A subtype H3 virus, an influenza A subtype pdm H1N1 virus, and an influenza B virus; a composition or a kit comprising the same; and a method for detecting influenza viruses by using the same. The primers and the method, according to the present application, can detect, in a rapid manner and with high sensitivity and specificity, whether influenza virus infection occurs, and enable detection without separate treatments after the completion of the amplification, thereby improving convenience.
US10907221B2	Engineered genetic enteric sensor bacteria and uses thereof The disclosure relates to genetic engineered bacteria having a genetic memory circuit, compositions thereof, formulations thereof, methods of analyses and method of treatment of conditions related to the gastrointestinal tract including the mouth and the stomach.
US10907213B2	Mitochondrial mutations and rearrangements as a diagnostic tool for the detection of sun exposure, prostate cancer and other cancers Mitochondrial DNA deletions useful for the detection of cancers and sun exposure are provided. In particular, methods and kits for detecting mitochondrial DNA deletions for the early detection, diagnosis and progression of prostate cancer, sun exposure and non-melonoma skin cancer are provided.
US10907212B2	Inhibitors of cell adhesion Nectin-4 and Nectin-1 in cancer progression/development and as a therapeutic target for cancer.
US10907206B2	Methods of preparing and analyzing cell-free nucleic acid sequencing libraries Aspects of the invention relate to methods for preparing and analyzing a sequencing library from a mixed cell-free DNA (cfDNA) sample, wherein the mixed sample includes double-stranded DNA (dsDNA), damaged dsDNA (e.g., nicked dsDNA), and single-stranded DNA (ssDNA) molecules. The subject methods facilitate the collection of information from dsDNA, ssDNA and damaged DNA (e.g., nicked DNA) molecules in a sample, thereby providing enhanced diagnostic information as compared to sequencing libraries that are prepared from dsDNA alone.
US10907204B2	Primer extension target enrichment Improved methods and compositions are provided herein for primer extension target enrichment of target polynucleotides.
US10907200B2	Compositions and methods for nucleic acid amplification The disclosure provides compositions and methods for amplifying nucleic acids.
US10907198B2	Assay systems for genetic analysis The present invention provides assays systems and methods for detection of chromosomal abnormalities and status of single loci associated with monogenic or polygenic traits in a sample containing nucleic acids from a maternal and a fetal source.
US10907197B2	Probes for imaging huntingtin protein Provided are imaging agents comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and methods of their use.
US10907193B2	Methods and systems for the detection of ricin and other ribosome inactivating proteins A device, method, and system for the detection of ribosome inactivating protein activity, including the ricin toxin, in a sample. According to one embodiment, the ribosome inactivating protein in the sample removes an adenine from a labeled DNA substrate to create an abasic site. An AP lyase can then cleave the DNA substrate at the abasic site, allowing the fluorophore located at or near one end of the DNA substrate and the quencher at or near the other end of the DNA substrate to spatially separate. Once the fluorophore and the quencher are sufficiently separated, the fluorophore will emit a fluorescence signal. Increasing fluorescence, indicating ribosome inactivating protein activity, will be monitored in real time using a detection system.
US10907192B2	Systems and methods for artificial test strip controls A linearity standard includes a plurality of calibration solutions, each calibration solution having a different level of a reactant having a known response in a test strip and meter combination, and an electronic storage medium for storing calibration instructions and known responses for each solution of the plurality of calibration solutions.
US10907183B2	Process for enzymatic hydrolysis of lignocellulosic material and fermentation of sugars The invention relates to a process for the preparation of a fermentation product from lignocellulosic material, comprising the following steps: a) optionally, pre-treatment of the lignocellulosic material, b) optionally, washing of the optionally pretreated lignocellulosic material, c) enzymatic hydrolysis of the optionally washed and/or optionally pretreated lignocellulosic material using an enzyme composition comprising at least two cellulases and whereby the enzyme composition at least comprises LPMO, and optionally purifying the hydrolysed lignocellulosic material, d) fermentation of the hydrolysed lignocellulosic material to produce a fermentation product, and e) optionally, recovery of a fermentation product, wherein oxygen is consumed in amounts corresponding to between 20 and 5000 mmol molecular oxygen per kg glucan present in the lignocellulosic material, the oxygen is added after the pretreatment and before and/or during the enzymatic hydrolysis of the lignocellulosic material, preferably in an amount corresponding to at least 30 mmol molecular oxygen per kg glucan present in the lignocellulosic material, more preferably in an amount corresponding to at least 40 mmol molecular oxygen per kg glucan present in the lignocellulosic material, and most preferably in an amount corresponding to at least 50 mmol molecular oxygen per kg glucan present in the lignocellulosic material is consumed.
US10907182B2	Thermostable fructose-6-phosphate-3-epimerase and a method for producing allulose using the same The present disclosure relates to fructose-6-phosphate-3-epimerase consisting of an amino acid sequence of SEQ ID NO: 1, a nucleic acid encoding the fructose-6-phosphate-3-epimerase, and a transformant comprising the nucleic acid. Additionally, the present disclosure relates to a composition for producing allulose, which comprises the fructose-6-phosphate-3-epimerase of the present disclosure, and a method for producing allulose using the fructose-6-phosphate-3-epimerase of the present disclosure.
US10907176B2	Methods and compositions for targeted gene transfer The present invention provides AAV capsid proteins comprising a modification in the amino acid sequence and virus capsids and virus vectors comprising the modified AAV capsid protein. The invention also provides methods of administering the virus vectors and virus capsids of the invention to a cell or to a subject in vivo.
US10907175B2	Isolated human cell with an inactivated glucocorticoid receptor gene Disclosed herein are methods and compositions for inactivation of the human glucocorticoid receptor (GR) gene by targeted cleavage of genomic DNA encoding the GR. Such methods and compositions are useful, for example, in therapeutic applications which require retention of immune function during glucocorticoid treatment.
US10907170B2	Increasing levels of nicotinic alkaloids in plants Four genes, A622, NBB1, PMT, and QPT, can be influenced for increasing nicotinic alkaloid levels in Nicotiana plants, as well as for synthesizing nicotinic alkaloids in non-nicotine producing plants and cells. In particular, overexpressing one or more of A622, NBB1, PMT, and QPT may be used to increase nicotine and nicotinic alkaloid levels in tobacco plants. Non-nicotine producing cells can be engineered to produce nicotine and related compounds by overexpressing A622 and NBB1.
US10907165B2	Methods of enhancing translation ability and stability of RNA molecules, treatments, and kits The present invention relates to methods of enhancing the translation ability and stability of an RNA molecule. The methods involve providing a cell-free composition comprising an RNA molecule to be translated, where the RNA molecule lacks an N6,2′O-dimethyladenosine (“m6Am”) residue. Also disclosed are methods of making RNA molecules and treatment methods using an RNA molecule comprising a 7-methylguanosine (“m7G”), a 5′ triphosphate linker (“-ppp-”), and an N6,2′-0-dimethyladenosine (m6Am).
US10907163B1	Aptamers that bind to natural and synthetic cannabinoids The subject invention provides materials and methods for single-step detection of small molecules, e.g., natural and synthetic cannabinoids, in a sample. The subjection invention provides nucleic acids materials, e.g., aptamers (nucleic acid oligonucleotides) that can bind to natural and/or synthetic cannabinoids. The method for detecting a natural or synthetic cannabinoid in a sample comprises contacting the sample with an aptamer-based sensor selective for the natural or synthetic cannabinoid, and sensitively and rapidly detecting the natural or synthetic cannabinoid in the sample. The aptamer-based sensor comprises aptamers that can specifically binds to natural and/or synthetic cannabinoids with nanomolar dissociation constant.
US10907153B2	Treatment of heart disease by inhibtion of the action of muscle A-kinase anchoring protein (mAKAP) The present invention provides a method of protecting the heart from damage, by administering to a patient at risk of such damage, a pharmaceutically effective amount of a composition which inhibits the interaction of RSK3 and mAKAPβ, or the expression or activity of one or both of those molecules. This composition is preferably in the form of an siRNA construct, more preferably an shRNA construct, which inhibits the expression of mAKAPβ.
US10907152B2	Compositions and methods for controlling arthropod parasite and pest infestations This application provides and discloses anti-parasitic, anti-pest or insecticidal nucleic acid molecules and their calmodulin target genes for the control of arthropod parasites and pests. In particular, this application provides and discloses insecticidal nucleic acid molecules that target Varroa calmodulin gene sequences. This application further provides methods and compositions for the control and treatment of parasites and pests in Apis mellifera (honey bee) hives.
US10907150B2	Modified guide RNAs, CRISPR-ribonucleotprotein complexes and methods of use Described herein are modified guide RNAs such as a single guide RNA including, from 5′ to 3′, a single-stranded protospacer sequence, a first complementary strand of a binding region for the Cas9 polypeptide, an aptamer that binds a biotin-binding molecule, and a second complementary strand of the binding region for the Cas9 polypeptide. Also described is an RNP complex including the modified guide RNA and a Cas9 polypeptide or active fragment thereof. Also included are methods of modifying target genes in cells using the modified guide RNAs.
US10907148B2	Method and kit for analyte detection The present invention relates to a method and kit for analyte detection. More precisely the invention relates to a method of detecting an analyte, comprising storing short single stranded nucleic acids (10-100 nt), such as aptamers and micro RNA, on a solid support at ambient temperature; and subsequent amplification of said nucleic acids for detection of analyte(s).
US10907146B2	Nucleic acid extraction method using solid subject The present invention relates to a ribonucleic acid (RNA) extraction method using a solid subject, the method including activating a subject with a reactive amine group, injecting a sample having 1×101 to 1×103 cells/ml and a dimethyl suberimidate (DMS) compound or a dimethyl pimelimidate (DMP) compound into the subject, and forming a complex having the RNA within the sample and the compound, and extracting the RNA by treating elution buffer to the subject on which the complex is formed. The subject, particularly, the thin film device used for extracting the RNA, has improved hydrophilicity compared to the conventional silicon substrate, so that RNA is extracted more efficiently.
US10907145B2	Chemotherapeutic drug-conjugated resins and their preferential binding of methylated DNA Ligands and methods for selectively binding hypermethylated DNA from a sample. The ligands include a CG-region binding molecule-conjugated resin derived from the aminoglycoside antibiotic amikacin. Furthermore, the CG-region binding molecule may be conjugated to the resin with a crosslinker and/or may be modified with one or more of long chain and short chain alkyl, aryl, piperazinyl, piperidyl, and pyrrolidyl groups. Such ligands are used in methods for contacting a sample to thereby selectively bind hypermethylated DNA.
US10907140B2	Mutant beta-glucosidase variants with increased thermostability A mutant β-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.
US10907139B2	Compositions comprising a modified GIcNAc-1-phosphotransferase and methods of use thereof The disclosure provides a modified UDP-GlcNAc:Lysosomal Enzyme GlcNAc-1-phosphotransferase with enhanced ability to phosphorylate lysosomal enzymes and methods of use thereof.
US10907134B2	Mutated genes for the catalytic protein of oplophorus luciferase and use thereof Luciferases which are different from those known heretofore have been desired. A luciferase mutant comprising an amino acid sequence in which at least one amino acid selected from the group consisting of valine at the position of 44, alanine at the position of 54 and tyrosine at the position of 138 is substituted with other amino acid(s) in the amino acid sequence of SEQ ID NO: 2.
US10907129B2	Apparatus for processing samples containing biological cells An apparatus and a method for the automated processing of samples containing biological cells—in particular, of blood samples or other cell samples is provided. The apparatus has a sample receiving device configured to receive samples, an auxiliary material receiving device configured to receive auxiliary materials, a sample carrier receiving device configured to receive sample carriers, a discharge device configured to discharge samples from a discharge position, and a capture device configured to capture discharged samples in a capture position to obtain prepared samples, and at least one temperature control device for controlling the temperature of at least one of the sample carriers. The distance between the discharge position and the capture position can be adjusted to a prespecified height. The method includes wetting a temperature-controlled sample carrier with at least one auxiliary material and discharging the sample onto the wetted temperature-controlled sample carrier from a prespecified height.
US10907126B2	Self-contained biological indicator A biological sterilization indicator includes a housing having a first enclosure and a second enclosure, an ampule containing a liquid growth medium, and an insert disposed at least partially in the first enclosure. A portion of the ampule may be disposed inside the first enclosure. The insert may have a platform including a top surface, an abutment surface, and a side surface, as well as a first void disposed in the platform and configured to allow passage of a first volume of the liquid growth medium into the second enclosure and a second void disposed through at least a portion of the side surface and configured to allow passage of a second volume of the liquid growth medium into the second enclosure.
US10907125B2	Flow through electroporation modules and instrumentation The present disclosure provides a flow-through electroporation device configured for use in an automated multi-module cell processing environment and configured to decrease cell processing time and the risk of clogging.
US10907119B2	Fermentation cooling system A fermentation system includes a vessel defining a chamber for holding liquids and including a lower aperture, an insulating jacket disposed around the vessel, and a cooling fluid disposed between the insulating jacket and the vessel, the cooling fluid being in fluid communication with a fluid pump. A beverage line operably couples the lower aperture with a dispensing spigot, the beverage line being wrapped around the vessel and at least partially submerged in the fluid. The system further includes a collar disposed proximate the conical bottom portion of the vessel, the collar including a gasket in abutting contact with the insulating jacket.
US10907118B2	Use of ethyleneoxy and propyleneoxy copolymer to control rheology of unit dose detergent pack A unit dose detergent pack includes a pouch and a detergent composition encapsulated within the pouch. The detergent composition includes a surfactant component including an alcohol ethoxy sulfate having a C8-C20 backbone that is ethoxylated with from about 1 to about 10 moles of ethylene oxide and is present in an amount of from about 5 to about 30 weight percent actives, water present in a total amount of from about 5 to about 30 weight percent, and a particular liquid block copolymer present in an amount of at least about 0.5 weight percent actives. The detergent composition has a viscosity of less than about 5,000 cps when diluted with additional water at about a 2:1 weight ratio of the detergent composition:water. The block copolymer is incorporated as a rheology modifying agent.
US10907115B2	Solventless winterization of microbial oil Provided herein are methods for winterizing oil. The methods include heating the oil to a first temperature and maintaining the oil at the first temperature for a first period of time; reducing the first temperature of the oil after the first period of time to a second temperature over a second period of time, wherein reducing the first temperature produces a first solid fraction and first liquid fraction of the oil; removing the first solid fraction from the oil; reducing the second temperature of the first liquid fraction of the oil over a third period of time to a third temperature, wherein reducing the second temperature of the oil produces a second solid fraction and second liquid fraction of the oil; removing the second solid fraction from the oil; and recovering the second liquid fraction of the oil.
US10907110B2	Process for treating gasoline The present application relates to a process for treating gasoline, comprising the steps of: contacting a gasoline feedstock with a mixed catalyst and subjecting it to desulfurization and aromatization in the presence of hydrogen to obtain a desulfurization-aromatization product; optionally, splitting the resulting desulfurization-aromatization product into a light gasoline fraction and a heavy gasoline fraction; and, optionally, subjecting the resulting light gasoline fraction to etherification to obtain an etherified oil; wherein the mixed catalyst comprises an adsorption desulfurization catalyst and an aromatization catalyst. The process of the present application is capable of reducing the sulfur and olefin content of gasoline and at the same time increasing the octane number of the gasoline while maintaining a high yield of gasoline.
US10907108B1	Method for removing sulfur-containing contaminants from a thermally cracked waste oil A method for removing sulfur containing contaminants from a thermally cracked waste oil is disclosed. In the present invention, the substantial amount of contaminants containing sulfur is separated into a solvent and further remaining contaminants can be separated via adsorption with bauxite such that an end product oil having better quality may be produced with higher productivity. The solvent can be subject to flash evaporation and then be recycled.
US10907107B1	Amphiphilic asphaltene ionic liquids as demulsifiers for heavy petroleum crude oil-water emulsions Provided herein are amphiphilic asphaltene ionic liquids and methods of making and using the amphiphilic asphaltene ionic liquids, e.g. as demulsifiers for petroleum crude oil-water emulsions.
US10907105B2	Methods for enhancing heavy oil recovery Novel catalysts comprising nickel oxide nanoparticles supported on alumina nanoparticles, methods of their manufacture, heavy oil compositions contacted by these nanocatalysts and methods of their use are disclosed. The novel nanocatalysts are useful, inter alia, in the upgrading of heavy oil fractions or as aids in oil recovery from steam-assisted well reservoirs.
US10907103B2	Bitumen extraction using reduced shear conditions A process for extracting bitumen from mined oil sand is provided, comprising: preparing an oil sand slurry comprising oil sand and water; conditioning the oil sand slurry by pumping the oil sand slurry through a hydrotransport pipeline under shear conditions that reduce the formation of water-in-bitumen emulsions in the conditioned oil sand slurry and increase the size of bitumen-air aggregates; and subjecting the conditioned oil sand slurry to gravity separation to produce a bitumen froth having enhanced bitumen recovery and reduced water-in-bitumen emulsions, a middlings layer and sand tailings.
US10907101B2	Liquid crystal cell and liquid crystal display A liquid crystal cell includes a pair of facing substrates having a photo-alignment film, and a liquid crystal layer. The liquid crystal material contains a liquid crystal compound having a structure represented by any of the following chemical formula (1-1) and chemical formula (1-2): A1-CnF2n—X1-A2 (1-1) A1-X1—CnF2n+1 (1-2) in the chemical formula (1-1), A1 is a phenyl group, a phenylene group, a naphthyl group, a naphthylene group, a cyclohexyl group, or a cyclohexylene group; A2 is a phenyl group, a phenylene group, a naphthyl group, or a naphthylene group (provided that a hydrogen atom in functional groups A1 and A2 is optionally substituted by a fluoro group, a chloro group, a bromo group, a methyl group, or an ethyl group); X1 is an oxygen atom or a direct bond; and n is an integer of 1 to 6. The photo-alignment film is obtained by subjecting a polymer film to a photo-alignment treatment.
US10907100B2	Compounds and liquid-crystalline medium Compounds of formula I, and liquid-crystalline media, preferably having a nematic phase and negative dielectric anisotropy, comprising: a) one or more compounds of formula I and one or more other compounds selected from: b) one or more compounds of formula II and/or c) one or more compounds selected from compounds of formulae III-1 to III-4 and B Use thereof in electro-optical displays, particularly in active-matrix displays based on the VA, ECB, PALC, FFS or IPS effect and use of compounds of formula I for stabilisation of liquid-crystalline media which comprise one or more compounds of formula II and/or one or more compounds selected from compounds of formulae III-1 to III-4 and B.
US10907099B2	Compound, composition, cured object, optically anisotropic body, and reflective film An object of the present invention is to provide a compound (particularly, a liquid crystal compound having excellent light fastness) which has excellent light fastness and can be used for an optically anisotropic body, a reflective film obtained by immobilizing a cholesteric liquid crystalline phase, or the like.Another object of the present invention is to provide a composition containing the above-mentioned compound (particularly, a liquid crystal compound having excellent light fastness); and a cured object, an optically anisotropic body, and a reflective film, which are obtained by curing the above-mentioned composition.The compound of the present invention is represented by General Formula (1).
US10907090B2	In situ solid organic pillar placement in fracture networks Methods include introducing a multistage treatment fluid into one or more intervals of a wellbore, wherein the treatment fluid contains one or more stages of a polymer-forming composition and one or more stages of a spacer fluid and initiating polymerization of the one or more stages of polymer-forming composition. Methods may include designing a multistage treatment fluid containing one or more stages of a polymer-forming composition and one or more stages of a spacer fluid, wherein or more stages of the polymer-forming composition comprises a thermosetting polymer; and pumping the multistage treatment fluid into a wellbore, wherein the pumping rate is determined by constructing a model based upon (a) the minimum pumping rate determined from the critical reaction temperature and the downhole temperature, (b) the fracture closing time, (c) the temperature within one or more fractures, and (d) the maximum pumping rate.
US10907089B2	Treatment fluids for a subterranean formation A method of stabilizing one or more clays within a subterranean formation comprises forming at least one treatment fluid comprising anionic silica particles, cationic silica particles, and at least one base material. The at least one treatment fluid is provided into a subterranean formation containing clay particles to attach at least a portion of the anionic silica particles and the cationic silica particles to surfaces of the clay particles and form stabilized clay particles. A method of treating one or more clays contained within a subterranean formation, and a treatment fluid for a subterranean formation.
US10907086B2	High temperature gravel packing fluid system A composition and method for treating a subterranean formation that includes preparing a treatment gel of aqueous fluid, a thickening agent soluble in the aqueous fluid, sand/gravel, and micro fibrous cellulose. Placing the treatment gel in at least a portion of a subterranean formation.
US10907084B2	Nanofibril cellulose additive A variety of systems, methods and compositions are disclosed, including, in one method, a method for well treatment may comprise providing a treatment fluid comprising an aqueous base fluid; and a nanofribril cellulose additive, wherein the nanofribril cellulose additive comprises nanofribril cellulose and a surfactant adsorbed onto a surface of the nanofribril cellulose; and introducing the treatment fluid into a well bore penetrating a subterranean formation. Additional systems, methods and compositions are also disclosed.
US10907082B2	Two-component lost circulation pill for seepage to moderate loss control A two-component lost circulation material (LCM) is provided having a polymer component and a sodium hydroxide component. The polymer component may include a carrier fluid such as water, a particulate material such as fly ash, a fibrous material such as polypropylene fibers, and an acrylic polymer. The sodium hydroxide component may include water and sodium hydroxide. The sodium hydroxide component is introduced to contact the polymer component to form the two-component LCM. Methods of lost circulation control and manufacture of a two-component LCM are also provided.
US10907081B2	Rare-earth regenerator material particles, and group of rare-earth regenerator material particles, refrigerator and measuring apparatus using the same, and method for manufacturing the same Provided is a group of rare-earth regenerator material particles having an average particle size of 0.01 to 3 mm, wherein the proportion of particles having a ratio of a long diameter to a short diameter of 2 or less is 90% or more by number, and the proportion of particles having a depressed portion having a length of 1/10 to ½ of a circumferential length on a particle surface is 30% or more by number. By forming the depressed portion on the surface of the regenerator material particles, it is possible to increase permeability of an operating medium gas and a contact surface area with the operating medium gas.
US10907075B2	Chemically minimized system for time reduced application of eyelash extensions A system for the professional preparation and implementation of eyelash and hair extension application which may include the use of chemically reduced bonding agents such as cyanoacrylate based adhesive, non-adhesive bonding gel, micro-fiber skin protection strips and staging pallets, brushless micro-applicators and tweezers including an affixed UV light source.
US10907070B2	Articles subject to ice formation comprising a repellent surface comprising a siloxane material Articles subject to ice formation during normal use, are described comprising a repellent surface such that the receding contact angle of the surface with water ranges from (90) degrees to (135) degrees wherein the repellent surface comprises a siloxane material. In one embodiment, the repellent surface further comprises a non-fluorinated organic polymeric binder. In another embodiment, the repellent surface comprises a thermally processable polymer and a siloxane material melt additive. Also described are methods of making an article comprising providing an article subject to ice formation during normal use; and providing a liquid repellent surface, as described herein, on at least a portion of the article.
US10907066B2	Curable composition for ink-jet printing, cured object, and printed wiring board Provided are a curable composition for inkjet, which not only allows surface curability in formation of a coating film by an inkjet system to be enhanced, but also is not reduced in characteristics conventionally provided, such as solder heat resistance and gold plating resistance, and a cured product and a printed wiring board using the curable composition. The curable composition for inkjet of the present invention includes (A) an alkylene chain-containing bifunctional (meth)acrylate compound, (B) an α-aminoalkylphenone-based photopolymerization initiator, and (C) an acylphosphine oxide-based photopolymerization initiator, wherein, when the thickness is 10 μm, the absorbance at a wavelength of 365 nm is 0.08 to 0.8 and the absorbance at a wavelength of 385 nm is 0.05 to 0.3.
US10907063B2	Ink composition, process for producing same, and ink-jet ink set and ink-jet printing system both including said ink composition An ink composition according to the present invention contains a polymerizable compound and a photopolymerization initiator, wherein an amount of organic sulfonic acid measured at a temperature of 25° C. by using a water extraction method is 50 ppm or less, and an amount of water measured by a Karl Fischer method is 0.50 mass % or less with respect to a total mass of the ink composition. Also, an ink-jet ink set according to the present invention includes the above-described ink composition of the present invention. Also, an ink-jet printing system according to the present invention uses the above-described ink composition of the present invention and an ink-jet recording apparatus, and the ink-jet recording apparatus includes an ink heating portion and an ink filter.
US10907060B2	Printing on a textile In an example of a method for printing on a textile, a print is generated by thermal inkjet printing a thermal inkjet ink on a cotton fabric. The thermal inkjet ink consists of a pigment, a single dispersant and binder resin, a vehicle, and a balance of water. The single dispersant and binder resin is a styrene acrylic resin having an acid number greater than 100 mg KOH/g and a weight average molecular weight less than 50,000. The vehicle includes a co-solvent, an anti-kogation agent, a humectant, a surfactant, a biocide, or combinations thereof. The print is generated without a post-printing curing process.
US10907059B2	Waterborne clear ink compositions An aqueous ink composition including water; an optional co-solvent; a sulfonated polyester, wherein the sulfonated polyester has a degree of sulfonation of at least about 3.5 mol percent; and an isoprene rubber. A process of digital offset printing including applying an ink composition onto a re-imageable imaging member surface at an ink take up temperature, the re-imageable imaging member having dampening fluid disposed thereon; forming an ink image; transferring the ink image from the re-imageable surface of the imaging member to a printable substrate at an ink transfer temperature; wherein the ink composition comprises water; an optional co-solvent; a sulfonated polyester having a degree of sulfonation of at least about 3.5 mol percent; and an isoprene rubber. A process including combining a sulfonated polyester resin, having a degree of sulfonation of at least about 3.5 mol percent, water, an optional co-solvent, and an isoprene rubber to form an aqueous ink composition, wherein the ink composition is substantially colorless.
US10907058B2	Aqueous ink composition comprising polyisoprene An aqueous ink composition including water; an optional co-solvent; an optional colorant; a sulfonated polyester; and an isoprene rubber. A process of digital offset printing, the process including applying an ink composition onto a re-imageable imaging member surface at an ink take up temperature, the re-imageable imaging member having dampening fluid disposed thereon; forming an ink image; transferring the ink image from the re-imageable surface of the imaging member to a printable substrate at an ink transfer temperature; wherein the ink composition comprises: water; an optional co-solvent; an optional colorant; a sulfonated polyester; and an isoprene rubber. A process including combining a sulfonated polyester resin, water, an optional co-solvent, an optional colorant, a sulfonated polyester, and an isoprene rubber to form an aqueous ink composition.
US10907056B2	Curable compositions A low viscosity energy curable epoxy resin composition essentially free of solvent for preparing an ink composition comprising: (a) at least one divinylarene dioxide compound, (b) at least one cycloaliphatic epoxy resin, (c) at least one vinyl ether compound, (d) at least one cationic photoinitiator, (e) at least one pigment, and (f) optionally, at least one oxetane; wherein (i) the viscosity of the curable composition is less than or equal to about 50 mPa·s at 25° C., (ii) the composition cures at a relative humidity of greater than 30%, and (iii) the composition cures with an increase in cure time of less than 100% when the composition is cured at a relative humidity of at least 70% compared to that of a composition that is cured at a relative humidity of less than or equal to 45%. The curable epoxy resin composition is useful, for example, for preparing an ink composition; and more specifically for preparing a solventless low viscosity UV curable inkjet ink composition.
US10907048B2	Product having ultraviolet radiation protection A product for incorporating ultraviolet radiation protection and antimicrobial protection into rayon is disclosed which has a quantity of rayon, a quantity of zinc oxide particles with each particle having a surface, and a quantity of a reactive group for modifying each surface of each zinc oxide particle, the quantity of the reactive group for incorporating the quantity of zinc oxide particles into the quantity of rayon prior to the quantity of rayon being formed into a fiber.
US10907047B2	Whitening agents for cellulosic substrates The present application relates to novel whitening agents for cellulosic substrates. The whitening agents are comprised of at least two constituents: at least one chromophore constituent and at least one polymeric constituent. Suitable chromophore components generally fluoresce blue, red, violet, or purple color when exposed to light, or they may absorb light to reflect these same shades. The whitening agents are further characterized by the polymeric component comprising at least two repeating glycerol units. This disclosure also relates to laundry care compositions including but not limited to liquid and/or powder laundry detergent formulations and rinse added fabric softening (RAFS) compositions that comprise such whitening agents.
US10907046B2	Nanoprobe-metal chelator complexes Provided herein are compounds that are able to bind metal ions (e.g., free metal ions or metal ions bound to low affinity ligands) in a sample or subject. Also provided herein are methods of using the compounds for chelating metal ions and for the treatment of diseases associated with abnormal levels of metal ions. Methods of preparing the compounds and pharmaceutical compositions are also provided.
US10907038B2	Templated synthesis of shape-controlled polymeric nanofibers by chemical vapor deposition (CVD) in liquid crystals Methods are provided for fabricating functional nanostructures (e.g., nanowires/nanofibers) via chemical vapor deposition polymerization of paracyclophanes or substituted paracyclophanes onto and through a structured fluid, such as a film of liquid crystals, on a substrate. A one-step process is provided that does not require the use of any solid templates, nor does it require any volatile solvents, additives or catalysts. The resulting nanowires/nanofibers can be in the form of aligned nanowires/nanofibers arrays supported on any solid material, in the form of nanofibers mats supported on porous materials, or as individual free-standing nanowires/nanofibers. By using chiral liquid crystals, chiral nanofibers can be fabricated. The functional nanowires/nanofibers can contain one or more type of surface reactive groups that allows for post surface chemical modifications on the nanowires/nanofibers. Such nanostructures can be used in a range of different applications, including in biomedical applications.
US10907035B2	Propylene resin composition and injection-molded article thereof A propylene resin composition containing (A), (B), (C), and (D) is provided. The content of (A) is 40 to 65 parts by weight, the content of (B) is 10 to 25 parts by weight, the content of (C) is 25 to 35 parts by weight, and the content of (D) is 0.01 to 0.3 parts by weight based on the total weight of (A), (B), and (C) being 100 parts by weight. (A) is a propylene-based polymer, (B) is an ethylene-α-olefin copolymer, (C) is a talc whose ratio of D50[L] to D50[S] is at least 4, and (D) is a nucleating agent having formula (1): R1 and R2 each independently represent an alkyl group having 1 to 8 carbon atoms or a halogen group, and m and n each independently represent an integer of 1 to 5. A molded article produced from the composition has low linear expansion coefficients.
US10907033B2	Processing additive mixtures The invention relates to processing additive mixtures comprising at least one polyol, amide and/or carboxylic acid, optionally auxiliaries for crystallization and at least one organic ammonium salt. Said processing additive mixtures allow the optimization of the vulcanization behavior of rubber mixtures and the properties of vulcanizates obtained by said vulcanization.
US10907029B2	Resin composition, resin layer-provided support, prepreg, laminate sheet, multilayer printed wiring board, and printed wiring board for millimeter-wave radar The present invention relates to a resin composition containing (A) a compound having a maleimide group, a divalent group having at least two imide bonds, and a saturated or unsaturated divalent hydrocarbon group and (B) a halogen-free flame retardant.
US10907027B2	UV-photocured resin layer and image display device using the same A UV-photocured resin layer (and an image display device including the UV-photocured resin layer), the UV-photocured resin layer including the following cured components: an acrylate-based oligomer component selected from the group consisting of a polyisoprene-based (meth)acrylate oligomer, a polybutadiene-based (meth)acrylate oligomer, and a polyurethane-based (meth)acrylate oligomer; an acrylic-based monomer component including octyl acrylate or isobornyl acrylate; a plasticizer component; and a photoradical polymerization initiator component.
US10907026B2	Nanostructured thermoplastic polyimide films Structured films containing multi-walled carbon nanotubes (“MWCNTs”) have enhanced mechanical performance in terms of strength, fracture resistance, and creep recovery of polyimide (“PI”) films. Preferably, the loadings of MWCNTs can be in the range of 0.1 wt % to 0.5 wt %. The strength of the new PI films dried at 60° C. increased by 55% and 72% for 0.1 wt % MWCNT and 0.5 wt % MWCNT loadings, respectively, while the fracture resistance increased by 23% for the 0.1 wt % MWCNTs and then decreases at a loading of 0.5 wt % MWCNTs. The films can be advantageously be created by managing a corresponding shift in the annealing temperature at which the maximum strength occurs as the MWCNT loadings increase.
US10907020B2	CNF cellular solid material with anionic surfactants The present invention relates to cellular solid materials comprising cellulose nanofibers (CNF) and an anionic surfactant, a method for preparation of such materials, as well as their use.
US10907019B2	Synthetic polymer film provided with surface having sterilizing activity A synthetic polymer film (34A), (34B) having a surface which has a plurality of raised portions (34Ap), (34Bp), wherein a two-dimensional size of the plurality of raised portions (34Ap), (34Bp) is in a range of more than 20 nm and less than 500 nm when viewed in a normal direction of the synthetic polymer film (34A), (34B), the surface having a microbicidal effect, and a concentration of a total of a nitrogen element which is a constituent of a primary amine and a nitrogen element which is a constituent of a secondary amine is not less than 0.29 at %, and a number of moles of an ethylene oxide unit included in one gram is more than 0.0020 and not more than 0.0080.
US10907012B2	Polycarbonate diol and producing method thereof, and polyurethane and active energy ray-curable polymer composition both formed using same A novel polycarbonate diol is useful as a raw material for producing a polycarbonate diol-based polyurethane with a high degree of hardness, superior abrasion resistance, and superior hydrophilicity. The polyurethane is useful in paints, coating agents, synthetic leathers, artificial leathers, and highly-functional elastomers, or the like. The polycarbonate diol is also useful for producing an active-energy radiation curable polymer composition giving a cured film having superior contamination resistance and high degree of hardness. The curable polymer composition contains a urethane(meth)acrylate oligomer obtained from the polycarbonate diol. The polycarbonate diol is obtained, for example, by reacting two specific types of diols with diester carbonate in the presence of a transesterification catalyst. The catalyst has a metal of Group 1 or 2 on the periodic table. A metal content of the transesterification catalyst is 100 weight ppm or less.
US10907008B2	Highly functional epoxidized resins and coatings The invention provides highly functional epoxy resins that may be used themselves in coating formulations and applications but which may be further functionalized via ring-opening reactions of the epoxy groups yielding derivative resins with other useful functionalities. The highly functional epoxy resins are synthesized from the epoxidation of vegetable or seed oil esters of polyols having 4 or more hydroxyl groups/molecule. In one embodiment, the polyol is sucrose and the vegetable or seed oil is selected from corn oil, castor oil, soybean oil, safflower oil, sunflower oil, linseed oil, tall oil fatty acid, tung oil, vernonia oil, and mixtures thereof. Methods of making of the epoxy resin and each of its derivative resins are disclosed as are coating compositions and coated objects using each of the resins.
US10907002B2	Copolymer latex A copolymer latex of a copolymer comprising 50 to 88 wt % of a conjugated diene monomer unit, 10 to 40 wt % of an ethylenically unsaturated nitrile monomer unit, and 2 to 10 wt % of an ethylenically unsaturated acid monomer unit, the copolymer latex having an insoluble content in methyl ethyl ketone of 70 wt % or less and a swelling degree in methyl ethyl ketone of 40 times or more when the copolymer is formed into a dry film.
US10907000B2	Functionally versatile amphiphilic copolymers The present invention provides multifunctional amphiphilic copolymers having the structure set out below: wherein w, x, y, and z are molar percentages, the sum of which equals 100%; wherein R1 has the formula —(CH2CH2O)n—R2, where R2 is hydrogen or a C1-C10 alkyl group; R3 has the formula —(CH2)a—CH3; R4 is hydrogen or methyl; R5 has the formula —(OCH2CH2)b—O—(CH2)c—CH3 or —(OCH2CH2)b—O—C6H5; and n is an integer ranging from 1 to about 10, a is an integer ranging from 1 to about 21, b is an integer ranging from 1 to about 23, and c is an integer ranging from 1 to about 21. The present invention also provides compositions comprising the multifunctional amphiphilic copolymers including spray drift control compositions including agricultural compositions, consumer compositions, industrial compositions, and mining compositions. The present invention also provides methods for preparing and using the multifunctional amphiphilic copolymers.
US10906999B2	Fluoroelastomer compositions The invention pertains to a (per)fluoroelastomer composition comprising: —a (per)fluoroelastomer [fluoroelastomer (A)]; and —at least one (per)fluoropolyether additive [polymer (E)] comprising a (per)fluoropolyether chain comprising recurring units having at least one catenary ether bond and at least one fluorocarbon moiety, and comprising at least one chain end comprising at least one per(halo)fluorinated aromatic group [group (ArF)], said polymer (E) being comprised in the composition in an amount of 0.5 to 30 phr, with respect to fluoroelastomer (A).
US10906994B2	Processes and apparatus for producing nanocellulose, and compositions and products produced therefrom Processes disclosed are capable of converting biomass into high-crystallinity nanocellulose with surprisingly low mechanical energy input. In some variations, the process includes fractionating biomass with an acid (such as sulfur dioxide), a solvent (such as ethanol), and water, to generate cellulose-rich solids and a liquid containing hemicellulose and lignin; and mechanically treating the cellulose-rich solids to form nanofibrils and/or nanocrystals. The crystallinity of the nanocellulose material may be 80% or higher, translating into good reinforcing properties for composites. The nanocellulose material may include nanofibrillated cellulose, nanocrystalline cellulose, or both. In some embodiments, the nanocellulose material is hydrophobic via deposition of some lignin onto the cellulose surface. Optionally, sugars derived from amorphous cellulose and hemicellulose may be separately fermented, such as to monomers for various polymers. These polymers may be combined with the nanocellulose to form completely renewable composites.
US10906993B2	Modified cellulose fibers Modified cellulose fibers, wherein each of (A) one or more substituents selected from substituents represented by the following general formula (1) and substituents represented by the following general formula (2): —CH2—CH(OH)—R1 (1); —CH2—CH(OH)—CH2—(OA)n-O—R1 (2), wherein each R1 in the general formula (1) and the general formula (2) is independently a linear or branched alkyl group having 3 or more carbon atoms and 30 or less carbon atoms; n in the general formula (2) is a number of 0 or more and 50 or less; and A is a linear or branched, divalent saturated hydrocarbon group having 1 or more carbon atoms and 6 or less carbon atoms, and (B) a substituent represented by the following general formula (3): —CH2—CH(OH)—R2 (3), wherein R2 in the general formula (3) is an alkyl group having 1 or more carbon atoms and 2 or less carbon atoms, is independently bonded to cellulose fibers via an ether bond, wherein the modified cellulose fibers have a cellulose I crystal structure. The resin composition blended with the modified cellulose fibers of the present invention can be suitably used in various industrial applications such as daily sundries, household electric appliance parts, wrapping materials for household electric appliance parts and automobile parts.
US10906989B1	Antibody specific to Staphylococcus aureus, therapeutic method and detection method using same We provide new monoclonal antibody inhibitors of coagulases for treatment of S. aureus. The monoclonal antibodies are useful in targeting the SC N-terminus and inhibiting SC-ProT activation. The monoclonal antibodies are able to bind to and interfere with, modulate, and/or inhibit the binding interactions between the staphylocoagulase protein and its ligand protein prothrombin in blood and tissues. The antibodies are effective in inhibiting the activation of prothrombin.
US10906986B2	Prevention of disulfide bond reduction during recombinant production of polypeptides Provided herein are methods for preventing the reduction of disulfide bonds during the recombinant production of disulfide-containing polypeptides. In particular, the invention concerns the prevention of disulfide bond reduction during harvesting of disulfide-containing polypeptides, including antibodies, from recombinant host cell cultures.
US10906980B2	Compositions and methods for non-myeloablative conditioning Disclosed herein are non-myeloablative antibody-toxin conjugates and compositions that target cell surface markers, such as the CD34, CD45 or CD117 receptors, and related methods of their use to effectively conditioning a subject's tissues (e.g., bone marrow tissue) prior to engraftment or transplant. The compositions and methods disclosed herein may be used to condition a subject's tissues in advance of, for example, hematopoietic stem cell transplant and advantageously such compositions and methods do not cause the toxicities that are commonly associated with traditional conditioning methods.
US10906977B2	Enhancing the therapeutic activity of immune checkpoint inhibitor The present invention provides antagonists and methods of use thereof in the treatment of cancer and abnormal immune suppression diseases.
US10906971B2	Monoclonal anti-IL-1RAcP antibodies Monoclonal antibody that specifically binds the interleukin 1 receptor type 1 (IL-1RAcP), or an antigen binding fragment thereof, comprising: a) a heavy chain variable region (VH) comprising CDR1H, CDR2H and/or CDR3H, wherein the CDR1H region comprises an amino acid sequence selected from the group of SEQ ID NO: 155-231, wherein the CDR2H region comprises an amino acid sequence selected from the group of SEQ ID NO: 232-308, and wherein the CDR3H region comprises an amino acid sequence selected from the group of SEQ ID NO: 309-385; and b) a light chain variable region (VL) comprising CDR1L, CDR2L and/or CDR3L, wherein the CDR1L region comprises an amino acid sequence selected from the group of SEQ ID NO: 386-462, wherein the CDRL2 region comprises an amino acid sequence selected from the group of SEQ ID NO: 463-539, and wherein the CDR3L region comprises an amino acid sequence selected from the group of SEQ ID NO: 540-616. The monoclonal antibody is characterized in that it inhibits IL-1RAcP induced NFkB activity, useful in treatment of IL-1RAcP related diseases.
US10906966B2	Tau-binding antibodies The present invention relates to Tau-binding antibodies and binding fragments thereof.
US10906963B2	Non-glycosylated anti-tenascin antibody The present invention relates to variants of the anti-tenascin antibody F16 which are modified to abolish N-glycosylation at positions 88 to 90 in the VL domain. This results in dramatically improved properties, such as improved binding affinity and tumour biodistribution in vivo. Variant F16 antibody molecules and methods for their production and use are provided.
US10906958B2	TGF-beta superfamily type I and type II receptor heteromultimers and uses thereof In certain aspects, the disclosure provides soluble heteromeric polypeptide complexes comprising an extracellular domain of a type I serine/threonine kinase receptor of the TGF-beta family and an extracellular domain of a type II serine/threonine kinase receptor of the TGF-beta family. In some embodiments, the disclosure provides soluble polypeptide complexes comprising an extracellular domain of a type II receptor selected from: ActRIIA, ActRIIB, TGFBRII, BMPRII, and MISRII. In some embodiments, the disclosure provides soluble polypeptide complexes comprising an extracellular domain of a type I receptor selected from: ALK1, ALK2, ALK3, ALK4, ALK5, ALK6, and ALK7. Optionally the soluble complex is a heterodimer. In certain aspects, such soluble polypeptide complexes may be used to regulate (promote or inhibit) growth of tissues or cells including, for example, muscle, bone, cartilage, fat, neural tissue, tumors, cancerous cells, and/or cells of hematopoietic lineages, including red blood cells. In certain aspects, such soluble polypeptide complexes are can be used to improve muscle formation, bone formation, hematopoiesis, metabolic parameters, and disorders associated with these tissues, cellular networks, and endocrine systems.
US10906956B2	Methods of treatments using chimeric antigen receptors targeting G-protein coupled receptor The presently disclosed subject matter provides for methods and compositions for treating multiple myeloma. It relates to chimeric antigen receptors (CARs) that specifically target a G-protein coupled receptor (e.g., a G-protein coupled receptor family C group 5 member D (GPRC5D)), and immunoresponsive cells comprising such CARs. The presently disclosed CARs targeting a G-protein coupled receptor (e.g., GPRC5D) have enhanced immune-activating properties, including anti-tumor activity.
US10906955B2	Recombinant ROBO2 proteins, compositions, methods and uses thereof The invention provides recombinant Roundabout Receptor 2 (ROBO2) proteins designed to bind SLIT ligands and prevent their binding to ROBO2 cell surface receptors. Also provided are methods for use of these recombinant ROBO2 proteins.
US10906950B2	Alkaline pH-modified edible casein-based films and coatings, and method for the making thereof Improved casein-based films are produced by adjusting the pH of a film-production suspension. The film-production suspension may contain a casein source, a plasticizer, and optionally a strengthening additive. The adjustment of the pH may be accomplished by the addition of an alkaline additive, such as a base, to achieve a desired pH value. The improved casein-based films have improved physical properties as compared to those produced without a pH-adjusted film-production suspension at least in part due to the chemical and structural changes imparted by the change in pH.
US10906949B2	Methods of treating spinal cord injury using a chondroitin sulfate proteoglycan (CSPG) reduction peptide (CRP) comprising a cell membrane penetrating domain, a CSPG binding domain, and a lysosome targeting domain Provided herein are compositions, systems, kits, and methods for treating nervous system injuries caused by trauma or neurodegeneration or aging in a subject by administering a CSPG or SOCS3 reduction peptide (CRP and SRP respectively), or a nucleic acid sequence encoding the CRP or SRP, wherein both the CRP and SRP comprise a cell membrane penetrating domain, and a lysosome targeting domain, and the CRP further comprises a chondroitin sulfate proteoglycan (CSPG) binding domain, and the SRP further comprises a suppressor of cytokine signaling-3 (SOCS3) binding domain.
US10906945B2	Modified alpha hemolysin polypeptides and methods of use Provided herein are alpha hemolysin polypeptides comprising modified amino acid sequences that can reduce the rate of translocation of a polymer. Also provided herein are apparatuses and devices comprising modified hemolysin polypeptides. Also provided herein are methods of using modified alpha hemolysin proteins for use in characterizing and/or sequencing a polymer or for use as molecular sensors.
US10906944B2	Stabilized coronavirus spike (S) protein immunogens and related vaccines The present invention provides redesigned soluble coronavirus S protein derived immunogens that are stabilized via specific modifications in the wildtype soluble S sequences. Also provided in the invention are nanoparticle vaccines that contain the redesigned soluble S immunogens displayed on self-assembling nanoparticles. Polynucleotide sequences encoding the redesigned immunogens and the nanoparticle vaccines are also provided in the invention. The invention further provides methods of using the vaccine compositions in various therapeutic applications, e.g., for preventing or treating coronaviral infections.
US10906936B2	Immunotherapy against several tumors including neuronal and brain tumors The present invention relates to peptides, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated cytotoxic T cell (CTL) peptide epitopes, alone or in combination with other tumor-associated peptides that serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses. The present invention relates to 30 peptide sequences and their variants derived from HLA class I and class II molecules of human tumor cells that can be used in vaccine compositions for eliciting anti-tumor immune responses.
US10906931B2	Methods for treating diseases related to mitochondrial stress Means and methods for therapeutic intervention of mitochondrial disorders or diseases, and in particular to a method for the treatment, prevention and/or amelioration of a disorder or disease correlated with mitochondrial stress or dysfunction, a mitochondrial disorder or disease, or a disorder or disease characterized by OPA1 alterations are disclosed. Thereby, a pharmaceutically active amount of a compound capable of modulating the activity of OMA1 and/or an oligomeric complex comprising OMA1 is administered to a patient in need of medical intervention. Methods of screening for a compound capable of modulating the activity of OMA1 and/or an oligomeric complex comprising OMA1 are disclosed. Methods for determining the susceptibility for, predisposition for, or the presence of such a disorder or disease and whether a person in need will benefit from the therapeutic intervention, i.e. personalized medicine are also disclosed.
US10906927B2	Steviol glycoside compounds, compositions for oral ingestion or use, and method for enhancing steviol glycoside solubility Novel steviol glycoside compounds characterized by a first group of four glucopyranose residues attached via the number 13 carbon (C13) of the steviol moiety and a second group of two or three glucopyranose residues attached via the number 19 carbon (C19) of the steviol moiety are described, and exemplified by compounds 1-4. These compounds can be present in a composition with other steviol glycosides (e.g., Reb D and Reb M) to enhance their solubilities. Accordingly, the novel compounds can facilitate the preparation of aqueous compositions having a higher concentration of steviol glycosides. A steviol glycoside composition including one or more of compounds 1-4 can be used as a sweetener composition to sweeten other compositions (sweetenable compositions) such as foods, beverages, medicines, oral hygiene compositions, nutraceuticals, and the like.
US10906922B2	Heterocyclic compound and organic solar cell comprising same The present specification relates to a heterocyclic compound and an organic solar cell including the same.
US10906921B2	Base generator, reagent, organic salt, composition, method for manufacturing device, cured film and device A curing agent or a curing accelerator which is easy to synthesize and may cure an epoxy resin and the like, or may accelerate the curing is provided. A curing agent or a curing accelerator according to some embodiments of the present invention has a highly-coordinated silicon structure.
US10906919B2	Fused pentacyclic imidazole derivatives A series of fused pentacyclic imidazole derivatives, being potent modulators of human TNFa activity, are accordingly of benefit in the treatment and/or prevention of various human ailments, including autoimmune and inflammatory disorders; neurological and neurodegenerative disorders; pain and nociceptive disorders; cardiovascular disorders; metabolic disorders; ocular disorders; and oncological disorders. In particular, the present invention is concerned with 6,7-dihydro-7,14-methanobenzimidazo[1,2-b][2,5]benzodiazocin-5(14H)-one derivatives and analogs thereof.
US10906916B2	Thienopyrimidinones as ubiquitin-specific protease 7 inhibitors The disclosure relates to inhibitors of USP7 inhibitors useful in the treatment of cancers, neurodegenerative diseases, immunological disorders, inflammatory disorders, cardiovascular diseases, ischemic diseases, viral infections and diseases, and bacterial infections and diseases, having the Formula: where R1, R2, R3, R5, R5′, X1, X2, n, and m are described herein.
US10906913B2	NMDA receptor modulators and uses thereof Disclosed are compounds having enhanced potency in the modulation of NMDA receptor activity. Such compounds are contemplated for use in the treatment of diseases and disorder such as learning, cognitive activities, and analgesia, particularly in alleviating and/or reducing neuropathic pain. Orally available formulations and other pharmaceutically acceptable delivery forms of the compounds, including intravenous formulations, are also disclosed.
US10906912B2	Pharmaceutical intermediates and methods for preparing the same A pharmaceutical intermediate including a first indole moiety which is associated with an optionally carboxylated hexahydroazepino moiety, an optionally carboxylated azonane moiety, or a second, optionally carboxylated indole moiety, having an alkyl, allyl, phenylallyl, cinnamyl, alkenyl, and/or alkyl-alkenyl substituent pendant from a nitrogen atom of the same.
US10906911B2	Synthesis of coelenterazine Disclosed herein are synthesis methods for coelenterazine. Also disclosed are articles including the coelenterazine and coelenterazine derivatives. Representative absorbent articles include disposable diapers and adult incontinence products.
US10906910B2	Substituted bicyclic pyrimidine compounds with tubulin and multiple receptor inhibition This invention provides substituted bicyclic pyrimidine compounds of the following formula: or a pharmaceutically acceptable salt thereof, wherein R is selected from the group consisting of H and a straight or branched chain alkyl group having from 1 to 10 carbon atoms, wherein the alkyl group is partially or completely saturated, each having tubulin and multiple receptor inhibition properties. Methods of treating a patient diagnosed with cancer are disclosed comprising administering to the patient a therapeutically effective amount of the substituted bicyclic pyrimidine compounds, or a pharmaceutically acceptable salt thereof.
US10906907B2	Tert-butyl (s)-(1-(5-fluoro-4-oxo-3-phenyl-3,4-dihydroquinazolin-2-yl)propyl)carbamate precursor of a quinazolinone inhibitor of human phosphatidylinositol 3-kinase delta and a process for preparing thereof Compounds that inhibit PI3Kδ activity, including compounds that selectively inhibit PI3Kδ activity, are disclosed. Methods of preparing such compounds are also disclosed, including the preparation and use of the compound tert-butyl (S)-(1-(5-fluoro-4-oxo-3-phenyl-3,4-dihydroquinazolin-2-yl)propyl)carbamate of formula (110) as a precursor to synthesize an exemplary compound disclosed in this application, (S)-2-(1-((9H-purin-6-yl)amino)propyl)-5-fluoro-3-phenylquinazolin-4(3H)-one. Methods of inhibiting phosphatidylinositol 3-kinase delta isoform (PI3Kδ) activity, and methods of treating diseases, such as disorders of immunity and inflammation in which PI3Kδ plays a role in leukocyte function, using the compounds also are disclosed.
US10906905B2	Five-membered heteroaryl ring bridged ring derivative, preparation method therefor and medical use thereof The present invention relates to a five-membered heteroaryl ring bridged ring derivative, a preparation method therefor and the medical use thereof. In particular, the present invention relates to a new five-membered heteroaryl ring bridged ring derivative as shown in formula (I), a preparation method therefor and a pharmaceutical composition comprising the derivative, and the use thereof as a therapeutic agent, in particular as a TGF-β inhibitor, and the use in the preparation of a drug for treating, preventing or reducing cancers mediated by the over-expression of TGF-β, wherein the definition of each substituent in the general formula (I) is the same as defined in the description.
US10906904B2	ADO-resistant cysteamine analogs and uses thereof The present disclosure is directed to methods for treating diseases for which cysteamine is indicated and compounds useful in such methods.
US10906901B2	Crystal form and salt form of N-phenyl-2-aminopyrimidine compound, and preparation method therefor The present invention provides a new crystal form of a N-phenyl-2-aminopyrimidine compound, a crystal form of a pharmaceutically acceptable salt of said compound, and a preparation method for these crystal forms and use thereof. The present invention also relates to a pharmaceutical composition and a pharmaceutical preparation comprising the crystal form of said compound and the crystal form of the pharmaceutically acceptable salt of said compound, and use of these crystal forms, the pharmaceutical composition and the pharmaceutical preparation for treating diseases or conditions associated with the cell epidermal growth factor receptor (EGFR), for example, for treating or improving abnormal cell proliferative conditions, such as cancer.
US10906897B2	Microbiocidal heterobicyclic derivatives Compounds of the formula (I) wherein Q1, Q2, Y—X, R1, R2, R3, R4, Rb, Rc, Rd, R5, R6, R7, Ra, m and n are as defined in claim 1. Furthermore, the present invention relates to agrochemical compositions which comprise compounds of formula (I), to preparation of these compositions, and to the use of the compounds or compositions in agriculture or horticulture for combating, preventing or controlling infestation of plants, harvested food crops, seeds or non-living materials by phytopathogenic microorganisms, in particular fungi.
US10906892B2	LFA-1 inhibitor and methods of preparation and polymorph thereof Methods of preparation and purification of a compound of Formula I, intermediates thereof, a polymorph thereof, and related compounds are disclosed. Formulations and uses thereof in the treatment of LFA-1 mediated diseases are also disclosed.
US10906890B2	Triazole phenyl compounds as agonists of the APJ receptor Compounds of Formula I and Formula II, pharmaceutically acceptable salt thereof, stereoisomers of any of the foregoing, or mixtures thereof are agonists of the APJ Receptor and may have use in treating cardiovascular and other conditions. Compounds of Formula I and Formula II have the following structures: (I), (II) where the definitions of the variables are provided herein.
US10906887B2	Amino compounds for treatment of immune and inflammatory disorders Compounds, methods of use, and processes for making inhibitors of complement Factor D are provided comprising Formula I, I″ and I′″ or a pharmaceutically acceptable salt or composition thereof. The inhibitors described herein target Factor D and inhibit or regulate the complement cascade. The inhibitors of Factor D described herein reduces the excessive activation of complement.
US10906886B2	Substituted 5,6,7,8-tetrahydroimidazo[1,5-a]pyrazines as factor xia inhibitors The present invention provides compounds of Formula (I): or stereoisomers, pharmaceutically acceptable salts thereof, wherein all of the variables are as defined herein. These compounds are inhibitors of factor XIa andor plasma kallikrein which may be used as medicaments.
US10906881B2	Inhibitors of arginine gingipain The present invention relates generally to therapeutics targeting the bacterium Porphyromonas gingivalis, including its proteases arginine gingipain A/B (Rgp), and their use for the treatment of disorders associated with P. gingivalis infection, including brain disorders such as Alzheimer's disease. In certain embodiments, the invention provides compounds according to Formula I, as described herein, and pharmaceutically acceptable salts thereof.
US10906878B2	Kinase inhibitors for the treatment of disease The invention relates to compounds and their use in the treatment of disease. Novel irreversible inhibitors of wild-type and mutant forms of EGFR, FGFR, ALK, ROS, JAK, BTK, BLK, ITK, TEC, and/or TXK and their use for the treatment of cell proliferation disorders are described.
US10906874B2	YAP1 inhibitors that target the interaction of YAP1 with OCT4 Binding of the transcriptional co-activator, YAP1, to the transcription factor Oct4, induces Sox2, which is a transcription actor necessary for the self-renewal of stem-like cells from non-small cell lung cancer. The WW domain of YAP1 binds to the PPxY motif of Oct4 to induce Sox2. Delivering a peptide corresponding to the WAV domain could prevent the induction of Sox2 and stemness. Similarly, peptides and mimetics of the PPxY motif would be able to inhibit stemness. Disclosed are compounds that affect the Yap1:Oct4 interaction.
US10906873B2	Substituted cyclic amides as herbicides Disclosed are compounds of Formula 1, including all stereoisomers, N oxides, and salts thereof, wherein R1, R4, R5, R6, J, Q1, Q2, A, Y1, and Y2 are as defined in the disclosure. Also disclosed are compositions containing the compounds of Formula 1 and methods for controlling undesired vegetation comprising contacting the undesired vegetation or its environment with an effective amount of a compound or a composition of the invention.
US10906867B2	Lipids and lipid compositions for the delivery of active agents This invention provides for a compound of formula (I): or a pharmaceutically acceptable salt thereof, wherein R1-R4, L1, n and p are defined herein. The compounds of formula (X) and pharmaceutically acceptable salts thereof are cationic lipids useful in the delivery of biologically active agents to cells and tissues.
US10906864B2	Nitroalkene non steroidal anti-inflammatory drugs (NA-NSAIDS) and methods of treating inflammation related conditions Nitroalkene non-steroidal anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of treating inflammation related conditions.
US10906863B1	Hydroxytyrosol 4-methoxycinnamic acid ester with antibacterial activity and a method of preparing the same A compound having the formula (I): is disclosed. A method of preparing the compound of formula (I) is also disclosed.
US10906862B2	Process for isolating pure butyl acrylate from crude butyl acrylate by distillation, where butyl is n-butyl or isobutyl A process for isolating pure butyl acrylate from crude butyl acrylate, which is carried out in a dividing wall column having separation-active internals and a vaporizer, and in which: a dividing wall is arranged in a longitudinal direction of the column to form an upper joint column region, a lower joint column region, an inflow section having a side feed point and an offtake section having a side offtake point; a ratio of an amount of liquid at an upper end of the dividing wall going to an enrichment section and a stripping section of the column is set in the range from 1:0.2 to 1:5; and a ratio of an amount of vapor streams at a lower end of the dividing wall going to the stripping section and the enrichment section of the column is set in a range from 1:0.5 to 1:2.0.
US10906860B2	Method for synthesizing chiral beta-hydroxy acid ester compound A method for synthesizing a chiral β-hydroxy acid ester compound is disclosed. The method includes the steps of: using an aldehyde compound and a monoalkyl malonate as raw materials, using a metal and a chiral ligand as a catalyst to make the raw materials be directly and fully reacted in an organic solvent and form a reaction solution, and separating and purifying the reaction solution to obtain the highly stereoselective β-hydroxy acid ester compound. The beneficial effects are mainly embodied in: 1. simple operation; 2. rapidly constructing a highly stereoselective β-hydroxy acid ester skeleton structure molecule; 3. high reaction yield and good stereoselectivity. Therefore, the invention has high basic research significance, industrial production value and social economic benefit.
US10906858B2	CTA solvent exchanging method The present invention relates to a method for processing acetic acid solvent in Crude Terephthalic Acid (CTA) in an oxidized unit of a pure terephthalic acid (PTA) industrial apparatus. In the present invention, a filter cake in CTA is washed by means of a two-stage-three-step method. The present invention further shortens the production process of solvent exchanging technique of CTA pressure filters, improves production capacity of a device, reduces investment of the device, reduces energy consumption of a system, and solves the shortcomings of the existing CTA solvent exchanging technique of the pressure filters.
US10906854B2	Process for forming a photocatalyst and oxidizing a cycloalkane Methods of preparing Pt/SrTiO3 photocatalysts comprising strontium titanate nanoparticles and platinum doped on a surface of the strontium titanate nanoparticles are described. Processes of oxidizing cycloalkanes to cycloalkanols and/or cycloalkanones by employing the Pt/SrTiO3 photocatalysts are specified. A method for recycling the photocatalyst is also provided.
US10906851B2	Process for recovering para-xylene Para-xylene is separated from a mixture of xylenes and ethylbenzene by a separation process. An ortho-selective adsorbent is used to reduce the ortho-xylene concentration of the xylenes, prior to contact of the xylenes and ethylbenzene with a para-selective adsorbent. The stream rich in ortho-xylene may be isomerized in the liquid phase to increase the amount of para-xylene therein. The para-xylene-depleted stream may be treated in the vapor phase to remove the ethylbenzene and then subjected to isomerization in the liquid phase to produce a stream having a higher than equilibrium amount of para-xylene.
US10906849B2	Explosive composition and method of delivery Disclosed herein is an explosive composition for soft and wet ground. The explosive composition comprises an explosive comprising an oxidiser component in a water in oil emulsion or a water gel, and a bulking agent comprising discrete particles of a combustible substance. The combustible substance is water soluble but, in the explosive composition, migration of the combustible substance from the discrete particles to the oxidiser component is inhibited. Also disclosed is a method for delivering an explosive composition to a borehole, for example a borehole in soft and wet ground.
US10906848B2	Propellant grain for optimizing the interior ballistic performance of a weapon A method of manufacturing and optimizing energetic propellant grains includes generating an optimal surface area to mass fraction burned ratio profile for a predetermined solid structure including propellant grains; using the profile as a target function of a topological optimization process to generate a 3D form of a propellant grain; developing a negative of the 3D form of the propellant grain; mixing and densifying the negative with an energetic material in an uncured form in a mixer to create a structure including the energetic material and embedded negative; and solvating the negative from the structure, wherein the negative comprises a 3D propellant grain. The developing of the negative of the 3D form of the propellant grain may occur using a predetermined material in an additive manufacturing process. The negative may be soluble in the predetermined material, and the energetic material may be insoluble in the predetermined material.
US10906845B2	Microbial inoculants, fertiliser compositions, growth mediums and methods for enhancing plant growth The present invention relates to microbial inoculants, fertiliser compositions, growth mediums and methods for enhancing plant growth. In one aspect, the invention relates to a method of increasing plant growth, plant productivity, seed germination or soil quality for a dicotyledonous plant or a monocotyledonous plant, the method comprising the step of: applying to the plant a treatment agent comprising at least one plant-beneficial Burkholderia-like species.
US10906842B2	Method of processing a ceramic matrix composite (CMC) component A method of processing a CMC component includes preparing a fiber preform having a predetermined shape, and positioning the fiber preform with tooling having holes facing one or more surfaces of the fiber preform. After the positioning, a clamping pressure is applied to the tooling to force portions of the one or more surfaces of the fiber preform into the holes, thereby forming protruded regions of the fiber preform. During the application of the clamping pressure, the fiber preform is exposed to gaseous reagents at an elevated temperature, and a matrix material is deposited on the fiber preform to form a rigidized preform including surface protrusions. After removing the tooling, the rigidized preform is infiltrated with a melt for densification, and a CMC component having surface bumps is formed. When the CMC component is assembled with a metal component, the surface bumps may reduce diffusion at high temperatures.
US10906840B2	Cellulose nanocrystal-modified ceramic blank and preparation method thereof A cellulose nanocrystal-modified ceramic blank and a preparation method thereof are disclosed. Cellulose nanocrystals are added into a ceramic blank in gelcasting. The cellulose nanocrystal-modified ceramic blank comprises, by weight, 0.1 to 10 parts of cellulose nanocrystals, 0.1 to 30 parts of organic gel and 70 to 99 parts of ceramic powder. The cellulose nanocrystal has length of 100 to 300 nm, a diameter of 10 to 20 nm, a slenderness ratio of 10 to 15 , and an elastic modulus of 100 to 150 GPa. The drying strength of the ceramic blank with the cellulose nanocrystals is obviously improved.
US10906835B2	Glass compositions, fiberizable glass compositions, and glass fibers made therefrom The present invention relates generally to glass compositions incorporating rare earth oxides (RE2O3). In one embodiment, a glass composition suitable for fiber forming comprises 51-70 wt. % SiO2, 12.5-22 wt. % Al2O3, 0-20 wt. % CaO, 0-11 wt. % MgO, 0.2-1 wt. % Fe2O3, 0.05 or greater wt. % RE2O3, and greater than 1 wt. % MnOx. In another embodiment, a glass composition suitable for fiber forming comprises 51-70 wt. % SiO2, 12.5-22 wt. % Al2O3, 0-20 wt. % CaO, 0-11 wt. % MgO, 0.2-1 wt. % Fe2O3, 0.05 or greater wt. % RE2O3, 0-4 wt. % BaO, 0-4 wt. % SrO, and 0-5.5 wt. % ZnO, wherein the sum of BaO+SrO+ZnO is greater than about 2 wt. %. In another embodiment, a glass composition suitable for fiber forming comprises 51-70 wt. % SiO2, 12.5-22 wt. % Al2O3, 0-20 wt. % CaO, 0-11 wt. % MgO, 0.2-1 wt. % Fe2O3, 0.05 or greater wt. % RE2O3, and from greater than 0 to 2.5 wt. % Cu2O. In another embodiment, a glass composition suitable for fiber forming comprises 51-70 wt. % SiO2, 12.5-22 wt. % Al2O3, 0-20 wt. % CaO, 0-12.5 wt. % MgO, 0.2-1 wt. % Fe2O3, 0.05 or greater wt. % RE2O3, and at least one additional feature selected from the group consisting of: La2O3 is present in an amount greater than about 2 weight percent, CaO is present in an amount less than about 2 weight percent, a MgO/CaO ratio less than about 1, and a SiO2/Al2O3 ratio greater than about 4. The glass compositions can be used to form glass fibers which can be incorporated into a variety of other fiber glass products (e.g., strands, rovings, fabrics, etc.) and incorporated into various composites.
US10906824B2	Ozone-assisted fluid treatment apparatus and method An apparatus and method for ozone-aerating fluid is connected to a conventional water treatment system that includes a high pressure fluid pump and a high pressure filter connected to a main reservoir. Included is an auxiliary reservoir and low pressure filter. A first valve controls the fluid flow in a conduit connected to the output of the high pressure filter. A second valve controls the flow of fluid output from the filter to a lift tube. Ozonated air bubbles are injected into fluid in the lift tube. The fluid flows up the lift tube and into the auxiliary reservoir due to expansion of air bubbles. The fluid flows out of the auxiliary reservoir and filter under the force of gravity into the conduit on the downstream side of the first valve and into the main reservoir. A UV germicidal lamp may be positioned in the path of fluid flow.
US10906818B2	Process for back-and-forth washing of adsorptive media The invention provides methods and systems for washing adsorptive media with minimal water consumption. More specifically, the invention provides methods and systems for in situ regeneration and/or sanitization of adsorptive media, such as activated carbon, using back-and-forth washing.
US10906814B2	Layered materials and methods for their processing A method for producing nanoplates derived from a layered material, includes the steps: (a) mixing particles of said layered material with a carrier liquid to form a dispersion of said particles in said carrier liquid; (b) pressurizing the dispersion to a pressure of at least 10 kpsi; and (c) forcing the dispersion along a microfluidic channel under said pressure, to apply a shear rate of at least 105 s−1 to said particles in the dispersion. Exfoliation of nanoplates from said particles is thereby caused. The nanoplates may be graphene nanoplates, for example. Steps (b) and (c) may be repeated for a number of cycles in order to promote exfoliation. The method may be carried out using a microfluidizer.
US10906813B2	Functionalized carbon nanotubes and methods Provided herein are methods off functionalizing a carbon nanotube, functionalized carbon nanotubes, methods of forming a suspension, and methods of forming a sensor. The methods may include contacting one or more carbon nanotubes with a dienophile in the presence of a supercritical fluid to form one or more functionalized carbon nanotubes. The one or more functionalized carbon nanotubes may have a degree of functionalization of about 1% to about 5%.
US10906812B1	Methods of producing carbon nanoparticles A method of producing carbon nanoparticles, comprising milling carbonized date palm fronds to produce a milled powder; dispersing the milled powder in a liquid to form a suspension; sonicating the suspension to form the carbon nanoparticles; and collecting the carbon nanoparticles is provided.
US10906809B2	Ozone generator with position-dependent discharge distribution An ozone generator includes a high-voltage electrode and at least one counter electrode, which define an interstice in which at least one dielectric is arranged and through which a gas flows in the flow direction. The high-voltage electrode and the at least one counter electrode are provided with a connection for an electrical voltage supply to generate silent discharges which are discharged from surface discharge locations. The mean sparking distance and the mean spacing between the high-voltage electrode and the at least one counter-electrode are constant. The number of surface discharge locations decreases in the flow direction.
US10906804B2	Devices and methods for hydrogen generation via ammonia decomposition Systems and methods for hydrogen generation via ammonia decomposition that utilize a fixed bed reactor configured to receive inflows of NH3 and oxidant and to produce an outflow of high purity H2. The fixed bed reactor contains a fixed bed of a NH3 decomposition catalyst wherewith the NH3 decomposes to form N2 and H2; a plurality of ceramic hollows fibers with a high surface to volume ratio disposed in the fixed bed, the hollow fibers having an H2 selective membrane disposed thereon for extracting H2 from N2 and to form a permeate of the high purity H2 and a retentate of primarily N2; and a catalytic H2 burner also disposed in the fixed bed, the catalytic H2 burner for burning a portion of the H2 with the oxidant to provide thermal energy for the NH3 decomposition.
US10906803B2	Planar cavity MEMS and related structures, methods of manufacture and design structures A method of forming at least one Micro-Electro-Mechanical System (MEMS) includes forming a beam structure and an electrode on an insulator layer, remote from the beam structure. The method further includes forming at least one sacrificial layer over the beam structure, and remote from the electrode. The method further includes forming a lid structure over the at least one sacrificial layer and the electrode. The method further includes providing simultaneously a vent hole through the lid structure to expose the sacrificial layer and to form a partial via over the electrode. The method further includes venting the sacrificial layer to form a cavity. The method further includes sealing the vent hole with material. The method further includes forming a final via in the lid structure to the electrode, through the partial via.
US10906802B2	Actuator layer patterning with topography Provided herein is a method including fusion bonding a handle wafer to a first side of a device wafer. Standoffs are formed on a second side of the device wafer. A first hardmask is deposited on the second side. A second hardmask is deposited on the first hardmask. A surface of the second hardmask is planarized. A photoresist is deposited on the second hardmask, wherein the photoresist includes a MEMS device pattern. The MEMS device pattern is etched into the second hardmask. The MEMS device pattern is etched into the first hardmask, wherein the etching stops before reaching the device wafer. The photoresist and the second hardmask are removed. The MEMS device pattern is further etched into the first hardmask, wherein the further etching reaches the device wafer. The MEMS device pattern is etched into the device wafer. The first hardmask is removed.
US10906798B2	Systems and methods for reducing saddle fuel tank depressurization time Methods and systems are provided for increase a rate at which a saddle fuel tank is depressurized responsive to a request for refueling. In one example, a method may include, responsive to the request for refueling, depressurizing a primary side of the saddle fuel tank to a secondary side of the saddle fuel tank, and commanding open a refueling lock coupled to the primary side to allow fuel to be delivered to the primary side when pressure in the primary side drops below a threshold pressure. In this way, the secondary fuel tank may be maintained at atmospheric pressure prior to the request for refueling, which may increase the rate of depressurization of the saddle fuel tank responsive to the request.
US10906797B2	Suction filler spout The invention relates to a filler spout comprising a tubular body having mounted therein both a valve member extending facing an inlet orifice of a distribution chamber and also a shutter arranged downstream from the valve member and rigidly connected thereto in such a manner as to extend facing an outlet orifice of the distribution chamber. An actuator is coupled to the valve member in order to move it between an extreme opening position and an extreme closing position, the valve member possessing an intermediate closing position in order to form a suction piston when the valve member is moved from the extreme closing position to the intermediate closing position or from the intermediate closing position to the extreme closing position. The shutter includes a channel opening into the distribution chamber and facing the outlet orifice of said distribution chamber so that the channel is always unobstructed regardless of the position of the valve member.
US10906791B2	Apparatuses and methods for container content preservation One feature pertains to a device that includes a main body having a bottle-receiving end that receives an end of a bottle having a mouth and forms an airtight seal between an exterior surface of the bottle and an interior air cavity of the main body. The device also includes an actuator assembly that drives a stopper securement device into a stopper positioned within the mouth of the bottle and retracts the stopper securement device to remove the stopper from the mouth of the bottle. The device also includes a vacuum pump that evacuates air out of the interior air cavity and the bottle's headspace after the stopper has been removed to create a vacuum within the headspace. The actuator assembly may also drive the stopper securement device and the stopper back into the mouth of the bottle to reseal the bottle while the headspace is under vacuum.
US10906790B2	Control box and operator interface for an industrial vehicle A control box and operator interface for an industrial vehicle includes a left thumb joystick controller, a right thumb joystick controller, and integrated handles positioned adjacent the left thumb joystick controller and the right thumb joystick controller, respectively. The integrated handles are ergonomically positioned relative to the left and right thumb joystick controllers such that when an operator grasps the handles, the operator's thumbs are naturally positioned adjacent the left and right thumb joystick controllers, respectively. An enabling mechanism is associated with each of the integrated handles and includes a switch that serves to activate operational functionality of the left and right thumb joystick controllers.
US10906784B2	Method for crane assembly The invention relates to a system for central control of one or more cranes including at least one crane and at least one central control station, wherein the crane includes one or multiple image sensors observing a picked-up load, at least part of the crane surroundings and at least part of the crane structure, the crane is connected with the control station for the transmission of the image sensor data via at least one bidirectional communication link, and wherein the control station comprises at least one display element for the visual representation of the received sensor data as well as provides at least one input device for inputting control commands, and the control commands can be transmitted, via the communication link, to one or more crane actuators and/or the crane control for performing crane movements.
US10906781B2	Pneumatic vertical transportation device A pneumatic vertical transportation device comprises an expandable cylinder, a carriage rack, an air piping controller, and an air exhauster. The expandable cylinder includes a bellow body, with one end hanging carriage rack and the other end connected with a fixing plate. The expandable cylinder is connected with the air piping controller. While the carriage rack is rising, the air exhauster draws air from the bellow body through the air piping controller to gradually decrease pressure inside. Once pressure difference exceeds weight of the carriage rack, the carriage rack begins to rise. Volume of the expandable cylinder is reduced such that the lower disc of the expandable cylinder approaches top, and the expandable cylinder is maintained at low pressure state. While the carriage rack is descending, air is fed into the expandable cylinder through the air piping controller to gradually expand the bellow body, letting the carriage rack descend.
US10906780B2	Absorber for elevator system rail An elevator system includes a hoistway, the hoistway having a plurality of landing floors each landing floor having a landing floor door. One or more guide rails are located in the hoistway to guide one or more elevator system components along the hoistway. An absorber is located at a hoistway pit and is supportive of a guide rail of the one or more guide rails. The absorber is configured to absorb loads imparted to the guide rail due to vertical translation and/or compression of the hoistway. A method of supporting a guide rail of an elevator system includes locating an absorber in an elevator hoistway in operable communication with a guide rail of an elevator system. Vertically-acting loads are transmitted from the guide rail to the absorber via the absorber piston thereby increasing a fluid pressure in the housing chamber.
US10906779B2	Rail foot holder for fastening a rail of an elevator system A rail foot holder for fastening a rail in an elevator shaft includes a contact body defining a contact plane and at least one holding device. A first side part of a rail foot arranged between a holding head of the holding device and the contact plane to fasten the rail. A holding dimension between the holding head and the contact plane can be changed to compensate tolerances of the first side part. The holding head can be rotated about an axis of rotation into a fastening position to reduce the holding dimension. A side of the holding head facing the contact plane has a slope against the direction of rotation in at least one fastening region extending around the axis of rotation in the direction of rotation, in which fastening region at least indirect contact between the holding head and the first side part is enabled.
US10906778B2	Elevator rail clamping system An elevator rail clamping system for coupling to omega elevator rails is disclosed. Each omega elevator rail having a circular portion and a pair of wings extending therefrom. The system including a pair of hinged clamps with each clamp having a pair of jaws for receiving the circular portion of an omega elevator rail. The system further including an adjustable length load bearing beam mounted to each clamp.
US10906773B2	Remote fault clearing for elevators, escalators, and automatic doors Controlling an apparatus may include detecting a fault in the apparatus, such that a controller of the apparatus exits a normal operation state for controlling the apparatus and enters a faulted state based on the detected fault, operation of the apparatus is stopped based on the controller entering the faulted state, and the detected fault is recorded in a fault memory or a fault recorder of the controller. The controlling may include receiving a remote fault clearing command subsequent to detecting the fault, and clearing the detected fault in response to the remote fault clearing command, such that the controller exits the faulted state and enters the normal operation state, and operation of the apparatus is enabled based on the controller entering the normal operation state. Clearing the detected fault may include deleting the detected fault from the fault memory or fault recorder.
US10906769B2	Core with cushion strip A core for winding sheet material is proved. The core comprises a cylindrical tube having a longitudinally oriented slot formed therein, and a strip of soft material located in the slot. Because of the geometry of the slot and the strip, the strip may be softer in the central region but firmer where the core transitions from the relatively soft strip to the relatively hard tube. The leading edge of the sheet material imbeds itself into the soft central region of the strip as additional layers are wound around the core.
US10906766B2	Sheet discharging apparatus and image reading apparatus A sheet discharging apparatus includes a discharge portion discharging a sheet in a discharge direction; a sheet supporting portion including a support surface which supports a lower surface of the sheet discharged from the discharge portion; and a conductive portion which is electrically conductive and connected to a ground potential. The conductive portion is provided at the support surface.
US10906765B2	Sheet stacking device and image forming apparatus incorporating the sheet stacking device A sheet stacking device includes a stacker, a detector, a blower, and a moving device. A sheet is stacked on the stacker. The detector detects a stacking amount of the sheet on the stacker. The blower blows air to the sheet stacked on the stacker. The moving device moves the blower with respect to the stacker based on the stacking amount of the sheet detected by the detector.
US10906762B2	Sheet conveyance apparatus and image forming apparatus A sheet conveyance apparatus includes a control unit for executing a stop process of stopping a second sheet in a state in which the second sheet is nipped by a second conveyance portion, and a conveyance restart process of restarting conveyance of the second sheet stopped by the second conveyance portion. The control unit has a first mode in which the conveyance restart process is performed at a first timing at which a first time has elapsed since a first sheet has passed a reference position, and a second mode in which the conveyance restart process is performed at a second timing at which a second time longer than the first time has elapsed since the first sheet has passed the reference position.
US10906761B2	Feeder for feeding document to document imaging system and method for feeding documents A method and apparatus for processing documents are provided. The apparatus includes a feeder for receiving a packet of a plurality of documents and separating the documents to serially feed the documents to a scanner. A retard adjacent the feeder is operable in first and second positions. In the first position the retard forms a nip with the feeder so that the retard is operable to impede the progress of one or more documents in the packet while the feeder feeds one of the documents in the packet. In the second position, the retard is spaced apart from the feeder to form a gap between the feeder and the retard. The system further includes a sensor for detecting a characteristic of the documents in a packet indicative of whether the number of documents in the packet exceeds a predetermined threshold. A drive mechanism automatically drives the retard pad between the first and second positions in response to the detected characteristic.
US10906759B2	Loading dock vehicle restraint system A vehicle restraint system and a control system configured to manipulate an orientation of a vehicle restraint relative to a carriage that supports the restraint such that the hook is moveable between an engaged or extended position wherein the hook interferes with translation of vehicle relative to the vehicle restraint system and a disengaged or retracted position wherein the vehicle can be associated with or removed from interaction with the vehicle restraint system. The control system includes a single indicia whose output is manipulated such that a characteristic of the output of the indicia, rather that strictly operation thereof, indicates a secured or less than secured condition associated with operation of the restraint relative to a vehicle.
US10906758B2	Method for adjustably restricting air flow and apparatus therefor Apparatus for air flow limiting comprise a vertically oriented tube, a sail assembly positioned in the tube and moveable therewithin responsively to air flow through the tube to limit rate of air flow through the tube and halt air flow through the tube upon air flow rate through the tube exceeding a preselected value, and a moveable stop for adjustably changing the length of travel of the sail assembly thereby changing the maximum amount of air flow.
US10906757B2	Module for a conveyor system for bulk goods, and also conveyor system for bulk goods The module (19) for a conveyor system for bulk goods has at least one first tubular section (20). A second tubular section (23), which is provided with at least one coupling piece (21), branches away from said first tubular section. The second tubular section (23) adjoins a valve (13) which has three connections (25, 26). The first connection forms a flow-connection with the second tubular section (23). The second connection (26) of the valve (13) can be selectively connected to the first connection (25) by means of a first line and to the third connection (25) by means of a second line (48).
US10906754B2	Apparatus and method for manufacturing liquid crystal panel This application discloses an apparatus for manufacturing a liquid crystal panel and a method for manufacturing a liquid crystal panel. The manufacturing apparatus includes a vacuum attaching station, a pneumatic transmission mechanism and a sealant curing station, the vacuum attaching station is configured to support the liquid crystal panel on which sealant coating and substrate attaching have been completed, the pneumatic transmission mechanism is disposed at the vacuum attaching station and between the vacuum attaching station and the sealant curing station, the pneumatic transmission mechanism is provided with a plurality of air holes, and an angle included between an air discharging direction of the air holes and the liquid crystal panel is an acute angle.
US10906751B2	Device for transferring products The present invention relates to a method for transferring products from an accumulation surface to an outlet conveyor configured to convey products in a longitudinal direction using an intermediate conveyor arranged between, and flush with, said accumulation surface and said outlet conveyor, and a pushing device the method comprises decelerating the intermediate conveyor and transferring the products between the accumulation surface and the intermediate conveyor by said pushing device and accelerating the intermediate conveyor end transferring the products from the intermediate conveyor to the outlet conveyor. The present invention also relates to a device for transferring products from an accumulation surface to an outlet conveyor, in particular one that is capable of carrying out the method according to the invention.
US10906747B2	Conveyance system, control apparatus, and conveyance method A conveyance system includes a conveyance device including a first conveyance mechanism configured to convey freight supplied from a loader, and a second conveyance mechanism configured to convey the freight supplied from the first conveyance mechanism, a weight detection device configured to detect weight of the freight loaded on the second conveyance mechanism, and a control apparatus. The control apparatus includes a first conveyance control unit configured to control the first conveyance mechanism. The first conveyance control unit controls the first conveyance mechanism based on a detection value of the weight detection device.
US10906744B2	Retracting and swivelling transfer apparatus for attachment to a mobile conveyor A transfer apparatus for loading a main conveyor of an implement, for example a seed cart, includes a guide track mounted along the main conveyor, a carriage frame movable along the guide track from a deployed position aligned within an inlet opening of the main conveyor and a retracted position displaced along the main conveyor towards the discharge end from the deployed position, and a transfer conveyor including a discharge end operatively connected to the carriage frame for discharging into the inlet end of the main conveyor in the deployed position. The carriage frame including a swivel formed therein which supports the transfer duct for pivotal movement relative to the guide track about an upright swivel axis and about a lateral tilt axis in the deployed position.
US10906743B2	Roller and locking method thereof The present disclosure provides a roller and a locking method thereof. The roller includes a main body, a first groove provided on an inner surface of the main body, and a first elastic component fitted with the first groove; wherein a through hole for receiving and fixing a shaft is provided on the first elastic component. The present disclosure can be used to lock shafts.
US10906742B2	Carton unloader tool for jam recovery Various embodiments described herein generally relate to techniques for conveying articles on a conveyor system of a robotic material handling system in a material handling environment. In accordance with an embodiment, the robotic material handling system includes a front portion and a rearward conveyor. The front portion may be expandable to a first configuration and retractable to a second configuration. On detecting a jam on the front portion, the robotic material handling system may actuate expansion of the front portion to the first configuration, and attempt to dislodge the jammed articles by causing one or more of (i) separating the jammed articles by activating one or more of a plurality of zones of the front portion under the jammed articles, and/or (ii) activating one or more of the plurality of zones under the jammed articles in a reverse direction.
US10906737B2	Container for receiving multiple flexible bag assemblies Containers are described which can accommodate a variety of flexible bag assemblies used for containing waste. Internal accommodating structures are designed to accommodate and secure various types of bag assemblies, including single bag assemblies and cassettes.
US10906735B2	Container with fill state transmitter A plastic fuel container with a fill level transmitter has a floating body, which is disposed on a rotatably mounted carrier via a lever arm, and a magnet, which is disposed on the carrier and which rotates together with the carrier when the carrier rotates as a result of the floating body, and a Hall sensor, which is disposed in a fixed position relative to the magnet, for detecting a field strength, which changes when the magnet rotates, as a measurement for the fill level in the container. In addition, the Hall sensor is disposed on a sensor carrier which can be mounted from the outer side of the container.
US10906731B2	Drip bag A drip bag including a bag body having an upper end to be opened and two opposing surfaces, and a pair of hook members provided on outer faces of the opposing surfaces and spaced apart from vertical side edges of the bag body. Each of the hook members including an upper stuck part adhered along an opening of the bag body, a center part located below the upper stuck part, and a hook part not adhered to the bag body. For each of the hook members, a pair of oblique folding lines are formed on the upper stuck part, and a vertical folding line is formed downwardly from a lower end of each oblique folding line, whereby, in use, at least the oblique folding lines and the vertical folding lines cause the outer faces of the bag body to protrude outward from a bottom end of the bag body.
US10906729B2	Canister and valve An aerosol canister for dispensing a product and propellant, and a product metering valve for use with the aerosol canister. The canister includes a high pressure chamber for containing a liquefied or compressed gas propellant, a low pressure chamber for containing a gas propellant, and a product reservoir for containing a gas propellant. A pressure regulating valve is interposed between the high pressure chamber and the low pressure chamber, the pressure regulating valve adapted to provide a fluid flow path from the high pressure chamber to the low pressure chamber when the pressure in the low pressure chamber drops below a predetermined pressure. The canister further includes a partition wall interposed between the low pressure chamber and the product reservoir.
US10906724B2	Insulated box An insulated box includes a box, the box including a bottom panel and a side panel, the side panel attached to the bottom panel; and an insulated panel attached to the side panel, the insulated panel including an insulation batt and a sheet, the insulation batt enclosed between the side panel and the sheet.
US10906717B2	Pallet container A pallet container for storing and transporting in particular flammable or easily ignitable liquid filling materials has a composite base plate, a thin-walled rigid internal container made from a thermoplastic plastics material, a tubular lattice frame that as a supporting jacket tightly encloses the plastics-material internal container, and a base pallet on which the plastics-material container bears and to which the tubular lattice frame is fixedly connected. The plastics-material internal container is on all sides enclosed by a fire-protection insulation mat. The composite base pallet is equipped with a heat-resistant support element for maintaining the resistance thereof in the case of heat acting thereon over a comparatively long period at each plastics-material corner foot.
US10906715B2	Containers for card slots An example of a packet for a card slot. The container may include a chamber for storing oil. The packet may have a shape and a thickness to fit within a slot that holds a credit card. The packet may include a first lamina and a second lamina. The second lamina maybe affixed to the first lamina to form the chamber within a sealed region along a first peripheral region of the first lamina and a second peripheral region of the second lamina. A combined thickness of the first lamina, the second lamina, and the oil fits within a defined volume. A first surface of the first lamina and a second surface of the second lamina is substantially flat.
US10906714B2	Tool holder A tool holder contains: a connector and a fixer. The connector includes at least one body, and each of the at least one body has a first side plate, a second side plate, and a connection plate. The first side plate has a first fitting portion, and the second side plate has a second fitting portion. The first fitting portion and the second fitting portion define a square fitting zone, and the first side plate further has a first locking projection. Between the first fitting portion and the second fitting portion is defined a cavity so that the first fitting portion and the second fitting portion deform inwardly, and so that the first locking projection retract into the fitting zone. The fixer is housed in the cavity of the connector to limit an inward deformation of the first fitting portion and the second fitting portion.
US10906709B2	Systems and methods for containers with locking lug and recess Thermoformed locking assembly comprising a first web portion including locking lug having lug undercut defining a cantilevered lug ledge having lug engaging surface, second web portion including locking recess having recess undercut defining an opposing recess ledge having recess engaging surface and a lug stop opposite the recess undercut. Locking recess configured to receive locking lug and lug stop configured to position locking lug in locking recess with the lug engaging surface in engagement with the recess engaging surface when first web portion is moved towards second web portion.
US10906707B2	Disposable lid for beverage containers A disposable lid for containers with beverages, especially hot beverages, such as coffee and tea. The disposable lid has an open part where a compartment is created, enabling a person to drink directly from the top of the container, and where the compartment is limited by a floor. One embodiment includes an integrated filter with narrow slits to hinder particles, such as coffee grains or tea leaves from entering the mouth of the consumer of the beverage. Another embodiment includes an arrangement to slow down the beverage flow entering the drinking compartment, and optionally includes a cooling surface for the beverage. The lid may be provided with an auxiliary lid to be attached to reduce the spilling risk to a minimum.
US10906705B2	Stopper for a container with a reclosable dispenser providing evidence of first opening A stopper for a container providing evidence of first opening includes an upper part with a protection cap closable on a pouring element and a ridged lower part with an upper hollow cylindrical portion disposed inside the pouring element and a lower cylindrical portion of larger diameter that is internally threaded. A frangible label is positioned between the protection cap, and a security ring is connected with the upper and lower parts with frangible bridges. An annular security crown is connected to the lower part of the stopper by frangible bridges and a cam arrangement, coaxially coupled between an outer surface of the upper hollow cylindrical portion and an inner surface of the pouring element, causes their translation and rotation. The pouring element has a duct passage and a coaxial island shutter which cooperates with a central hole in the upper hollow cylindrical portion of the lower part.
US10906703B2	Vessel cap A vessel cap (100, 10) for exchanging gas in and pressuring a vessel headspace (30), the cap (100, 10) comprising a cap inlet (11), a seal (12) arranged to form a gas-tight seal on a vessel opening, a pressure reducing valve, a gas inlet port (25) arranged to allow incoming gas into the vessel headspace (30), a gas outlet port (31) arranged to allow outgoing gas to escape from the vessel headspace (30).
US10906699B2	Non-metallic tie A non-metallic tie, for example a twist-tie or a tin-tie, comprises a polymeric material melt-blending from a composition containing (a) from about 50 to about 80 wt % of at least one matrix-forming thermoplastic polymer which is amorphous or becomes amorphous when melted, and (b) from about 20 to about 50 wt % of at least one elastomeric polymer which has a flexural modulus of less than 700 MPa and a glass transition temperature less than 25° C., based on the combined weight of (a) and (b). The tie is characterized by tensile elongation at break according to ASTM D638-00 of from about 20° to about 100°; and a dead fold angle equal to or less than about 30°, as determined by a method including the steps of (i) providing a sample of the twist tie having two end portions, a thickness of 1-2 mm and a length of about 100 mm; (ii) folding the sample approximately in half in the lengthwise direction so that end portions are approximately adjacent to each other; (iii) relaxing the folded sample at room temperature for three minutes; and (iv) measuring as the dead fold angle the included angle between the article sample end portions.
US10906697B2	Systems and methods for attaching a container A container system securable to a base such as a roof gutter, a railing, a ladder top, a ladder rung, an edge, a platform and the like. The container system includes a container such as a utility bucket, a pail, and the like; a horizontal member in the form of a collar securely attached to or integratedly molded into the container. The collar is provided with a plurality of fasteners to removably attach the container to the base. In one embodiment, the fasteners are selected from braces, clamps, locking devices, clips, hooks, protrusions, and combinations thereof. In one embodiment, a U-bolt is provided to securely attach a bracket to the container, and for attaching to a base.
US10906692B2	Tieless flatware display packaging A tieless package is provided for displaying flatware pieces. The package has a rigid paperboard box. Sized to fit snugly within this box is a formed backer. The backer has a display panel surface and at least one recessed area and an insert recess running across the recessed area. A resilient foam insert is securely set into the insert recess. This insert has shaped slots for inserting individual flatware pieces. Each shaped slot has: a relatively narrow neck, and a relatively wider holding area under the narrow neck. An individual flatware piece is inserted into the slot by squeezing the piece through the relatively narrow neck to seat the piece in the wider holding area, and the foam of the slot's narrow neck recloses over the individual flatware piece after insertion to capture it in the holding area.
US10906691B2	Carton with article protection feature A carton for containing at least one article. The carton comprises at least one panel that can form an interior of the carton. The carton comprises at least one protection feature for protecting the articles from breakage. The article protection feature can comprise at least one feature in end flaps of the carton. The article protection feature can comprise an article protection flap foldably connected to the at least one panel. The article protection flap can be moveable between a first position and a second position wherein the article protection flap is folded relative to the at least one panel.
US10906688B2	Container with integral divider wall Containers for holding packaging, such as blister-pack packaging, can be formed from a unitary piece of paperboard or other material. The containers have an interior defined by front and rear walls, first and second sidewalls, and a container bottom. The containers also include a divider panel that separates the interior into at least two sections. Flaps having multiple apertures for receiving corners of the packaging can be attached to the first and second sidewalls and the divider wall.
US10906687B2	Systems and methods for custom labeling of products A method of custom labeling products in which users specify, via a purchasing interface, product label images in correspondence with products. A label group is generated for each of the users. The label group includes an indicator label image providing a purchase identifier and product identifiers, and the product label images arranged in a sequence specified by the product identifiers. The label groups are printed to produce printed label groups. The printed label groups are transferred to a labeling machine. A conveyor system is controlled to release, for each of the printed label groups, the sequence of the products specified by the product identifiers. Printed product labels of each of the printed label groups are applied to the corresponding sequence of the products.
US10906686B2	Sealing device The sealing device for packages that includes a control unit, a sealing station, an unwinder for a film web, a cutting device provided upstream of the sealing station and used for producing film sections of the film web, a film feed device for feeding the film sections to the sealing station, a conveying device for conveying packages into the sealing station. Preferrably, the packages include food packed in a gas-tight manner. Further, the sealing station may comprise upper and lower sealing elements that are configured for clamping the package and the film section in common between the lower and upper sealing elements and for sealing the film section onto the package. The sealing device may also include the sealing elements being adapted to be synchronously moved along with the continuously moving package during the sealing process.
US10906682B2	Food processing system, apparatus for testing a foreign object sensor and a method for operating the food processing system A food processing system is disclosed. The food processing system includes a food scaling portion, a food bagging portion and a chute portion connecting the food scaling portion to the food bagging portion. The food processing system also includes a foreign object sensor arranged about the chute portion. The foreign object sensor and the chute portion cooperatively form a foreign object sensing zone within a passage formed by the chute portion that extends along a portion of a length of the chute portion. The food processing system also includes at least one sensor testing conduit extending through one or both of the food scaling portion and the chute portion. An exit opening of the at least one sensor testing conduit is arranged in an opposing relationship with respect to the foreign object sensing zone. A foreign object sensor apparatus for detecting non-foodstuff material is also disclosed. A method is also disclosed.
US10906678B2	Inflating stick and processing machine An inflating stick and a processing machine are provided. The inflating stick includes a body, a link rod, a cutter, and one or more inflating tubes. A front end of the body includes a guiding segment with a cone structure. A rear end of the body includes a packing segment. The body includes a gas inlet formed on the packing segment, an internal chamber allowing gas to flow into through the gas inlet, and gas outlets formed on an outer wall of the body allowing gas to flow out. The packing segment includes a first locking structure and a second locking structure. The first locking structure and the second locking structure communicate with the gas inlet. The second locking structure is detachably fastened to the first locking structure. The link rod and the cutter are disposed in rear of the body. The inflating tube is connected to the gas inlet.
US10906677B2	Apparatus and process for evacuation of packages A device (1) for evacuating gas from a package (50) in a packaging apparatus, the package (50) having an open end (55), the open end (55) having a terminal portion (54), a non-terminal portion (52), and an intermediate portion (53) located between the terminal portion (54) and the non-terminal portion (52) of the open end (55), the device (1) comprising a vacuum chamber (10) having an elongated opening (14) extending along a longitudinal axis of the vacuum chamber (10), an evacuation means configured for providing the vacuum chamber (10) with an internal vacuum pressure that is lower than an ambient pressure outside the vacuum chamber (10), means for moving (30) a package (50) relative to the vacuum chamber (10), and a control unit (60) programmed for controlling the means for moving (30) to relatively move a package (50) to be evacuated with respect to the vacuum chamber (10), the package (50) and the means for moving (30) each being arranged with respect to the vacuum chamber (10) so that a main movement direction (40) of packages (50) placed on the means for moving (30) and the longitudinal axis of the vacuum chamber (10) are substantially parallel to one another, the package (50) to be evacuated being positioned so that, during the relative movement of the package (50) with respect to the vacuum chamber (10), a terminal portion (54) of the open end (55) of the package (50) relatively moves within the vacuum chamber (10) and a non-terminal portion (52) of the open end (55) relatively moves outside the vacuum chamber (10), an intermediate portion (53) of the open end (55) passing through and relatively moving along the opening (14), and activating the evacuation means to provide the vacuum chamber (10) with the internal vacuum pressure. A packaging process using the gas evacuation device and a packaging apparatus including the device are also disclosed.
US10906671B2	Modular architecture optimized for making microsatellites The present invention concerns a method for making a microsatellite, comprising providing: modules of a first type configured to house electronic boards of a microsatellite; modules of a second type configured to house devices and systems of a microsatellite; and modules of a third type comprising first and second interface means configured to be coupled to a launch vehicle and to external appendages of a microsatellite, respectively; said modules of a third type being designed to cause a body of a microsatellite to have a predefined height; wherein all the modules of the first, second and third types are configured to be stacked regardless of the type. The method further comprises making a body of a microsatellite by stacking modules of different types, wherein the stacked modules include at least one module of the second type and at least one module of the third type.
US10906670B2	Methods for effluent based condition assessment A method for determining a condition of a second component of an engine is disclosed wherein the engine includes at least a first component and the second component. The method includes determining a concentration value of a chemical species in an effluent obtained from washing at least a portion of the first component of the engine, inputting the concentration value of the chemical species in a condition assessment model to update the condition assessment model, and estimating the condition of the second component based on an output of the updated condition assessment model. The effluent used herein includes a wash fluid and the chemical species. The second component is different from the first component and the condition assessment model is a representative of a condition of the second component of the engine.
US10906669B2	Crack pepair method for inhibiting crack growth in wall portion by using ultrasonic wave There is provided a crack repairing method for suppressing a crack growth in a wall portion. The crack repairing method includes an injection step in which working fluid is injected into a crack formed into a surface of the wall portion of a target object and a vibration step in which vibration is applied to the working fluid in a direction from an crack initiation portion of the crack on the surface to an inner end portion of the crack. The crack repairing method further includes a deformation step in which a cavity is generated in the working fluid by the applied vibration and compressive residual stress is generated at the inner end portion of the crack.
US10906666B2	Stabilized aggregates and other materials and structures for energy absorption Materials and structures for absorbing energy. The materials and structures are well suited for arresting aircraft and other vehicles, although their purposes need not be so limited. Also detailed are packaging and other solutions for maintaining system integrity, especially (but not exclusively) when foam glass or other aggregate is employed and stabilizing the location of the aggregate is desired.
US10906664B2	Multi-rotor aerial vehicle Multi-rotor aerial vehicle (1, 1′, 1″, 1′″, 1″″, 1″″′, 1″″″) comprising, at least a first, second and third rotor 10, 20, 30, each rotatable by a dedicated first second and third hydraulic motor 11, 21, 31, a power unit 2, at least a first, second and third hydraulic pump 12, 22, 32 dedicated to the respective first, second and third hydraulic motor 11, 21, 31, wherein each hydraulic pump 12, 22, 32 is arranged to provide pressurized fluid to each hydraulic motor 11, 21, 31 for powering the hydraulic motor 11, 21, 31 and thereby rotating the respective rotor 10, 20, 30, a control unit 6 for controlling the operation of the multi-rotor aerial vehicle (1, 1′, 1″, 1′″, 1″″, 1″″′, 1″″″), wherein the control of the multi-rotor aerial vehicle (1, 1′, 1″, 1′″, 1″″, 1″″′, 1″″″) is arranged to be performed by altering the flow of pressurized fluid distributed to each respective hydraulic motor 11, 21, 31, wherein, wherein the flow of pressurized fluid provided to each hydraulic motor 11, 21, 31 is individually controllable by means of at least one control valve 13, 23, 33 configured to control the flow of pressurized fluid from each hydraulic pump 12, 22, 32 to its dedicated hydraulic motor 11, 21, 31.
US10906663B2	Apparatus for boundary layer air inlet utilization A boundary layer utilization apparatus for intake of air to a high speed aircraft, comprises a first air inlet adjacent an exterior surface of a fuselage of the aircraft and offset from the fuselage enough to integrate a second air inlet in the offset space to ingest and divert the boundary layer air flowing next to the fuselage into the aircraft for a useful purpose such as cooling the engine compartment. The second air inlet is disposed aft of the first air inlet to minimize hot gas re-ingestion.
US10906661B2	Nacelle cowl hinge A nacelle for a gas turbine engine includes at least one hinge axis extending along the nacelle. At least one cowl is mounted to the nacelle, along the at least one hinge axis, by a plurality of hinges. The plurality of hinges includes at least one latch. The at least one latch includes a clevis and a tang. The clevis and the tang of the at least one latch are configured to receive a hinge pin, through a pin aperture, when the at least one cowl is in a closed condition.
US10906659B2	Structured panel with structural reinforcement(s) A panel is provided for attenuating sound. This panel includes a perforated first skin, a second skin and a core. The core forms a plurality of cavities vertically between the perforated first skin and the second skin. The core includes an array of corrugations that include a first baffle, a second baffle and a first septum. The cavities include a first cavity formed longitudinally between the first baffle and the second baffle. The first cavity is fluidly coupled with perforations in the first skin. The first septum extends from the first skin and the first baffle to the second skin and the second baffle. The first septum divides the first cavity into fluidly coupled sub-cavities. At least one element of the panel includes at least one first rib and at least one second rib, the first rib extends along a first trajectory and the second rib extends along a second trajectory that is non-parallel with the first trajectory.
US10906658B2	Energy storage system for a hybrid power system Energy storage systems for aircraft and methods of operating the same are provided. The energy storage system may include a main battery, a propulsion power bus, a non-critical bus, a critical bus, and an engine starter bus. The propulsion power bus may be configured to convey electricity, which is supplied by the main battery, to an electric propulsion machine configured to provide propulsion for the aircraft. The non-critical bus may be configured to convey electricity to a hotel load on the aircraft. The critical bus may be configured to convey electricity, which is supplied by the main battery, to a critical load on the aircraft. The engine starter bus may be configured to convey electricity, which is supplied by the main battery, to an electric starter for a gas turbine engine, where the gas turbine engine is configured to power the electric propulsion machine.
US10906656B2	Hybrid tiltrotor drive system An exemplary tiltrotor aircraft with a hybrid drive system includes a first propulsion system having a first engine and a first supplemental driver operably coupled to a first proprotor that is operable between a helicopter mode and an airplane mode and a second propulsion system having a second engine and a second supplemental driver operably coupled to a second proprotor that is operable between a helicopter mode and an airplane mode.
US10906655B2	Under-instrument panel emergency vision apparatus An emergency vision apparatus includes a housing for attachment underneath an instrument panel in a cockpit, the housing including a front opening, a front cover for the front opening, a bottom portion of the front cover being pivotably attached to the housing to allow the front cover to open and rotate downwardly; an inflatable enclosure made of airtight material and having an expanded form when deployed and a deflated form when not in use, the enclosure when in the deflated form is stored within the housing; first and second clear members disposed at respective first and second ends of the enclosure to enable a user to see through the enclosure when expanded and observe a source of visual information at a distal end of the enclosure while smoke or other particulate matter is in the environment; a first switch operably associated with the blower to activate the blower and thereby inflate the enclosure to the expanded form when the enclosure is to be deployed; and a tubular air passageway connecting the blower and the enclosure.
US10906654B2	Parachute landing assistant The embodiments of the Parachute Landing Assistant are comprised of a battery pack, a power switch, an LED indicator light; an audio jack; a microcontroller; and a ground proximity sensor. The LED indicator light informs the parachutist as to whether operation is enabled or disabled and indicates when the unit is charging. The microcontroller controls the components of the Parachute Landing Assistant. The ground proximity sensor senses the distance from the ground of the parachutist. The ambient pressure sensor allows the unit to determine its height. During a jump the ambient pressure gauge will sense the pressure change and turn on the Parachute Landing Assistant. It will also be used to send a warning to advise the parachutist of upcoming flare tones established by the ground proximity sensor and microcontroller.
US10906653B2	Aircraft air conditioning system with a reduced process air demand An aircraft air conditioning system comprising an air conditioning unit adapted and configured to be supplied with compressed process air and to generate cold fresh air, a mixer adapted and configured to mix the cold fresh air from the air conditioning unit with recirculation air recirculated from an aircraft region to be air conditioned, an air outlet adapted and configured to direct mixed air from the mixer into the aircraft region, a first sensor adapted and configured to detect an actual temperature in the aircraft region, a second sensor adapted and configured to detect a temperature of the mixed air directed into the aircraft region, and a control unit adapted and configured to control an operation of the air conditioning unit in dependence on a difference between the temperature of the mixed air directed into the aircraft region and the actual temperature in the aircraft region.
US10906651B2	Compact functional arrangement in a cabin of a vehicle and vehicle with such a functional arrangement A functional arrangement in a cabin of a vehicle includes a monument with a housing having several side walls, which define an interior space, and at least two adjacently arranged seats each having a backrest and headrest. The seats adjoin an exterior side of a first side wall of the housing, and have a seating direction facing away from the first side wall. The first side wall includes a first surface portion that is located at least sectionally behind the headrests of the at least two seats in a vertical direction and includes at least one bulge extending at least in a horizontal direction between two adjacently lying headrests. At least one piece of equipment is situated in the interior space, extends into the at least one bulge and is usable in the interior space of the monument.
US10906646B2	Integrated passenger service unit (PSU) An integrated passenger service unit (PSU) is disclosed. The integrated PSU includes a housing installable into an aircraft overhead panel and a control knob set into, and positionable relative to, the housing. The housing incorporates signage elements (e.g., fasten seat belts, no smoking) visible through its exterior surface, as well as reading lights and gasper outlets set thereinto (e.g., as adjacent segments of an annulus). Each reading light includes an LED array selectably configured to illuminate the corresponding seat, and each gasper outlet directs an airstream toward the seat. The housing includes a notification ring configured to illuminate when the passenger calls a flight attendant. A control knob is set within the housing and positionable relative thereto. The control knob incorporates an LCD display and user interface (UI) which allows the occupant or passenger to view and adjust the status of the reading lights, gasper outlets, and notification ring.
US10906641B1	System and method for releasing UAVs from an airborne vehicle A system for releasably retaining at least one UAV in an aircraft includes a support member connected to the aircraft and extending through a passage. At least one boom is secured to the support member. Each boom has an expanded condition preventing the UAV from exiting the passage and a collapsed condition allowing the UAV to exit the passage in the wing.
US10906638B2	Helicopter tail rotor blades and blade assemblies A tail rotor blade for a helicopter includes a blade body defining a longitudinally extending spar cavity, a leading edge forward of the spar cavity, and a trailing edge aft of the spar cavity. Upper and lower airfoil surfaces extend from the leading edge to the trailing edge on opposite sides of the spar cavity. The upper and lower airfoil surfaces define between one another a constant airfoil segment and transition airfoil segments disposed longitudinally adjacent to the constant airfoil segment on inboard and outboard sides of the constant airfoil segment.
US10906633B2	Flight control computer of an aircraft A flight control computer of an aircraft is likely to operate in a so-called incidence protection mode in which it is configured to compute the deflection orders of an elevator as a function of incidence angle values supplied by a set of incidence probes, so as to keep the incidence angle of the aircraft within a range of acceptable incidence angle values. The flight control computer is configured to, when only one incidence probe is operational: compute a first estimated incidence angle value of the aircraft, by a first estimator and a second estimated incidence angle value of the aircraft, by a second estimator unlike the first estimator; and keep the incidence protection mode activated as long as the incidence angle value supplied by the single operational incidence probe is consistent with at least one out of the first estimated incidence angle value and the second estimated incidence angle value.
US10906629B2	Leading edge skin structure A leading edge skin panel for an aerodynamic structure of an aircraft. The skin panel includes attachment components for attaching the leading edge skin panel to the structure. A primary attachment component is configured to substantially prevent spanwise relative movement between the leading edge skin panel and the structure. The remaining attachment component are configured to permit a predetermined amount of spanwise relative movement between the leading edge skin panel and the structure.
US10906622B1	Trolling motor and mount for trolling motor A trolling motor includes a head unit, a propulsion unit, and a shaft coupling the head unit to the propulsion unit. A shaft support couples the shaft to a mount base, which may be coupled to watercraft's deck. The shaft support is pivotable with respect to the mount base to move the trolling motor between a deployed position and a stowed position with respect to the deck. The trolling motor further includes a spring and damper combination coupled between the mount base and the shaft support, wherein a spring portion of the spring and damper combination provides a spring force to assist in pivoting the shaft support away from the deck, and a damper portion of the spring and damper combination provides a damping force to slow pivoting of the shaft support towards the deck and/or a metal-reinforced, self-lubricating bearing pivotably coupling the shaft support to the mount base.
US10906616B2	Light guides with coating to be used in water The invention provides a light guide element (1300) comprising a light guide (300), wherein the light guide (300) in comprises a first light guide face (301) and a second light guide face (302) with UV radiation transmissive light guide material (305) between the first light guide face (301) and the second light guide face (302), wherein the light guide element (1300) further comprises one or more of: (i) a first layer element (30) in contact with the first light guide face (301), wherein the first layer element (30) is transmissive for UV radiation; and (ii) a second layer element (130) in contact with the second light guide face (301), wherein the second layer element (130) has one or more functionalities selected from the group consisting of (a) reflective for UV radiation, (b) adhesive for adhering the light guide (300) to an object, (c) reinforcing the light guide element (1300), and (d) protective for the light guide (300).
US10906613B1	Boat top A boat top (1) having a collapsible frame that may be disassembled and stored when not in use and that provides storage for items, such as paddleboards, floating docks and so forth that double as a roof to provide shade and protection from the elements.
US10906612B2	Marine equipment inventory tool A system and method for tracking marine equipment is provided. Generally, the system and method of the present disclosure are designed to generate indicia corresponding to the inventory level of marine equipment used for a particular marine activity. To facilitate the assignment of indicia reflecting the inventory level of marine equipment used for a marine activity, the system and method of the present disclosure uses a plurality of equipment profiles having a defined lower limit and quantity associated with each piece of marine equipment. The lower limit may be manually input or automatically generated. The quantity may be tracked by the system using equipment transmitters and equipment sensors. In a preferred embodiment, the indicia indicate whether the quantity of a piece of marine equipment has fallen below a certain specified level as defined by the user. Users may purchase new marine equipment from third-party retailers via the user interface.
US10906610B2	Ebike with partially exposed battery An ebike comprises a front wheel, a rear wheel, a frame structure supported on the front wheel and the rear wheel, a crank assembly, and a battery assembly. The frame structure includes a down tube defining a down tube axis and being open at its lower end. The crank assembly is rotatable about a crank axis that is spaced rearward from the down tube axis. The battery assembly is slidable into the down tube from the lower end of the down tube along the down tube axis. The battery assembly includes a battery housing protruding from the lower end of the down tube, and a battery cover secured to a lower end of the battery housing and substantially enclosing the lower end of the battery housing. At least a portion of the battery housing may extend below a horizontal plane defined by the crank axis.
US10906609B2	Ebike motor mount An ebike comprises a front wheel, a rear wheel, and a frame structure supported on the front wheel and the rear wheel. The frame structure includes a main frame having a bottom shell coupling a down tube to a seat tube. The bottom shell at least partially defines a hollow interior. The motor assembly has an upper motor portion positioned in the hollow interior and a lower motor portion hanging below the bottom shell, and the battery assembly is at least partially positioned in the hollow interior, and the battery assembly includes a lower battery portion hanging below the bottom shell. The frame structure may also include a rear frame pivotally coupled to the main frame at a lower pivot axis defining a horizontal plane. The motor assembly may be secured to the bottom shell by a lower fastener below the horizontal plane and an upper fastener above the horizontal plane.
US10906608B2	Bicycle system A brake system includes a driving part driven by electric power to brake a rotary body of a human-powered vehicle and an electronic controller configured to control the driving part. The electronic controller has a plurality of control modes including a first mode that drives the driving part in accordance with a user operation and a second mode that does not drive the driving part regardless of the user operation. The electronic controller is configured to switch the plurality of control modes based on setting information related to an input to the human-powered vehicle.
US10906604B2	Detachable accessory carrier A detachable accessory carrier for a bicycle having a seat frame post, the detachable accessory carrier including an extension beam having a proximal end portion and an opposing distal end portion with a longitudinal axis spanning therebetween, also a structure for removable engagement to the seat post wherein the structure is disposed on the proximal end portion, a first base, a first surrounding sidewall having a first open slot with a rotationally engaged second base with a second surrounding sidewall having a second open slot, with a plurality of cantilever flexible tines disposed inside of the first surrounding sidewall to help retain the accessory, wherein the first and second open slots can be rotated to bring the accessory out in sideways movement from the tines.
US10906601B2	Passenger vehicle A passenger vehicle provided with a steering handle and configured such that an attitude angle of the driver seat surface relative to a horizontal reference plane is changeable, so that a first attitude changing operation switch and a second attitude changing operation switch for changing the attitude angle are disposed in such positions as to be operable with a thumb of the driver of the vehicle from a steering handle grip of the steering handle.
US10906591B2	Wheel house unit structure A wheel house unit structure is provided which has a wheel house including a curved surface portion, a circular cylindrical suspension tower provided at the curved surface portion, at the vehicle front side, of the wheel house, and a reinforcement member connected to the curved surface portion of the wheel house and to an outer circumference of the suspension tower. The reinforcement member has a ridge which connects the curved surface portion and the outer circumference of the suspension tower in a front-and-rear direction of the vehicle, and forms a closed cross section structure with the curved surface portion of the wheel house and the outer circumference of the suspension tower.
US10906588B2	Air supply system for whole vehicle Disclosed is an air supply system for a whole vehicle, which is intended to solve the technical problem that it is hard to provide a multi-position and controllable air supply solution for an electric vehicle. A first air source device, a control valve and a pipeline constitute a first-type air supply system, the first-type air supply system has multiple air passages, each air passage is respectively provided with an air supply port, and a controller can switch operating states of the control valve, control the opening or closing of the multiple air passages, and achieve controllable air supply effects in multiple positions. A second air source device and several pipelines constitute a second type of air supply system, the second type of air supply system has multiple air passages, each air passage is respectively provided with an air supply port, and a controller can switch operating states of the second air source device, control the opening or closing of the multiple air passages, and achieve controllable air supply effects. The first type of air supply system and the second type of air supply system are rationally configured on the electric vehicle, so as to achieve multi-position and controllable air supply effects.
US10906587B2	Vehicle body front structure A vehicle body front structure includes a front sub-frame configured such that a gear box is fitted to a front part of the front sub-frame, an arm portion extending from a front part of the front sub-frame forward and outward in a vehicle width direction, an impact absorbing portion supported by the arm portion, and a horn portion arranged on a front side of the impact absorbing portion.
US10906585B2	Chassis with wheels The present disclosure provides a chassis comprising a frame, two hanging units symmetrically provided at both sides of the frame, and a front guiding wheel and a rear universal wheel provided below the frame, wherein each of the hanging units comprises a mounting rack fixedly connected to the frame, a hanging rack slidably connected to the mounting rack, and a driving wheel rotatably connected to the hanging rack, and the front guiding wheel is provided with a first driving motor, and the driving wheel of each hanging unit is driven by a second driving motor, and wherein a closed loop speed control system is formed between the first driving motor and both second driving motors, such that a rotational angle of the front guiding wheel is adjustable via the first driving motor when revolving speeds of both second driving motors are changed.
US10906584B2	Method and device that assists a parking maneuver of a motor vehicle The present disclosure concerns a method and device that assists a parking maneuver of a motor vehicle. The method and device to assist a parking maneuver of a motor vehicle, with which the motor vehicle is maneuvered into an intended parking space at least partly, automatically, detects a curb bounded by at least one curb edge located in a vicinity of the motor vehicle. A trajectory is determined along which the motor vehicle can be moved into the intended parking space while carrying out at least one move of the maneuver. The trajectory is modified depending on at least one distance between the at least one curb edge and a tire of the motor vehicle that is expected for the trajectory while carrying out the parking maneuver.
US10906583B2	Autonomous trailer hitching using neural network A method of maneuvering a vehicle in reverse for attachment to a trailer is disclosed. The method includes receiving one or more images from one or more cameras positioned on a back portion of the vehicle and identifying one or more trailers within the one or more images. The method also includes receiving an indication of a selected trailer from the one or more trailers. Additionally, the method includes determining a vehicle path from an initial position to a final position. The vehicle path includes maneuvers configured to direct the vehicle in a rearward direction along the vehicle path from the initial position to the final position. The method also includes executing one or more behaviors causing the vehicle to take an action to autonomously follow the vehicle path and execute the maneuvers.
US10906582B2	Method for the driver assistance of a road vehicle A method for the driver assistance of a road vehicle; the assistance method comprises the steps of: determining an actual steering angle of the front wheels; determining a desired steering angle of the front wheels; and changing the servo-assistance torque applied by a servo-assistance device to a steering system based on the actual steering angle and on the desired steering angle, so that the servo-assistance torque that is applied when a steering wheel is rotated in a first direction to change the actual steering angle causing it to approach the desired steering angle is greater than the servo-assistance torque that is applied when the steering wheel is rotated in a second direction, which is opposite to the first direction, to change the actual steering angle causing it to distance itself from the desired steering angle.
US10906576B2	Anti-rotation feature for steering column telescope drive assembly A telescope drive assembly for a steering column assembly includes a column jacket moveable in a rake direction and defining a tapered slot. The telescope drive assembly also includes a telescope actuator assembly operatively coupled to the column jacket to move the column jacket in a telescope direction. The telescope drive assembly further includes a telescope drive bracket operatively coupled to the telescope actuator assembly and to the column jacket, the telescope drive bracket and the column jacket rotatable about a common axis in the rake direction. The telescope drive assembly yet further includes a telescope guide disposed between the telescope drive bracket and the column jacket, the telescope guide disposed at least partially within the tapered slot and translatable within the tapered slot in the telescope direction.
US10906566B2	Running gear provided with a passive hydraulic wheel set steering system for a rail vehicle A running gear for a rail vehicle includes a front and a rear wheel sets, each provided with left and right wheels. A passive hydraulic wheel set steering system includes a control valve hydraulically connected to hydro-mechanical converters for converting motion of each of the wheels towards and away from the median transverse vertical plane. The control valve is movable between a first position in which the front left and right hydro-mechanical converter assemblies are disconnected from the rear left and right hydro-mechanical converter assemblies, and a second position in which each of the front left and right hydro-mechanical converter assemblies is connected to at least a respective one of the rear left and right hydro-mechanical converter assemblies.
US10906565B2	Axle box suspension of railcar bogie and method of producing the same A railcar bogie axle box suspension axle beam includes an end portion d at a tip end, a tubular portion at the end portion and being open at both car width direction sides. The tubular portion includes: a first semi-tubular portion integrally formed with a main body portion; a second semi-tubular portion brought into contact with the first semi-tubular portion from one side in the car longitudinal direction; and a bolt fastening the second semi-tubular portion to the first. The first semi-tubular portion includes: a flat opposing surface contacting the second semi-tubular portion; and a hole into which the bolt is inserted. The second semi-tubular portion includes: a flat opposing surface contacting with the first semi-tubular portion surface; a flat machining reference surface formed at an opposite side of the opposing surface; and a hole extending in a direction perpendicular to the opposing surface, the bolt inserted into the hole.
US10906560B2	Integrated mandrel vehicle restraint with pedal tensioner An apparatus includes a mandrel assembly, an anchor, a strap, a winch, a first pedal, an advancer. The mandrel assembly is positioned on a first side of a tire of a vehicle and to couple to a track assembly of rail car. The anchor is positioned on a second side of the tire and to couple to the track assembly. The strap assembly is coupled to the mandrel assembly and the anchor and wraps around the tire. The winch is coupled to the mandrel assembly. The winch includes a first sprocket. The advancer is coupled to the first pedal and engages the first sprocket such that, when the first pedal is pushed towards the winch, the advancer pushes the winch such that the winch and the mandrel assembly rotate in a first direction.
US10906558B1	Methods and systems for managing interactions of an autonomous vehicle with other objects A method and a system for managing interactions of an autonomous vehicle with one or more objects are described. In one embodiment, objects that are in the vicinity of the autonomous vehicle are detected based on sensor measurements. An interaction label is determined for each one of the objects. The interaction label is one of a yield label, a no-yield label, a stay-behind label, a stay in-front label, and an irrelevant label and describes an interaction of the autonomous vehicle with the object. A cost function is generated for the object based on the interaction label. A trajectory for an interval of time is determined for the autonomous vehicle based on the cost functions of one or more objects. The trajectory is then used to generate control commands for controlling the motion of the autonomous vehicle during the interval of time.
US10906557B1	Haptic function of electric vehicle powertrain A system generates haptic feedback in an electric vehicle. The system comprises a frame, an energy storage device, and a wheel rotatably coupled to the frame. A motor receives power from the energy storage device and provides torque to the wheel. A controller determines a first operational state of the electric vehicle and transmits a first torque signal to the motor to control the motor to transmit first torque levels to the wheel to propel the electric vehicle. The controller determines a second operational state of the electric vehicle and transmits a second torque signal to the motor assembly. The motor assembly transmits second torque levels to the wheel to generate haptic feedback. The second torque signal is based on the second operational state of the electric vehicle and a torque profile stored in the memory, where the torque profile defines an irregular-shaped periodic waveform (e.g., a heartbeat rhythm).
US10906554B2	Autonomous driving system An autonomous vehicle driving system includes a control that autonomously controls the vehicle. The control, upon receipt of a destination geographical location, controls the vehicle to travel to the destination geographical location, and wirelessly receives data pertaining to driving conditions relevant to the route being traveled by the vehicle. Responsive to the received driving conditions data, the control determines a geographic location ahead of the vehicle along the route where driving of the vehicle by an occupant of the vehicle is desired. When the vehicle is traveling along the route and toward the determined geographic location and is within a threshold time and/or distance to the determined geographic location, the control informs the occupant of distance to and/or time of travel to the determined geographic location so the occupant is prepared to take over control of the vehicle and drive the vehicle upon the vehicle reaching the determined geographic location.
US10906553B2	Systems and methods for vehicle acceleration event prediction inhibit Methods and systems for inhibiting an acceleration event prediction includes determining a current vehicle operating condition. An acceleration event is predicted based on a plurality of stored predictions that match the current vehicle operating condition. A determination is made whether to inhibit the acceleration event prediction. The acceleration event prediction is permitted to modify an acceleration event powertrain control such that a powertrain control occurs. A driver noncompliance with the acceleration event powertrain control is stored as a machine learning data and the current vehicle operating condition is stored as machine learning data upon the driver noncompliance. The stored machine learning data is used to determine whether to inhibit a future acceleration event prediction.
US10906551B2	Traveling work vehicle equipped with work apparatus A traveling work vehicle includes: a vehicle speed control portion configured to control the vehicle speed; a number-of-revolutions calculation portion configured to calculate, as an actual number of revolutions, a number of revolutions of a single rotary power source per unit time; a number-of-revolutions command generation portion configured to generate a number-of-revolutions command using a requested number of revolutions; a requested vehicle speed input portion configured to input a requested vehicle speed that is based on a user operation; a requested vehicle speed calculation portion configured to calculate a computed requested vehicle speed using a deviation between the requested number of revolutions and the actual number of revolutions, and the requested vehicle speed; and a vehicle speed command generation portion configured to give the vehicle speed control portion a vehicle speed command that is generated using the computed requested vehicle speed.
US10906550B2	Vehicle control apparatus The present invention provides a vehicle control apparatus capable of traveling a vehicle by automated driving, comprising a state detection unit configured to detect a state of an occupant in the vehicle, and a control unit configured to set a traveling mode of automated driving in accordance with a change in the state of the occupant detected by the state detection unit.
US10906547B2	Controlling engine idle sailing in a vehicle using relative vehicle speed A method can include: detecting a distance between the host vehicle and a preceding vehicle and a current speed of the preceding vehicle; calculating a relative speed of the host vehicle with respect to the preceding vehicle based on a current speed of the host vehicle and the detected current speed of the preceding vehicle; determining whether to activate an engine idle sailing (EIS) function, in which a driving gear of the host vehicle shifts to neutral, based on the relative speed of the host vehicle with respect to the preceding vehicle and the detected distance between the host vehicle and the preceding vehicle; and in response to determining to activate the EIS function of the host vehicle, controlling operation of the host vehicle so as to activate the EIS function of the host vehicle, causing the driving gear of the host vehicle to shift to neutral.
US10906546B2	High efficiency, high output transmission A transmission includes an input shaft coupled to a prime mover, a countershaft, main shaft, and an output shaft, with gears between the countershaft and the main shaft. A shift actuator selectively couples the input shaft to the main shaft by rotatably coupling gears between the countershaft and the main shaft. The shift actuator is mounted on an exterior wall of a housing including the countershaft and the main shaft. An integrated actuator housing includes a single external power access for the shift actuator. A controller interprets a shaft displacement angle, determines if the transmission is in an imminent zero or zero torque region, and performs a transmission operation in response to the transmission in the imminent zero or zero torque region.
US10906545B2	Adjusting mechanical elements of cargo transportation units In some examples, a controller includes at least one processor configured to receive information regarding a condition associated with a cargo transportation unit (CTU), the received information regarding the condition including information of an environment around the CTU at a location of the CTU, and adjust an adjustable mechanical element of the CTU in response to the received information.
US10906543B2	Vehicle control system and method A vehicle control system includes a preceding vehicle selector that selects a pair of preceding vehicles, a target pair recognizer that executes a pairing process of storing a distance between a first target and a second target belonging to the respective preceding vehicles as an offset, and an intervehicular distance setter that sets both of a distance between an own vehicle and a first target as an intervehicular distance when the first target and the second target are detected as a target pair, and a distance corrected based on the offset as an intervehicular distance when the first target out of the target pair is not detected. The target pair recognizer stores a history of determination parameters including at least one of changes in relative distance, relative speed, and lateral deviation amount between the first and second targets.
US10906539B2	Automatic driving navigation method, apparatus, and system, in-vehicle terminal, and server An automatic driving navigation method, apparatus, and system, an in-vehicle terminal, and a server are provided. The method includes obtaining, by an in-vehicle terminal, satellite positioning data of a vehicle, receiving a differential positioning correction from a radio base station in a wireless network, and correcting the satellite positioning data using the differential positioning correction to obtain a high-precision location of the vehicle; providing, by the server, a lane level planning driving route to the in-vehicle terminal according to the high-precision location provided by the in-vehicle terminal and with reference to high-precision map information; and controlling, by the in-vehicle terminal according to the obtained high-precision location, the vehicle to automatically drive according to the lane level planning driving route. A satellite differential positioning technology based on wireless network assistance can be used, and round-the-clock and all-road-condition automatic driving navigation is implemented.
US10906535B2	System and method for vulnerable road user detection using wireless signals A method for detecting vulnerable road users (VRUs) using wireless signals includes receiving, by a wireless receiver, wireless signals from mobile devices and determining received signal strength indication (RSSI) levels of the wireless signals. The wireless signals and the RSSI levels of the wireless signals received by the wireless receiver are analyzed so as to determine at least one location of the VRUs. A notification is issued to the vehicle or a driver of the vehicle based on the at least one determined location of the VRUs.
US10906533B2	Method for manoeuvring a motor vehicle into a parking space with determination of a parking trajectory, driver assistance system and motor vehicle A method for manoeuvring a motor vehicle into a parking space includes: determining a parking trajectory from a starting point to a destination point in the parking space, wherein the parking trajectory includes circular arcs, straight lines, and clothoids; manoeuvring the motor vehicle along the determined parking trajectory into the parking space; and determining an auxiliary trajectory with a plurality of sections from the starting point to the destination point. The auxiliary trajectory includes circular arcs and straight lines as the sections, a respective transition region is defined for neighbouring sections, and a clothoid is determined for the respective transition regions. The parking trajectory is determined from the auxiliary trajectory in which the respective transition regions are replaced by the clothoids.
US10906526B2	Dynamic hybrid vehicle system for stabilizing cylinder deactivation or turbocharger boosting A computing device-implemented method includes receiving data representative of one or more operational parameters for a vehicle, calculating the fuel rate required for an internal combustion engine of the vehicle to respond to the operational parameters, determining if the required fuel rate exceeds a threshold which would cause a state change in the performance of the internal combustion engine, if the required fuel rate exceeds the threshold, calculating an amount of assistance required for an electric hybrid traction motor to provide to a drivetrain of the vehicle to implement the received operational parameters of the vehicle, and providing the amount of assistance to the drivetrain of the vehicle, thereby preventing the state change in the performance of the internal combustion engine.
US10906524B2	Control apparatus for vehicular power transmitting system A control apparatus for a vehicular power transmitting system includes a power transmission switching portion configured to selectively establish a first drive mode by placing one of the first and second coupling elements in an engaged state, a second drive mode by placing the other of the first and second coupling elements in an engaged state, or a third drive mode by placing both of the first and second coupling elements in the engaged states. The power transmission switching portion switches the vehicular power transmitting system between the first and second drive modes through the third drive mode, where a predetermined condition is not satisfied, and switches the vehicular power transmitting system between the first and second drive modes with concurrent engaging and releasing actions of the first and second coupling elements, where the predetermined condition is satisfied.
US10906523B2	Control apparatus and control method for hybrid vehicle A controlling apparatus 1 according to an embodiment is a controlling apparatus of a hybrid vehicle 30 including a motor generator 3 that is mechanically connected to an internal combustion engine 2 and that can generate power in response to rotation of the internal combustion engine 2 and provide torque to the internal combustion engine 2, the controlling apparatus 1 including a rotation information acquiring unit 11 that acquires rotation information of the motor generator 3 with a higher resolution than rotation information of the internal combustion engine 2 and a power generation determining unit 12 that makes a determination regarding the power generation by the motor generator 3 based on the rotation information of the motor generator 3.
US10906522B2	Road vehicle with dual-clutch transmission and hybrid drive and relative control method A road vehicle with hybrid drive having: at least one pair of drive wheels; an internal combustion engine; a reversible electric machine; and a dual-clutch transmission. The dual-clutch transmission has: a first primary shaft and a second primary shaft; a first clutch interposed between the internal combustion engine and the first primary shaft; and a second clutch interposed between the internal combustion engine and the second primary shaft; a third clutch, which is interposed between a shaft of the electric machine and the first primary shaft so as to connect/disconnect the shaft of the electric machine to/from the first primary shaft; and a fourth clutch, which is interposed between the shaft of the electric machine and the second primary shaft so as to connect/disconnect the shaft of the electric machine to/from the second primary shaft.
US10906517B2	Planetary gear arrangement particularly for an electromechanical service brake or an electromechanical parking brake for a motor vehicle A planetary gear assembly, in particular for an electromechanical service or parking brake for a motor vehicle. The planetary gear assembly can include a central sun gear, a plurality of planetary gears rotatably mounted on a planetary carrier, and a ring gear enclosing the planetary gears. The planetary gears can be mounted by the planetary carrier, such that the planetary gears roll off both the sun gear and the ring gear, whereby the sun gear, the planetary carrier or the ring gear is non-rotatably held by a holding unit with a holding torque. A force-sensing device can be arranged between the holding unit and the non-rotatably held element, or between the holding unit and an intermediate component non-rotatably connected to the held component. The force-sensing device can measure the force acting between the held component and the holding unit as a result of the holding torque.
US10906511B2	Systems and methods for predicting demands for exchangeable energy storage devices The present disclosure relates to methods and associated systems for managing a plurality of device-exchange stations. The method includes, for example, (1) receiving empirical information regarding exchanges of energy storage devices from each of the plurality of device-exchange stations in an initial time period; (2) determining a target time period; (3) identifying a plurality of reference factors and associated weighting values based on empirical information regarding exchanges of energy storage devices; (4) determining demand information during the target time period for each of the plurality of device-exchange stations during the target time period for each of the device-exchange stations; and (5) forming a plurality of charging plans for each of the plurality of device-exchange stations according to demand information during the target time period.
US10906510B2	Windscreen wiper device The windscreen wiper device includes a wiper element and a carrier element. The windscreen wiper device also includes a connecting device which has a base and a joint part. The joint part has a top wall that extends in a lateral direction between a pair of side walls. The joint part also includes a button configuration for lockingly attaching the connecting device with at least two different types of oscillating wiper arms. The button configuration includes a first button and a second button. The button configuration also includes a pin that is spaced below the top wall and that extends in the lateral direction between the side walls. The first button is attached with the pin on one longitudinal side of the pin, and the second button is attached with the pin on an opposite longitudinal side of the pin.
US10906508B2	Method for activating at least one security function of a security system of a vehicle The invention relates to a method (100) for an activation of at least one security function of a security system (200) of a vehicle (1), wherein an authentication at the security system (200) of the vehicle (1) is effected by means of a mobile identification transmitter (300).
US10906507B2	Defense of a relay station attack The performance of an action for a transportation vehicle, wherein a relay attack is prevented. In response to a transmission of a first radio signal at a first frequency, on the one hand, a second radio signal at a second frequency is received from an ID transponder authorized for the transportation vehicle and, on the other hand, a further radio signal at the first frequency is received. The action is performed for the transportation vehicle only in response to the second radio signal originating from an ID transponder authorized for the transportation vehicle and only in response to the signal strength of the further radio signal lying below a predefined signal strength threshold.
US10906498B2	Gas generator support for attaching a gas generator of a vehicle occupant restraint system to a vehicle structure It is provided a gas generator support for attaching a gas generator of a vehicle occupant restraint system to a vehicle structure, comprising a receiving region for the gas generator as well as a first and a second fastening region, via which the gas generator support can be attached to the vehicle structure. The gas generator support is twisted about a longitudinal axis such that after attaching the first fastening region to the vehicle structure the second fastening region is pretensioned against the vehicle structure and with at least one abutment portion clampingly rests against the vehicle structure.
US10906497B2	Airbag with deployment controlling flap An apparatus for helping to protect an occupant of a vehicle includes an airbag, an inflator, a first deployment flap, and fasteners. The airbag includes an upper portion and a lower portion. In a stored condition of the airbag, the lower portion is rolled and/or folded and positioned at least partially overlying the inflator, the upper portion is rolled and/or folded separately from the lower portion and positioned at least partially overlying the lower portion, and the first deployment flap extends from the fasteners and has a portion positioned between the upper and lower portions of the airbag. The first deployment flap is at least one of formed from and coated with a material that provides a frictional engagement between the first deployment flap and the lower portion sufficient to at least partially restrict and delay the initial deployment of the lower portion.
US10906496B2	Middle pillar support beam A vehicle includes a roof, a floor spaced from the roof, and sides spaced from each other in a cross-vehicle direction. The sides extend from the roof to the floor. Front seats and rear seats are supported by the floor. A beam is spaced from the roof and the floor and extends between the front and rear seats from one side to the other side in the cross-vehicle direction.
US10906490B2	Cover assembly A cover assembly includes a cover and a bracket. The cover conceals and protects the electronic device with lower peripheral portions of the cover at least partially surrounding the electronic device and contacting the floor of a passenger compartment of a vehicle. The bracket is attached to the cover and is installed to the floor of the vehicle adjacent to the electronic device. The bracket further has a central section that extends upward away from the cover. A center console structure is installed to the floor defining a hollow interior. The electronic device, the cover and the bracket are located within the hollow interior of the center console structure and are covered by the center console structure. A portion of the center consoled is connected to the central section of the bracket within the hollow interior.
US10906488B2	Vehicle dent protection assembly A vehicle dent protection assembly includes a vehicle that has a plurality of body panels. A plurality of extension units is each removably coupled to the vehicle. Each of the extension units is actuatable between a deploying position and a retracting position. The plurality of extension units includes a set of first extension units and a set of second extension unit. A pair of barrier units is each movably coupled to a respective one of the first and second sets of extension units. Each of the barrier units is urged upwardly along the body panels when the respective first and second sets of extension units are actuated into the deployed position to protect the body panels. Each of the barrier units is drawn beneath the vehicle when the respective first and second sets of extension units are actuated into the retracted position such that the body panels are exposed.
US10906484B2	In-vehicle power supply device An in-vehicle power supply device includes a first voltage conversion unit for performing at least a step-down operation to lower a voltage applied to a first conductive path electrically connected to an in-vehicle power storage unit, and apply the lowered voltage to a second conductive path; a second voltage conversion unit for performing at least the step-down operation to lower a voltage applied to a first conductive path and apply the lowered voltage to a second conductive path, a second voltage conversion unit having a smaller power capacity than the first voltage conversion unit; a driving unit that drives the first voltage conversion unit and the second voltage conversion unit, and a capacitor that is electrically connected to the second conductive path and is charged with a current flowing through the second conductive path.
US10906482B2	Real-time performance tuning The present invention is a system and method of making setpoint adjustments to a vehicle control computer in a real time manner in order to enable the one performing the programming to observe the changes in vehicle characteristics in real time. The system and method is an improvement over known methods in that it does not require the programmer to repeatedly stop and start the operation of the vehicle in order to verify that any changes have the desired result.
US10906479B2	Door edge protector device A door edge protector device includes a protector, a cam member and a link mechanism. Cam portions are formed in the cam member, and the cam member is rotated by an input corresponding to a close/open state of a door. The link mechanism includes cam followers which are engaged with the cam portions, and the protector is attached to the link mechanism. By the engagement between the cam portions and the cam followers, the link mechanism moves in an interlocking manner with rotation of the cam member. A locus T includes an accommodated position corresponding to the close state of the door and a set position covering a door edge corresponding to the close state of the door. The cam portions are configured so that the protector moves along the locus by movement of the link mechanism.
US10906477B2	Vehicle passenger compartment vent structure A rear wall structure of a passenger compartment includes a vent opening and a horizontally extending seal protruding in a vehicle forward direction. A trim panel has a rear surface facing the rear wall structure. A vertically extending seal extends from the rear surface. With the trim panel installed to the rear wall structure the vertically extending seal contacts the rear wall structure, and, the horizontally extending seal of the rear wall structure contacts the rear surface of the trim panel such that the rear surface and the vertically extending seal of the trim panel and the upright interior surface and the horizontally extending seal of the rear wall structure define an air outlet passageway that extends from an opening in the trim panel to the vent opening.
US10906476B2	Vehicle trim part having a layered, decorative finish and configured to form a light pattern at the front of the part A vehicle trim part having a layered, decorative finish is provided. The part includes a polymeric substrate, a decorative layer overlying the polymeric substrate and a light-transmissive, protective layer overlying and protecting the decorative layer. The protective layer includes a front surface and a rear surface having a surface portion with a translucent surface finish. The decorative layer has an opening extending from a rear surface of the decorative layer to a front surface of the decorative layer and aligned with the translucent surface finish. Both a cross section of the opening at the front surface of the decorative layer and the translucent surface finish are sized and shaped to form a light pattern which is visible at the front of the part when artificial lighting illuminates the translucent surface finish from the rear of the part.
US10906472B2	Apparatus and method for a multi-hitch receiver assembly A multi-hitch receiver assembly adapted for use on a trailer comprising a main frame that is adapted to be secured to the trailer, a means for securing the main frame to the trailer, and at least one receiver box assembly. The at least one receiver box assembly comprises a first member that is adapted to be secured to the main frame, a second member that is adapted to removably secure a first cargo carrier and is secured to the first member, and a third member that is adapted to removably secure a second cargo carrier and is secured to the second member. The at least one receiver box assembly is adapted to be secured to the main frame at more than one location on the main frame. A method comprising securing the main frame to the trailer.
US10906468B1	Swiveling drop ladder for vehicle tailgate A swiveling drop ladder configured for mounting to a vehicle tailgate includes a ladder and a swiveling plate. The ladder and the swiveling plate are coupled together via a hinge assembly. The swiveling plate, when mounted on a vehicle tailgate, is configured to provide for a rotation of the ladder from a stowed position upon the vehicle tailgate to a deployed position. The ladder extends off the back of the vehicle tailgate when in the deployed position. The hinge assembly is configured to provide for a rotation of the ladder when in the deployed position, such that the ladder extending off the vehicle tailgate angles down to touch the ground.
US10906462B2	Trim arrangement for a vehicle interior A trim arrangement for a vehicle interior includes a trim portion having a through-opening for delimiting the vehicle interior and a light-emitting body inserted into the through-opening. The light-emitting body is configured to transmit light and/or light signals into the vehicle interior, and blocks a movement transversely to an opening normal of the through-opening in a form-fitting manner. The trim arrangement further includes a receiving device connected to a rear side of the trim portion, the rear side facing away from the vehicle interior, and a latching body inserted into the receiving device along an insertion direction extending transversely to the opening normal. The receiving device blocks a movement of the latching body in a direction of the opening normal in a form-fitting manner. The trim arrangement additionally includes a connecting strip provided on the rear side of the trim portion and extending transversely to the opening normal.
US10906460B2	Skin material for vehicle interior There is provided a skin material for vehicle interior, which is woven from a side emission type optical fiber and a synthetic resin fiber, forms a design surface in a vehicle compartment and functions as an illumination. The skin material for vehicle interior is a skin material 10 for vehicle interior including a woven fabric woven by using a synthetic resin fiber and a side emission type optical fiber as warp or weft, wherein the ratio (dS/df) of the fineness (dS) of the synthetic resin fiber to the fineness (df) of the side emission type optical fiber ranges from 1.5 to 7.0. When the synthetic resin fiber is a multifilament 11, the ratio (dS1/df) of the fineness (dS1) thereof to the fineness (df) of the side emission type optical fiber 3 ranges from 2.0 to 7.0. Also, when the synthetic resin fiber is a monofilament, the ratio (dS2/df) of the fineness (dS2) thereof to the fineness (df) of the side emission type optical fiber ranges from 1.5 to 6.0.
US10906445B2	Console-mounted deployable work surface A work surface for a vehicle includes a first leaf, a second leaf, and a dual-stage hinge pivotably coupling the first and second leafs. The dual-stage hinge includes a first pivot axis and a second pivot axis.
US10906444B2	Multi-function connectivity module A vehicle includes a connectivity module. The connectivity module includes at least one deployable work surface extendably coupled thereto, a compartment within the connectivity module, a device holder deployably housed within the compartment, and an armrest slidably coupled to a first side of the connectivity module that conceals at least one of a power outlet and a mobile device connector.
US10906443B2	Actuation device for unlocking a backrest, comprising two actuation elements and an indicator for displaying the backrest lock An actuating device for releasing a locked release and/or adjustment mechanism of a vehicle seat having a first and a second actuating element. Provision is made that the first and second actuating elements and an indicator element are arranged together in a housing of the actuating device. The actuating elements are connected to at least one actuating mechanism that provides for a release of the locked release and/or adjustment mechanism upon actuation of one of the actuating elements. The actuation of one of the actuating elements substantially simultaneously results in an actuation and indication of the indicator element concerning the released or locked state of the release and/or adjustment mechanism.
US10906434B2	Child safety seat A child safety seat includes a seat portion, a backrest assembly including a first and a second backrest portion slidably connected with each other and a headrest slidably connected with the second backrest portion, the first backrest portion being connected with the seat portion, and a backrest adjusting system disposed on the backrest assembly and configured to provide a first stage of height adjustment where the first and second backrest portions are locked with each other and the headrest is movable relative to the first and second backrest portions for adjustment, and a second stage of height adjustment where the second backrest portion is locked with the headrest and unlocked from the first backrest portion so that the headrest and the second backrest portion are movable in unison relative to the first backrest portion for adjustment.
US10906433B2	Vehicle seat A vehicle seat 1 includes a seat cushion 2 for supporting the buttocks of an occupant, a backrest 3 having a seat back 5 and supporting the back of the occupant, and a reclining mechanism 8 having a bracket 82 that rotates about a rotation axis C and enabling the backrest 3 to rotate relative to the seat cushion 2. The bracket 82 is fastened onto a side surface plate 51 of the seat back 5 by a first bolt 61, a second bolt 62, and a third bolt 63 that pass through the bracket 82 and the side surface plate 51. An insertion position for the third bolt 63 is offset from a straight line L passing through an insertion position for the first bolt 61 and an insertion position for the second bolt 62.
US10906432B2	Vehicle seat comprising an adjustable switching console The invention relates to a vehicle seat for a vehicle, comprising a seat part that has a seat part frame, and comprising a backrest part, the seat part and/or the backrest part being designed so as to be adjustable with respect to a degree of inclination, and comprising at least one switching console element which comprises at least one control element for actuating at least one function of at least one actuator element of the vehicle, the switching console element being mounted on the seat part frame to the side of the seat part, a first portion of the switching console element being designed so as to be displaceable at least in the longitudinal direction of the vehicle seat.
US10906430B2	Dual roller for a rail assembly A roller assembly for a vehicle seating assembly is provided. The roller assembly includes an anchor rotatably coupled with a vehicle seating support. An axle extends from the anchor. A first roller is positioned on the axle. A second roller is positioned on the axle and between the first roller and the anchor. A spacer is positioned on the axle and flush with the second roller.
US10906429B2	Seat slide structure A seat slide structure includes a cushion frame, a slide rail including lower and upper rails, a movement mechanism, and a lock mechanism. The movement mechanism slides the cushion frame along a length direction of the slide rail. The lock mechanism includes a lock body engaging with the slide rail, and places or lifts a restriction on movement of the slide rail. The movement mechanism includes a lead screw, a gear part, and a shake absorber. The lead screw is provided in parallel with the slide rail, and is supported by the upper rail. The gear part transmits power from a power source to the lead screw to slide the lead screw and the upper rail along the lower rail. The shake absorber allows the cushion frame and the lead screw to move relative to one another in a moving direction of the upper rail along the lower rail.
US10906424B2	System for announcing predicted remaining amount of energy A system for generating information about predicted remaining amount of energy includes processing circuitry that obtains traveling state information which contains current vehicle position information, searches a predicted passage point through which the vehicle is predicted to pass in a future on a basis of the traveling state information when a vehicle traveling route is not set, predicts a predicted remaining amount of energy, the predicted remaining amount of energy being a predicted amount of traveling energy remaining at the time when the vehicle passes the predicted passage point and controls to provide information about the predicted remaining amount of energy and the predicted passage point corresponding to the predicted remaining amount of energy for a user.
US10906421B2	Wireless automatic charging system for electric vehicles A wireless automatic charging system for electric vehicles is disclosed, wherein the electric vehicle comprises a charging board, a Bluetooth device, a battery, as well as a battery management module electrically connected to the aforementioned charging board, Bluetooth device and battery and capable of detecting and recording the charging efficiency data concerning the charging board, and wherein the wireless automatic charging system for electric vehicles comprises a base seat, an air inflation and deflation device, a discharging board and a control console, wherein the battery management module in the electric vehicle can transfer the charging-related information of the electric vehicle to the control console via the Bluetooth module such, and adjust the distance between the charging board and the discharging board and/or charging power of the discharging board in accordance with the received charging efficiency data and the charging efficiency adjustment data.
US10906416B2	Contact apparatus and charging contact unit and method for electrically connecting a vehicle to a charging station The invention relates to a contact apparatus (11) and to a charging contact unit (12) for a rapid-charging system for electrically driven vehicles, in particular electric buses or the like, and to a method for forming an electrically conductive connection between a vehicle and a stationary charging station, wherein the contact apparatus serves to form an electrically conductive connection between the vehicle and the stationary charging station comprising a charging contact unit, wherein the contact apparatus can be arranged on a vehicle, wherein the contact apparatus comprises a contact device (14), wherein the contact device can make contact with the charging contact unit, wherein the contact apparatus or the charging contact unit comprises a positioning device (15), wherein the contact device can be positioned relative to the charging contact unit by means of the positioning device, wherein the positioning device has a pantograph or a swing arm (19), by means of which the contact device can be positioned in the vertical direction relative to the charging contact unit, wherein the contact device has a contact element support comprising contact elements (17), wherein the contact elements can make contact with the charging contact elements of the charging contact unit so as to form contact pairs, wherein the positioning device has a transverse guide (25), by means of which the contact element support can be positioned transversely relative to the charging contact unit, wherein the transverse guide is arranged at a distal end of the pantograph or of the swing arm (19).
US10906414B2	Systems and methods for restarting electrified vehicle charging without unplugging This disclosure describes exemplary electrified vehicle charging systems and methods for charging energy storage devices (e.g., battery packs) of the vehicles. An exemplary charging system may be configured to monitor the electrified vehicle for determining whether either a recoverable vehicle fault or a non-recoverable vehicle fault occurs during a charging event and to automatically command a charging sequence restart without unplugging a charging component from a vehicle inlet assembly in response to detecting the recoverable vehicle fault. The control system may also be configured to provide remote notification about the need to unplug and replug the charging component when the non-recoverable fault is detected or when greater than a predefined number of charging sequence restarts have been attempted.
US10906409B2	Battery terminals for a lithium ion battery module A lithium ion (Li-ion) battery module includes a module terminal configured to electrically couple the Li-ion battery module to an electrical connector of an external load. The module terminal includes a conductive component and a sealing shim secured to the conductive component, the sealing shim being formed from a polymeric material. The Li-ion battery module includes a housing containing a plurality of Li-ion battery cells and having an opening through which the conductive component of the module terminal at least partially protrudes. The sealing shim of the module terminal is directly secured to the housing and forms a seal isolating an interior of the housing from the external environment.
US10906405B2	Power converter for railroad vehicle In this power converter for a railroad vehicle, a cooling portion includes a first cooling portion arranged to block up an opening while ensuring watertightness and to come into contact with a semiconductor element through the opening, and a second cooling portion provided to be opposed to an outer surface of a power converter body not provided with the opening and adjacent to a side provided with the first cooling portion.
US10906401B2	Touch-pad integrated steering wheel for a motor vehicle A motor vehicle includes a steering wheel and a touchpad integrated into the steering wheel, situated in a channel, and adapted to input commands.
US10906400B1	Vehicular radio and recording system The vehicular radio and recording system comprises a vehicle and a recording appliance. The recording appliance mounts in the vehicle. The vehicle further comprises a vehicle audio entertainment device, a VECU, and a steering wheel. The vehicle audio entertainment device further comprises an audio output. The recording appliance electrically connects to the vehicle audio entertainment device and the VECU. A portion of the recording appliance mounts on the steering wheel. The recording appliance: a) captures audible sounds generated within the vehicle and converts the captured audible sounds into electrical signals; and, b) captures electrical signals generated by the vehicle audio entertainment device. The recording appliance converts the captured electrical signals into one or more audio files for storage.
US10906396B1	Transfer case neutral override and remote pump mounting A vehicle includes a transmission, a transfer case configured to directly couple to the transmission, and an override system coupled to the transfer case. The transfer case includes a shift rod, a piston assembly including a first piston coupled to the shift rod and a second piston selectively engageable with the first piston, and a resilient member positioned to bias the shift rod and the first piston into a high position corresponding with a high mode of operation of the transfer case. The override system includes a housing coupled to the transfer case, a lever coupled to the housing and pivotally actuatable between a first position and a second position, and an engagement element disposed within the housing and coupled to the lever. The engagement element is configured to engage the second piston in response to the lever being pivoted from the first position to the second position.
US10906389B2	Device for sealing a motor vehicle front face air intake and method for manufacturing same The present invention relates to a device (1) for sealing a motor vehicle front face air intake, comprising: a supporting frame (5) in which is installed at least one set of flaps (3) pivoting about pivot pins (A), at least one control element (13) configured to control the positioning of the flaps (3), the supporting frame (5) including at least one row of bearings (51) receiving the pivot pins (A) arranged on a side pillar (5b), the sealing device (1) including at least one locking element (60) covering a row of bearings (51), said locking element (60) comprising a body and at least one connection member (61) including a base connecting it to said body of the locking element (60) and a head wider than said base, said side pillar (5b) including at least one slot (52) opening onto an outer side of said side pillar (5b) and preferably having a shape complementing said at least one connection member (61), said at least one connection member (61) being inserted into the at least one slot (52).
US10906388B2	Radiator system An improved radiator mounting and cooling system for use in automobiles allows multiple components to be incorporated into the same unit, limiting the need for accessories to be mounted to inner fenders or firewall. A circulating vortex of air is pulled through a front grill and vortex tubes disposed through sides of the radiator system to improve cooling efficiency. An outer shroud protects interior components and creates a sealed core cavity allowing air to only enter through vortex tubes and front grill and exit through a rear grill. A self-circulating cooling system provides additional cooling of coolant. A fan system pulls around 5000 CFM of air through the core cavity. An optional secondary coolant pumping system allows coolant to be pumped when needed. A control system controls activation of the fan system and secondary coolant pumping system based on signals from sensors.
US10906387B2	Cooling apparatus of vehicle driving system A cooling apparatus of a vehicle driving system of the invention connects an engine water circulation passage to a hybrid system water circulation passage and flows cooling water in the engine water circulation passage and the hybrid system water circulation passage to cool a first hybrid system component by the cooling water cooled by an engine radiator and cool a second hybrid system component by the cooling water cooled by a hybrid system radiator when an engine cooling process is not requested, a first hybrid system cooling process is requested, a second hybrid system cooling process is requested, and a connection condition is satisfied. The connection condition is satisfied when the engine cooling process is not requested, and the cooling water flowing into the hybrid system water circulation passage from the engine water circulation passage, can cool the first hybrid system component.
US10906384B2	Vibration prevention device A vibration prevention device includes a vehicle body-side bracket having an inner space and a vibration prevention member disposed in the inner space. A press-fitting surface and a press-fitting groove are formed on an inner surface of the vehicle body-side bracket. The press-fitting surface and the press-fitting groove extend from an edge portion of the inner space opening through an outer surface of the bracket. The vibration prevention member has a first attachment member, a second attachment member, and an insulator disposed between the first attachment member and the second attachment member. The second attachment member has an abutting portion pressed against the press-fitting surface and an attachment portion press-fitted into the press-fitting groove.
US10906383B2	Alignment and locking mechanism for removeable battery assembly An alignment and locking system for a battery assembly is disclosed. The system may be located onboard of an electric vehicle powered by a battery pack disposed in the battery assembly. The system includes a set of receiving members fixed to the chassis. The battery assembly includes a cage with mounting bars. When the mounting bars are received in the receiving members they may be locked into place against the chassis. The system can also include a set of v-blocks that engage vertically oriented bars in the cage to help with horizontal alignment of the battery assembly.
US10906382B2	Roof construction for a vehicle and a semi-transparent photo voltaic panel therein A roof construction for a vehicle having an opening in its fixed roof, comprises at least one panel for at least closing said opening. The panel comprises a first and a second layer of glass and in between said first and second layer of glass a sheet of photo voltaic cells as a third layer. The sheet of photo voltaic cells has an active layer of a thin film of solar cell material and further has a first area which is semi-transparent and a second area which is substantially opaque.
US10906380B2	Evaporator with cold storage function An evaporator with a cold storage function includes: a plurality of refrigerant tubes which have refrigerant flow paths and which are disposed in parallel with an interval therebetween; and a cold storage material container sandwiched and bonded between adjacent refrigerant tubes among a plurality of the refrigerant tubes and to be filled with a cold storage material, wherein the cold storage material container is formed by superimposing a pair of cold storage plates, each of which includes accommodating concavities to be filled with the cold storage material, and a plurality of convexities are formed with an interval therebetween in standing walls of the accommodating concavities of each of the cold storage plates.
US10906376B2	Thermal management system for vehicle A thermal management system for a vehicle includes an engine cooling circuit that causes a heat medium to circulate through an engine, and an engine radiator that exchanges heat between the heat medium in the engine cooling circuit and outside air. The thermal management system for a vehicle further includes a switching device that switches between an independent mode in which the heat medium circulates respectively independently through a cooler cooling circuit and the engine cooling circuit, and a communication mode in which the cooler cooling circuit and the engine cooling circuit communicate with each other to cause the heat medium to flow between a chiller and the engine radiator; and a controller that controls an operation of the switching device to switch to the communication mode when a temperature of the heat medium in the engine cooling circuit is lower than a first heat-medium temperature.
US10906373B2	Vehicle heat management system A vehicle heat management system is provided. The system includes a radiator module having a battery radiator and an electric component radiator. A valve module has an inner space that is divided into a first chamber and a second chamber. Each chamber includes a first passage, a second passage, and a third passage. The first passage connects each chamber to a battery radiator, the second passage connects each chamber to a high-voltage battery core, and the third chamber connects each chamber to an electric component radiator and an electric component core. Each chamber includes therein a guide unit that selectively closes the first passage, the second passage, or the third passage depending on a rotation angle thereof. An actuator that is connected to the guide unit adjusts the rotation angle of the guide unit.
US10906372B2	Suspension structure for in-wheel motor drive device A suspension structure for an in-wheel motor drive device of the present invention includes an in-wheel motor drive device (10), a shock absorber (76), a torsion bar (81), and a stabilizer link (86), wherein: the shock absorber includes an upper spring seat (79a) provided in an upper end region of the shock absorber and a lower spring seat (79b) provided in a lower end region of the shock absorber and forming a pair with the upper spring seat; an upper end (87a) of the stabilizer link is arranged between a vehicle back edge (79d) of the lower spring seat and a vehicle front edge (79c) of the lower spring seat; and a lower end (87b) of the stabilizer link is arranged so as to overlap with a hub wheel (12) as viewed in an axial direction of the hub wheel.
US10906365B2	Tyre changing machine A tyre changing machine (1), configured to remove a tyre from a respective rim of a vehicle wheel (2), comprises an operating arm (4) which includes: a supporting structure (401); a head (5) movable along a longitudinal axis (402) relative to the supporting structure (401); a removal tool (403) pivoted to the head (5) to rotate relative thereto about an axis of oscillation (405′) transverse to the longitudinal axis (402); a driving member (6) movable along an operating axis (402′) parallel to the longitudinal axis (402) relative to the supporting structure (401) and to the head (5), and articulated to the removal tool (403) at an operating point (P) which is spaced from the axis of oscillation (405′); an actuator (407) comprising a stationary member (407a), connected to the supporting structure (401), and a movable member (407b), adapted to drive the removal tool (403) in rotation and in translation; a coupling member (7) coupled to the supporting structure (401), to the head (5) and to the driving member (6). The movable member (407b) of the actuator (407) is connected to the driving member (6) to directly drive it along the operating axis (402′).
US10906364B2	Machine and method for treating a tired wheel The present invention concerns a machine for treating a tired wheel, for example a machine for assembly and/or disassembly of a tired wheel, as well as a method for treating a tired wheel, for example an assembly and/or disassembly method.
US10906363B2	Warrant recording system and setting apparatus for pressure detector A warrant recording system includes a setting apparatus and a tire pressure detector. The setting apparatus is connected with the internet for acquiring a standard time. The setting apparatus writes the acquired standard time into the tire pressure detector, such that an initial timestamp is recorded in the tire pressure detector. Therefore, the setting apparatus automatically inputs a warrant period into the tire pressure detector, thus assuring the accurate record of the initial time point of the warrant period.
US10906362B2	Method for identifying at least one transmitter for monitoring the pressure of a tire of a motor vehicle by association with one of the wheels of said motor vehicle A method for identifying at least one emitter for monitoring the tire pressure of a motor vehicle by association with one of the wheels of the motor vehicle. The method includes: for each emitter monitoring tire pressure, reconstructing an intermediate-frequency signal from the radiofrequency signal and a reference signal, determining the FFT of the intermediate-frequency signal, determining whether there is a frequency deviation of the intermediate-frequency signal, determining the side of the vehicle on which the emitter monitoring the pressure of a tire is placed, acquiring a signal from the anti-lock braking system for at least one of the wheels on the side on which it was determined that the emitter for monitoring the pressure of a tire is placed, and determining the position of the emitter for monitoring the pressure of a tire depending on the deviation and on the at least one signal from the anti-lock braking system.
US10906359B2	Pneumatic tire, a tread band, and a tread block comprising a sipe, and a lamella plate for the manufacture thereof A pneumatic tire is provided with sipes, at least some of which have an open top end to the surface of the tread block. An intersection of the sipe with a surface that is geometrically congruent and parallel with the surface of the tread block and arranged a depth apart from the surface of the tread block into the tread block forms a curved line. A first sipe is shaped in such a way, that at all depths (d) within a range from the open top of the first sipe to a first transition depth, the curved line includes at least one deflection point having an inner corner that has a radius of curvature under 0.3 mm. A lamella plate for manufacturing the pneumatic tire, the tread band, or the tread block. Use of the lamella plate for manufacturing a tread block, a tread band, or a pneumatic tire.
US10906358B2	Pneumatic tire A pneumatic tire comprising on a tread surface 1 a plurality of blocks 7, wherein: the blocks have an inclined groove 43 formed thereon; the inclined groove has a connecting portion 43a connected to the circumferential main grooves, a wide-width portion 43b connected to the connecting portion, and a narrow-width portion 43c connected to the wide-width portion; the wide-width portion and the narrow-width portion have inclination angles with respect to the tire circumferential direction smaller than the connecting portion; the blocks have a sipe 52a formed thereon, the sipe having one end opening to the connecting portion and the other end opening to the circumferential main grooves; and the sipe has a bent portion.
US10906355B2	Pneumatic tire A pneumatic tire comprises a tread portion with a tread surface; four main grooves in the tread surface of the tread portion, extending in a tire circumferential direction; and a center land portion, middle land portions adjacent to the center land portion on either side in a tire lateral direction, and shoulder land portions outwardly adjacent to the middle land portions in the tire lateral direction formed by the main grooves. The main grooves have a wave-like shape with a constant groove width in the tire circumferential direction and with periodic oscillation.
US10906344B2	Printing paper A printing paper having a base paper and an outermost coating layer is provided, and satisfies at least one of the following characteristics (I), (II) and (III): (I) when an aqueous solution having a surface tension of 20 mN/m is dropped on the side having the outermost coating layer of the printing paper, a contact angle between the droplet and the outermost coating layer is 40° or more and 65° or less; (II) for the side having the outermost coating layer of the printing paper, a transfer amount of an aqueous solution having a surface tension of 20 mN/m at a contact time of 1 second as determined by the Bristow method is 5.0 ml/m2 or more and 12.0 ml/m2 or less; and (III) on the surface of the outermost coating layer of the printing paper, a maximum peak value of specular reflection light quantity of a point image is 2,000 or more and 30,000 or less.
US10906342B2	Printable media A printable media comprising a supporting substrate, including fibers, having an image side and a non-image side, which contains an image receiving layer coated on the image side of the supporting substrate. The image receiving layer comprises pigment fillers, polymeric binders and ink optical density enhancement agents. Also disclosed is a method for producing the textured media.
US10906341B2	Thermosensitive recording material The present invention relates to a thermosensitive recording material and, specifically, to a thermosensitive recording material comprising: a colorless or light-colored leuco dye; a compound of chemical formula (1) containing a non-phenolic sulfonyl urea group as a developer; at least one of general formulas II-1, II-2, and II-3 as a sensitizer; a binder; and other fillers. The thermosensitive recording material of the present invention improves the background blurring of a color-developed image by using a non-phenolic developer and exhibits excellent effects in view of color development sensitivity, water resistance, oil resistance, plasticizer resistance, and the like.
US10906339B2	Liquid discharge apparatus There is provided a liquid discharge apparatus which includes a tank including a liquid storage chamber, an inlet, a liquid lead-out channel, and an atmosphere communication channel, a conveyance mechanism, a carriage, and a head. A lower end of the inlet is positioned at a lower side of the nozzles, and the liquid storage chamber is arranged at a position shifted from the nozzles, in a first-direction side of the front-rear direction, and shifted from the conveyance route, to a second-direction side of the left-right direction. The liquid storage chamber is connected to the liquid outflow channel at a position on a lower side of a center in a up-down direction of the liquid storage chamber, and in the first direction from a center in the front-rear direction of the liquid storage chamber, and on the second-direction side of a center in the left-right direction of the liquid storage chamber.
US10906331B2	Recording method and ink jet recording apparatus An ink jet recording method includes attaching ink by ejecting an ink composition from a head to attach to a recording region of a recording medium, and drying by heating the recording medium to which the ink composition is attached, in which the ink composition is a water-based ink composition including a resin and an amide compound represented by General Formula (1) as an organic solvent, and the drying dries the organic solvent in the recording region of the recording medium to be 2.0 mg/inch2 or less. In Formula (1), R1 represents a linear or branched alkyl group having 1 to 6 carbon atoms; R2 and R3s represent each independently H or a linear or branched alkyl group having 1 to 4 carbon atoms.
US10906329B2	Method for printing transparent ink on different printing media A method for printing transparent ink on different printing media is provided. In a one-time printing process, printing with the transparent ink is performed for a plurality of times on a printed product, and a curing process by means of UV light irradiation is then performed once. The method is characterized in that, after performing the printing with the transparent ink for the first time, the curing process by means of UV light irradiation is performed once.
US10906324B2	Continuous inkjet printers The invention provides a method of adding solvent or make-up fluid into the gutter line of a continuous ink printer. During the addition of solvent, the vacuum level in the gutter line is monitored and maintained at a level sufficient to ensure that vacuum is maintained at the gutter. Vacuum level in the gutter line is preferably controlled by controlling the speed of a variable speed gutter pump. Noise in the gutter line is preferably used as a control over pump speed.
US10906323B2	Ink cartridge with a housing sealed by a sealing member that changeably forms an air communication passage An ink cartridge includes a housing that has an air communication port and stores a liquid inside and a sealing member attached to the housing in such a way as to cover the air communication port. The sealing member includes an adherent region attached to the housing and a non-adherent region not attached to the housing. The non-adherent region extends to an end portion of the sealing member and forms a communication passage which establishes communication between the air communication port and air.
US10906321B2	Print module having sequentially disconnected ink couplings A print module includes: a cradle having a nest for receiving a printhead; an elongate printhead assembly received in the nest, the printhead assembly including a printhead having first and second ink ports at opposite longitudinal ends thereof; and a supply assembly slidably movable relative to the nest along an axis perpendicular to a longitudinal axis of the printhead. The supply assembly includes first and second ink couplings fast with the supply assembly and connected to respective first and second ink ports. The print module is configured such that movement of the supply assembly disconnects the second ink coupling prior to disconnection of the first ink coupling.
US10906318B2	Liquid jetting apparatus A liquid jetting apparatus includes: a head unit including nozzles; a cap which covers the nozzles in a state of being in contact with the head unit at a capping position; and a cap movement device including a cam having a slide surface and a cam follower which is slid on the slide surface. One of the cam and the cam follower is provided integrally with the cap, and the other of the cam and the cam follower is moved in a slide direction. The slide surface includes a first inclined surface inclined by a first angle relative to the slide direction and a second inclined surface inclined by a second angle greater than the first angle relative to the slide direction.
US10906314B2	Liquid ejecting apparatus, and method of controlling liquid ejecting apparatus A liquid ejecting apparatus includes: a liquid ejecting head including a plurality of nozzles for discharging liquid and a supply passage through which the liquid to be supplied to the plurality of nozzles flows. The nozzles are arranged in a line; one of the nozzles at a first end of the line being a first end nozzle, whereas one of the nozzles at a second end of the line being a second end nozzle. A height of the first end nozzle is set to be greater than a height of the second end nozzle. The liquid flows through the supply passage in a direction from the first end nozzle to the second end nozzle.
US10906309B2	Liquid discharge head A liquid discharge head includes a stacked body formed by plates stacked in a first direction, and having a liquid channel. The liquid channel includes: individual channels which include nozzles and pressure chambers communicating with the nozzles, respectively, and which are aligned in a second direction orthogonal to the first direction; a first common channel extending in the second direction and communicating with the individual channels; a second common channel extending in the second direction and communicating with the individual channels; first throttles each connecting one of the individual channels and the first common channel; and second throttles each connecting one of the individual channels and the second common channel. The plates include: a nozzle plate having the nozzles; a pressure chamber plate having the pressure chambers; a first common channel plate having the first common channel; and a second common channel plate having the second common channel.
US10906308B2	Liquid jetting apparatus and method of producing liquid jetting apparatus There is provided a liquid jetting apparatus, including: a first pressure chamber and a second pressure chamber arranged in a first direction; a first insulating film covering the first and second pressure chambers; a first piezoelectric element arranged to face the first pressure chamber with the first insulating film being intervened therebetween; a second piezoelectric element arranged to face the second pressure chamber with the first insulating film being intervened therebetween; a trace arranged between the first and the second piezoelectric elements adjacent to each other in the first direction; and a second insulating film covering the trace. An end, in the first direction, of a part of the second insulating film covering the trace between the first piezoelectric element and the second piezoelectric element is positioned inside an end of a partition wall partitioning the first pressure chamber and the second pressure chamber.
US10906307B2	Liquid discharge head and recording apparatus using the same A liquid discharge head according to the present disclosure includes a plurality of discharge holes, a plurality of pressure applying chambers, a flow path member including a plurality of common flow paths, and a plurality of pressure applying modules. Adjacent discharge hole groups have a part in which, when a discharge hole A is positioned in an n column in one of the discharge hole groups, a discharge hole B in the discharge hole group located adjacent with the common flow path interposed therebetween is positioned in an n±1 column. A discharge hole C in the discharge hole group located at a center in a second direction is positioned in an n column, while a non-carry discharge hole is positioned in an n±1 column.
US10906299B2	Print head and activation system There is provided a print head discharging a liquid from a nozzle, including: a memory circuit that stores individual information of the print head and individual activation information based on the individual information; a communication control circuit that controls communication between the print head and an outside; a discharge control circuit that controls discharge of the liquid; and a limiting circuit that limits liquid discharge control by the discharge control circuit, in which when a signal according to the individual activation information is input from the outside, the limiting circuit changes a limitation of liquid discharge control by the discharge control circuit.
US10906296B2	Density fluctuation compensation during print head replacement A method compensates for position-dependent density fluctuations of print nozzles in an inkjet printing machine by use of a computer. The computer produces compensation profiles for the position-dependent density fluctuations over all the print heads for all print substrates used, calculates an mean profile from these, and applies the mean profile to compensate for the position-dependent density fluctuations in the inkjet printing machine. When one or more print heads of the inkjet printing machine are replaced, the computer calculates a new compensation profile for only one print substrate. The computer derives a new mean profile from this, and the computer calculates and applies the new mean profile using the old compensation profiles for the remaining print substrates.
US10906295B2	Printing apparatus and printing system A printing apparatus including: a cleaning section including a cleaning member and configured to perform cleaning processing of a screen mask used in printing of a viscous fluid onto a print target; a cleaning member moving section configured to perform at least one of moving the cleaning member to and from a cleaning position and an exchange position, and unloading and loading of the cleaning member; and an exchange control section configured to control the cleaning member moving section to perform cleaning member exchange processing of exchanging the cleaning member.
US10906294B2	Method for producing printed matter The present invention aims to provide a method of producing a printed matter that shows suppressed scumming in planography. A method of producing a printed matter, the method including the steps of: allowing a dampening water to adhere to a hydrophilic layer of a planographic printing plate having at least the hydrophilic layer and a heat sensitive layer; allowing an ink to adhere to the heat sensitive layer; and transferring the ink adhering to the heat sensitive layer to an object to be printed; wherein the pH (A) of the ink and the pH (B) of the dampening water are both from 1 to 6.5.
US10906291B2	Controllable release build plate for 3D printer A fused filament fabrication three dimensional printing system includes a build platform, an extruder for one or more deposition materials, the extruder including at least one nozzle movable relative to the build platform, and a controller configured to control the relative movement between the build platform and the nozzle, and to cause material to be extruded out of the nozzle to form a 3D object on the build platform. The build platform includes a first plate on which the 3D object is formed, a second plate that is positioned vertically below the first plate and defines at least one gap between the first and second plates, and a heating element that is configured to heat the second plate. The first plate defines at least one opening that is configured to allow passage of material extruded from the nozzle into the at least one gap between the first and second plates.
US10906289B2	Method and device for producing components having defined dimensions A method for producing a component having defined dimensions from a blank having the same defined dimensions or having dimensions which differ from the defined dimensions of the component, by carrying out a heat treatment. Furthermore, a device for carrying out this method is disclosed.
US10906281B2	Polymeric film comprising vibration dampening and barrier properties The presently disclosed subject matter is directed generally to multilayer films suitable for use in forming pouches, such as (but not limited to) bioprocessing pouches. When used in the formation of solution pouches, the disclosed films help prevent or reduce the number of seal failures, such as during transportation or use. The disclosed films comprise first and second vibration dampening layers and first and second barrier layers.
US10906279B2	Interlayer film for laminated glass, method for manufacturing interlayer film for laminated glass, and laminated glass There is provided an interlayer film for laminated glass with which the processability at the time of preparation of laminated glass can be enhanced, furthermore, a large broken piece of glass is hardly generated even when laminated glass is broken, and laminated glass can have a high level of safety. The interlayer film for laminated glass according to the present invention includes a plastic layer with a Young's modulus of higher than or equal to 1 GPa and a first resin layer layered on a first surface of the plastic layer, is provided or not provided with a second resin layer layered on a second surface opposite to the first surface of the plastic layer, has the Young's modulus of the plastic layer higher than the Young's modulus of each of the first and second resin layers, and has an adhesive force between the plastic layer and each of the first and second resin layers measured in accordance with JIS K6854-2 of greater than or equal to 1 N/50 mm and less than or equal to 20 N/50 mm.
US10906277B2	Low-friction member, image-forming device, and agent for forming low-friction coating film A problem addressed by the present invention is to provide a low-friction member which does not easily lose low-friction properties thereof even when used for a relatively long period. The low-friction member LS according to the present invention is consisting of at least lubricating materials PL, PS and a polyimide resin MR. The low-friction member has a surface roughness Rsk or 0.500 or more and the surface exposure ratio of the lubricating materials of 15.0% or more. It is particularly preferred that the surface roughness Rsk be in a range of 0.0900 (inclusive) to 0.1400 (inclusive), and the surface exposure ratio of the lubricating materials be 35.0% or more. It is preferred that the lubricating materials be a fluororesin. The low-friction member thus has the property of not losing the low-friction properties thereof easily even when used for a relatively long period.
US10906276B2	Multilayer polyolefin film The invention relates to a multilayer polyolefin film with improved barrier effect against oxygen and water vapor and having at least one core layer and two cover layers, in which at least one layer contains a hydrocarbon resin and a nucleating agent.
US10906274B2	Laminate substrate with sintered components The present disclosure relates to a laminate substrate with sintered components. The disclosed laminate substrate includes a substrate body having an opening through the substrate body, a first foil layer, a sintered base component, and a sintered contact film. The first foil layer is formed underneath the substrate body, such that a first portion of the first foil layer fully covers the bottom of the opening. The sintered base component is formed within the opening and over the first portion of the first foil layer. Herein, the sintered base component has a dielectric constant between 10 and 500, or has a relative permeability greater than 5. The sintered contact film is formed over the sintered base component. The sintered base component is confined within the opening by the substrate body on sides, by the first foil layer on the bottom, and by the sintered contact film on the top.
US10906268B2	Fiber sheets and structures comprising fiber sheets Fiber sheets, structures comprising the fiber sheets and the use of the sheets. The invention further relates to biodegradable and/or recyclable products comprising the fiber sheets, useful in replacing non-biodegradable products.
US10906267B2	Composite structure A method of manufacturing a composite component comprises forming a core, surrounding the circumference of the core with a first layer of fabric, applying a second layer of fabric having a different coefficient of thermal expansion from the first layer such that the second layer extends around at least a portion of the circumference of the core and curing the component such that the second layer imparts a compressive or tensile force on the core.
US10906265B2	Method for producing a printed decorative paper The present invention relates to method for producing a printed decorative paper comprising the steps of: i) providing a substrate paper; ii) applying to said substrate paper a decorative layer; iii) applying to said decorative layer a liquid coating consisting essentially of a polymerizable mixture; iv) applying polymerization conditions to form a polymerized layer on said decorative layer. An object of the present invention is to provide a method for manufacturing a printed decorative paper, which decorative paper is processed to form a decorative panel, which decorative panel thus obtained will exhibit a good resistance against weather influences.
US10906256B2	Methods for fabricating low cost 3-D printed parts with expanded material properties A 3-D (three dimensional) printing system is provided that includes a customized matrix having suitable material properties and geometric patterning to facilitate filling and retention of one or more filler material. The customized matrix defines the geometry and shape of the object. A filler mechanism that fills the customized matrix with one or more filler materials. The one or more filler materials retained within the customized matrix are cured or solidified to produce the object.
US10906252B2	Method for the production of an FMV hybrid component, and FMV hybrid component A method for the production of an FMV hybrid component includes braiding a dry hybrid fibre thread onto a core element, where a hybrid fibre braid is formed, and obtaining a fibre core composite. The method further includes reshaping the fibre core composite and impregnating and consolidating the hybrid fibre braid on the core element.
US10906250B2	Attachment part for connecting to a structural part An add-on part (10) for connecting to a component (30). The add-on part (10) has a longitudinal axis (A) and a welding section (11) to be welded to the component (30) by torsional ultrasonic welding. The welding section (11) has a contact surface (12) for contact with a torsion sonotrode (70) and a welding surface (13) for connecting to the component (30). The welding section (11) is delimited, at least in some sections, by an inner vibration-decoupling zone (14). The inner vibration-decoupling zone (14) extends, at least in some sections, at an inclination to or parallel to the longitudinal axis (A). The method comprises a) bringing the welding surface (13) in contact with a welding region (31), b) applying a force to the contact surface (12) such that the welding surface (13) is pressed against the welding region (31), and c) introducing a torsional ultrasonic vibration into the welding section.
US10906249B2	Method for reducing layer shifting and smearing during 3D printing An additive manufacturing system, and corresponding method, prints a sacrificial component using a 3D printing system that includes a spreading mechanism for spreading unbound powder to form layers of a powder bed and a printing mechanism for jetting binder fluid into the unbound powder to form the sacrificial component. The system forms the sacrificial component with a feature that provides a resistive force to a shear force imposed by the spreading mechanism during the spreading. The system prints a part with the 3D printing system in a coupled arrangement with the sacrificial component. The coupled arrangement in combination with the resistive force is sufficient to immobilize each printed layer of the part to resist the shear force imposed by the spreading mechanism during spreading of the unbound powder above each printed layer of the part. After printing, and before or after post-processing, the part and sacrificial component are separated.
US10906246B2	Optical shaping apparatus, manufacturing method, and storage medium An optical shaping apparatus includes a light modulation element having a plurality of pixels and configured to modulate light from a light source for each pixel, a controller configured to control the light modulation element based on each of a plurality of two-dimensional shape data obtained from three-dimensional shape data, and a moving member configured to move a cured portion cured by the modulation light among the photocurable resin in a direction separating from the light-transmissive portion. The controller controls the light modulation element so as to irradiate the modulation light of an irradiation light amount corresponding to a light amount necessary for curing for each resin area, onto each of a plurality of resin areas in the photocurable resin based on a temperature distribution or a temperature change in the photocurable resin.
US10906245B2	Shaped object, shaping system, and production method for shaped object A shaped object includes a first shaped portion expressing a three-dimensional shape of an object in a first state by at least one bump on the surface of a first thermally expansive section that expands due to being heated, and second shaped portion expressing a three-dimensional shape of the object in a second state by at least one bump on the surface of a second thermally expansive section that expands due to being heated. The second state is a state in which the object is more deteriorated than in the first state. The height of the at least one bump on the surface of the second thermally expansive section at least partially differs from a height of the at least one bump on the surface of the first thermally expansive section.
US10906244B2	Ultrasonic removal methods of three-dimensionally printed parts An imaging device includes an ejector head configured to eject a material, a platen having a first surface configured to receive material ejected by the ejector head and support an object formed with the ejected material, a vibrator configured to vibrate, and a controller operatively connected to the vibrator. The controller is configured to operate the vibrator to vibrate and loosen material adhering to the first surface of the platen to enable the object to be removed from the platen.
US10906243B2	Additive lathe that prints in cylindrical coordinates An additive lathe integrates the advantages of additive manufacturing (also called 3d printing) with the cylindrical motion of a lathe to reduce material waste, print times, and increase creative potential. A post-processing system allows for an improved surface finishing on parts. The additive lathe no longer prints in cartesian (X, Y, Z) coordinates as other 3D printers and instead prints using cylindrical (R, Theta, Z) coordinates. The traditional bed or build plate is replaced with a horizontal cylindrical starter bar, on which 3D printed material is deposited along and around the bar. Essentially, the additive lathe works like a conventional lathe, but in reverse. Instead of taking a cylinder and slowly removing material as the part spins, the additive lathe adds material along and around the bar iteratively building up the part. The finishing mechanism allows for the creation of a smooth outer finish on printed parts while still in the printer.
US10906240B2	Print head for additive manufacturing system A print head is disclosed for use with an additive manufacturing system. The print head may include a nozzle having a base end, a tip end, and a cylindrical passage extending from the base end to the tip end. The print head may also include a compactor located at least partially inside of the nozzle at the tip end.
US10906234B2	Method of producing three-dimensionally shaped object and three-dimensional shaping apparatus A three-dimensional shaping apparatus includes an ejection portion, a base stage, a movement portion, and a controller. The ejection portion configured to eject a fused thermoplastic resin. The movement portion configured to change relative positions of the ejection portion and the base stage. The controller configured to control the movement portion and the ejection portion such that a wall is formed by ejecting a fused thermoplastic resin from the ejection portion while relatively moving the ejection portion with respect to the base stage to provide a space surrounded by the wall in a horizontal direction and open in an upward direction, and such that a filling portion is formed by injecting a fused thermoplastic resin into the space from above.
US10906233B2	Print-head for a 3D printer Embodiments disclosed herein produce products by adding material on an existing object. Printing onto existing objects may be used to repair/rebuild/fix the existing objects. Other embodiments print on a lateral edge of an object. A print-head unit may be implemented that can horizontally rotate to produce the product by adding layers of materials on the existing object.
US10906232B2	Blown film installation, method for producing a blown film strip and film produced therewith In blown film installations, it is known to provide longitudinal stretching of the produced double layer film strip downstream of the draw-off, more precisely downstream of the reversing unit and upstream of the winder. It is also known to stretch the down-drawn film, wherein the film must then be preheated owing to the long cooling path from the draw-off. According to a first feature, the present invention specifies warming the film above the draw-off and then treating it mechanically. The film can thereby be brought with only little energy from a first level of warmth to a temperature level at which it can easily be worked. According to a second feature, the invention specifies providing a tractive force breakdown brake.
US10906229B2	Injection device for a forming and filling station adapted for CIP An injection device for injecting a pressurized liquid into a preform and forming a container. The injection device including a piston device having a piston body and a piston head arranged to reciprocate in the piston body and to fluidly isolate an inner chamber of the piston device. The piston body having a recess portion defining a location where the piston head is not in liquid tight contact with the piston body such that liquid can flow from the inner chamber to a part of the piston body on an opposite the inner chamber. The injection device being arranged for driving the piston head in the recess portion in a clean-in-place (CIP) configuration.
US10906224B2	Method for operating a constant pressure filament driver to an extruder head in a three-dimensional object printer A method of operating an additive manufacturing system feeds solid extrusion material into a heater using a slip clutch coupled to an actuator of a mechanical driver to supply thermoplastic material into a manifold in an extruder head. The method sets a speed of the actuator so the actuator operates at a rotational speed that is slightly greater than the rotational speed of the mechanical mover. This method helps maintain the pressure of the thermoplastic material in the manifold of the extruder head in a predetermined range no matter how many nozzles are opened in the extruder head.
US10906223B2	Control device for injection molding machine and control method for injection molding machine A control device for an injection molding machine has a first operation condition setup unit for setting an operation condition for a setting operation, a conversion table for storing in pairs an operation condition for the setting operation and an operation condition for a pull operation, a second operation condition setup unit for setting, by reference to the conversion table, an operation condition for the pull operation in correspondence to the operation condition for the setting operation set by the first operation condition setup unit, and a driving command generation unit for generating driving commands which drive the injection molding machine to perform the setting operation and the pull operation in accordance with the operation conditions set by the first operation condition setup unit and the second operation condition setup unit.
US10906222B2	Injection molding machine An injection molding machine for molding a molded article includes a display device, and a support mechanism configured to support the display device on a molding machine body. The support mechanism includes a first bracket attached to the display device, a second bracket attached to the molding machine body, and a slider provided between the first bracket and the second bracket and configured to support the first bracket so as to be movable relative to the second bracket in a mold opening and closing direction.
US10906221B2	Manufacturing method of liquid supply member There is provided a manufacturing method of a liquid supply member capable of suppressing decrease in sealing property of a liquid supply path and deformation of the liquid supply path or the external shape. For that purpose, a manufacturing process of a liquid supply member prevents inflow of a molten resin into a concave portion of a portion other than a liquid supply flow path in a liquid supply member.
US10906220B2	Method for producing a luminescent 3D radar module cover, and injection-molding system A method and a system for producing a luminescent 3D radar-module cover for a radiator grille of a motor vehicle. A three-dimensional structure including an optical conductor is produced from a light-dispersing first plastic material in separate method steps using a first injection mold. The three-dimensional structure is metallized and metal-coated. A subsequent separation of the gating takes place. A cover element is produced from a second plastic material using a second injection mold, which at least partially covers the metallized three-dimensional structure in a planar manner in a position of use. A contour of the three-dimensional structure is left free. The gating is subsequently severed. The three-dimensional structure is metallized together with the cover element disposed thereon and is embedded in a third plastic material with the aid of a third injection mold while molding a mount for a radar module and fastening points on the molded component.
US10906218B2	In-mould labelling process There is disclosed an in-mould labelling process for the manufacture of a labelled article comprising the steps of: feeding a labelstock web into a mould; forming an article in the mould such that the formed article contacts and effectively adheres to a label of the labelstock web; detaching the adhered label from the labelstock web; and removing the formed and labelled article from the mould.
US10906217B2	Molding for high brightness appearance and molding method thereof Disclosed is a molded article including a base layer, a surface layer having a resin and formed to cover at least a portion of the base layer, and a reflective material mixed with the resin and reflecting light, wherein the reflective material includes a metal flake, and a metal oxide layer stacked on the metal flake.
US10906213B2	Apparatus and method for processing doses An apparatus including a co-extrusion device for extruding a multi-layer structure having at least one primary layer and at least one secondary layer, so that the multi-layer structure leaves the co-extrusion device along an exit direction; a mould provided with a pair of elements, at least one of the elements being movable towards the other in a moulding direction, so as to compression mould an object from a multi-layer dose which was severed from the multi-layer structure; a transport device for carrying the dose towards the mould; an arrangement for modifying orientation of the dose while the dose is being transported by the transport device, so that the dose is introduced into the mould with an orientation in which the secondary layer extends transversely to the moulding direction.
US10906212B2	Actinic radiation device for speedy resin cure Provided are devices for applying actinic radiation to a curable resin. The devices include a housing having a front face, an actinic radiation source arranged within the housing such that actinic radiation emerges from the housing through the front face, and a proximity detector. The proximity detector is functionally connected to the actinic radiation source such that the actinic radiation source is shut off unless the proximity detector detects the presence of a surface within a safe distance from the front face. Optionally, the device includes a surface temperature sensor functionally connected to the actinic radiation source such that the actinic radiation source is shut off if the surface temperature sensor senses a surface temperature exceeding a maximum safe surface temperature.
US10906206B2	Apparatus for manufacturing fiber-reinforced concrete through shooting after inserting bubbles into normal concrete and method for manufacturing same The present invention relates to an apparatus for manufacturing fiber-reinforced concrete through shooting after inserting bubbles into normal concrete and a method for manufacturing the same, which: form fiber-mixed concrete in which the bubbles, fiber-mixed materials, and silica fume are mixed in the normal concrete or form the fiber-mixed concrete in which aggregates, water, and the bubbles are put into and mixed with a mixture, in which cement, the fiber-mixed materials, and silica fume are mixed; and then shoots the fiber-reinforced concrete in which excessive air included in the fiber-mixed concrete is reduced by spraying the fiber-mixed concrete with the high-pressure air when the fiber-mixed concrete is discharged, and of which a slump, drastically increased due to the large amount of bubbles, is reduced to a range of the slump of the normal concrete, thereby improving the production capacity of the fiber-reinforced concrete and shortening operating time.
US10906204B2	Translucent building element and method of manufacturing same The present invention is related to translucent building elements, and more specifically to their manufacture. The present invention comprises a method for the manufacture of an insulating core element for a translucent building element, an insulating core element for a translucent building element, a method for the manufacture of a translucent building element, a translucent building element, a method for the manufacture of a translucent building wall, a translucent building wall, and a method for the manufacture of a multiple of stacked rows of elongated light-conducting elements for an insulating core element.
US10906203B2	Apparatus and method for joining of carbide ceramics A method for joining carbide ceramic particles, comprising: forming a first mixture comprising carbide ceramic particles, preceramic polymer liquid, fine carbon particles and metal nanoparticles that form a eutectic liquid at temperatures below 1400° C.; and heating the first mixture at a temperature of about 1150° C. to about 1400° C.
US10906199B2	Onion chopper with spiralizer insert An onion chopper includes a container having a bottom and a plurality of sidewalls extending upwardly and terminating in a rim. A lid is attached to the container at a pivot location for movement between a closed position adjacent the rim and an open position pivoted away from the rim. A tray is removably supported atop the container, and defines a central opening positioned between a forward end and a rearward end. A spiralizer insert is removably attached to the tray within the central opening, the spiralizer insert having a central spindle and a blade extending radially outward from the central spindle.
US10906198B2	Installation for cutting food products equipped with means for filling the chute An installation (I) for cutting food products in the form of elongated loaves (P). The installation includes at least one assembly (E) with at least one chute or magazine for receiving a loaf (P). The chute has the form of an elongated compartment configured to receive the loaf (P) via its open upper end, with the possibility of sliding so as to direct it towards and beyond its open lower end. A generally horizontal tray is arranged at a distance from the lower end of the chute with a cutting blade arranged near the tray. A displacement mechanism alternatively guides the lower end so that said blade interacts the loaf and executes its cutting. Also included is a storage unit (S) and a mechanised and/or automated unit for picking-off at least one loaf (P) from the storage unit (S) and for transferring and loading it in the chute.
US10906192B1	Gripper A gripper may be provided that includes a motor, a jaw guide, a wedge head, a jaw, and a finger. The jaw guide is disposed on the motor and has a guide hole and a plurality of guide grooves. The wedge head is disposed in the guide hole and is able to perform up and down reciprocating movement by the motor. The jaw is disposed in the plurality of guide grooves respectively and is connected to the wedge head. When the wedge head moves in an up and down direction, the jaw is able to perform a reciprocating movement in a direction perpendicular to the up and down direction. The finger is disposed on the jaw. When the jaw moves in the direction perpendicular to the up and down direction, the finger moves together with the jaw, so that the movement of an object is limited.
US10906187B2	Robotic gripper camera An unmanned ground vehicle includes a main body, a drive system supported by the main body, and a manipulator arm pivotally coupled to the main body. The drive system comprising right and left driven track assemblies mounted on right and left sides of the main body. The manipulator arm includes a gripper, a wrist motor configured for rotating the gripper, and an inline camera in a palm of the gripper. The inline camera is mechanically configured to remain stationary with respect to the manipulator arm while the wrist motor rotates the gripper.
US10906182B2	Method of teaching robot and robot system A robot system includes a robot, a vision sensor, and a controller. The vision sensor is configured to be detachably attached to the robot. The controller is configured to measure a reference object by using the vision sensor and calibrate a relative relationship between a sensor portion of the vision sensor and an engagement portion of the vision sensor, and teach the robot by referring to the relative relationship and by using the vision sensor, after the vision sensor is attached to the robot.
US10906180B1	Monitoring and maintaining an intravenous assembly without medical staff involvement for safe distancing enforcement A method and system to monitor and autonomously configure an intravascular assembly without medical staff involvement or presence. In this solution, a robotic device is associated with an intravascular assembly, which has tubing through which fluids are delivered intravenously. Monitoring of the tubing is initiated. In response to the monitoring, an errant flow through the tubing is detected; typically, the errant flow results from one of: a kink or twist in the tubing, an air bubble in the tubing, an occlusion or clot in the tubing, and pressure variations. In response to detecting the errant flow, and in advance of an audible alarm being generated in association with the intravascular assembly, a command is then issued to the associated robotic device. The command is configured to initiate, by the robotic device, physical engagement with and mechanical manipulation of the tubing, thereby remediating the errant flow automatically.
US10906177B2	Active handling apparatus and method for contact tasks An apparatus for automated contact tasks and a related method are described. The apparatus includes a mechanical interface for connecting the apparatus to a manipulator, a holder for receiving a tool and being movable in relation to the mechanical interface, at least one actuator for positioning the holder in relation to the mechanical interface, a sensor unit that senses the actuator force provided by the at least one actuator, and a control unit that sets the actuator force to a desired minimum force to press the holder against a stop, while there is no contact between the tool and a surface, and detects contact when the holder moves in relation to the mechanical interface in opposition to the direction of the desired minimum force. The control unit further regulates the actuator force according to a pre-programmed contact force time-characteristic, when contact between the tool and the surface has been detected.
US10906175B2	Apparatus and method for estimating position of the center of gravity of robot A position of gravity of center of a load loaded to an industrial load is estimated. The robot has a robot arm driven horizontally. The robot arm includes first to fourth axis. Acceleration generated at the second axis during accelerated and decelerated intervals of each of three operation periods. In each operation period, the second axis is driven to move the robot arm from one initial position to one first estimating position and returns it from the estimating position to the initial position. During each operation period, the load is given a known mass, the fourth axis is positioned at a preset angle, and the first, third and fourth axes are the same in positions between the initial and estimating positions. The fourth-axis position is changed to different angles for every operation period. Based on calculated acceleration and known factors of the robot and load, the position is estimated.
US10906173B2	Smart cabinet The application relates to a smart cabinet. The smart cabinet includes a cabinet body, a moving module, a controlling module and an assisting module. The moving module is positioned in the cabinet body; the controlling module is connected to the moving module. The moving module includes a base, a guiding wheel group disposed on the base, a plurality of drivers pivotally connected with the guiding wheel group, and a manipulator disposed on the base. The controlling module includes an input control unit, a guiding rope, and a pulley group. The input control module is electrically connected with the drivers and the manipulator. The pulley group includes a plurality of pulleys defining a movement range for the moving module. The assisting module includes a rope retractor and a sensor electrically coupled to the rope retractor. Two ends of the guiding rope are coupled to the rope retractor.
US10906165B2	Firing pin assembly of nail gun and bonding method thereof A firing pin assembly of a nail gun and a bonding method thereof are provided. The firing pin assembly includes a firing pin body and a firing pin head made of a material having a hardness greater than that of the firing pin body. The firing pin head has a first end and a second end. The first end is made of a material having a density lower than that of the second end. The first end and the front end face of the firing pin body are preheated to a set temperature. The top of the second end is pressed toward the front end face of the firing pin body for an appropriate bonding time, so that the material particles of the firing pin body are dissociated and fused into the first end of the firing pin head to form the firing pin assembly.
US10906161B2	Connection and torque transfer apparatus, accessory, and use thereof The present disclosure provides a connection and torque transfer apparatus having a torque input end and a torque output end electrically insulated, an accessory and use thereof. The connection and torque transfer apparatus comprises at least: a torque input component, an intermediate body component, and a torque output component; and the accessory can match the foregoing apparatus to form an assembly. The apparatus has a few components, high reliability, good insulating performance, excellent torque transfer performance and low costs, and is simple and convenient to manufacture.
US10906160B1	Wingnut adjustment tool A self-contained folding wingnut tool for a variety of wingnut applications including percussion instruments. The tool has a hinged clamshell housing with multi-spaced pairs of upstanding wingnut engagement elements aligned to engage and adjustably turn wingnuts of various dimensions therebetween. Each pair of upstanding wingnut engagements form opposing space contoured frictional engagement surfaces for the registration with respective portions of a wingnut, positioned therebetween. The opposing spaced wingnut engagement pairs extend from wingnut engagement portion of the hinged housing inwardly from its free end, so when opened and extended an oppositely disposed portion handle is formed by the opposite housing portion for leverage and enclosure when closed.
US10906158B2	System, fixture plate assembly, and method for indexing a workpiece Disclosed herein is a system for indexing a workpiece. The system comprises a vacuum source and a fixture plate, fluidly coupled with the vacuum source. The system also comprises an indexing stop, coupled to the fixture plate and fluidly coupled with the vacuum source. The indexing stop is actuatable between an extended position and a retracted position relative to the fixture plate. The vacuum source is selectively operable to concurrently apply a suction force to a workpiece supported on the fixture plate to urge the workpiece against the fixture plate and to the indexing stop to actuate the indexing stop from the extended position to the retracted position.
US10906155B2	Power tool with interchangeable tool head A power tool that includes a tool body housing, a drive system, a tool head and a connection system. The drive system is housed in the tool body housing. The tool head, which is configured to perform work on a work piece, includes a tool head housing and an input member that is driven by the drive system when the tool head is coupled to the tool body housing. The tool head can be engaged to the tool body housing in at least two pre-defined and distinct orientations. The connection system secures the tool head to the tool body housing in each of the at least two pre-defined and distinct orientations.
US10906144B2	Tool and method for connecting/disconnecting a runner to/from a shaft assembly The present invention generally relates to an innovative tool for connecting or disconnecting a runner to/from a shaft assembly. Moreover, the present invention relates to a method for carrying out such operations using the tool. Advantageously, connecting/disconnecting operations can occur without having to work under a suspended load, as the tool may be activated for supporting the runner remotely from a location outside a runner footprint.
US10906143B2	Methods and systems for the manufacture of cutting blades for industrial machines A method for hardfacing cutting blades used in industrial machinery by creating a channel in the surfaces of an oversize cutting blade that may be filled with hardface weld and machining the outer edge of the main body and channel to create a desired finish profile with a hardfaced edge. Such a cutting blade may additionally have fixed points of reference on the cutting blade which may be used to automate some or all of the process of creating and/or hardfacing a cutting blade to the desired profile.
US10906142B2	Stacking apparatus for heat exchanger cores Provided is a stacking apparatus for heat exchanger cores that can assemble heat exchanger cores manufactured by a conventional manufacturing apparatus for heat exchanger core into stacked heat exchanger cores. As a solution, the stacking apparatus for heat exchanger cores includes: a core uprightly supporting unit; a first core holder with a J shape that holds a first heat exchanger core in close contact with a second heat exchanger core, a second core holder that holds the first heat exchanger core and the second heat exchanger core in close contact, and a core holding unit that moves the first core holder and the second core holder; a core conveying unit including a bottom supporter, a third core holder with a J shape that holds the first heat exchanger core or the second heat exchanger core held by the bottom supporter in close contact, and a moving mechanism; and an operation control unit that controls an operation of the core holding unit and the core conveying unit.
US10906140B2	Bearing race installer/remover A puller/installer comprises a draw plate, a split ring, a cap plate, and at least one draw member. The draw plate defines a draw plate cam surface. The split ring defines at least one split plate cam surface and is arranged such that the at least one split plate cam surface is in contact with the draw plate cam surface. The at least one draw member is arranged to draw the cap plate and the draw plate towards each other such that the draw plate cam surface engages the at least one split plate cam surface to deform the split ring to alter an effective diameter of the bearing race puller/installer.
US10906136B1	Joint structure Disclosed is a joint structure that includes a basal phase that contains Sn and an Sn—Cu alloy, and an intermetallic compound that is composed of Sn, Cu and Ni, and is contained in the basal phase; the Sn—Cu alloy and the intermetallic compound form an endotaxial joint; area ratio of the endotaxial joint, when assuming the total area of joint face between the Sn—Cu alloy and the intermetallic compound as 100%, is 30% or larger; and the joint structure contains 0.7 to 40% by mass of Cu, 0.1 to 5% by mass of Ni, and the balance of Sn.
US10906135B2	Systems and methods for low-manganese welding wire The invention relates generally to welding and, more specifically, to welding wires for arc welding, such as Gas Metal Arc Welding (GMAW) or Flux Core Arc Welding (FCAW). In one embodiment, a tubular welding wire includes a sheath and a core. The tubular welding wire includes less than approximately 0.4% manganese metal or alloy by weight, and the tubular welding wire is configured to form a weld deposit having less than approximately 0.5% manganese by weight.
US10906131B2	Method for processing film Embodiments are directed to a method for processing a film, which includes: (A) a step wherein protective films are temporarily bonded to both surfaces of a film that is a material to be processed, thereby obtaining a film to be processed to both surfaces of which the protective films are bonded; and (B) a step wherein the film to be processed to both surfaces of which the protective films are bonded is cut using a laser having a wavelength at which the protective films have an absorbance of 50% or more. Other embodiments are directed to a method for processing a film, which includes: (A) a step wherein protective films are temporarily bonded to both surfaces of a film that is a material to be processed, thereby obtaining a film to be processed to both surfaces of which the protective films are bonded; and (B′) a step wherein the film to be processed to both surfaces of which the protective films are bonded is cut using a laser having a wavelength at which the film to be processed has an absorbance of 50% or more and the protective films have an absorbance of 50% or more.
US10906127B2	Friction stir welding method A friction stir welding method is provided that can prevent defective welding due to a shortage of metal. The friction stir welding method welds metal members (1, 2) using a primary joining rotary tool (F) having a stirring pin (F2), and includes steps of: butting in which the metal members (1, 2) are butted with each other at an angle to form a butted portion (J1); buildup welding in which buildup welding is applied along an inner corner of the metal members (1, 2) formed in the butting step to cover the inner corner by a weld metal (M); and inner corner joining in which only the stirring pin (F2) in rotation is inserted in the inner corner to plastically fluidize the weld metal (M) and the metal members (1, 2) for friction stir welding of the butted portion (J1).
US10906125B2	Method for manufacturing electroseamed metal tube, and electroseamed metal tube Provided is a method for manufacturing an electric resistance welded metal pipe by butting side ends of a metal strip against each other and then welding the side ends by high frequency heating to manufacture an electric resistance welded metal pipe, each side end being provided with an inner surface side corner portion located on an inner surface side of the electric resistance welded metal pipe, wherein the method comprises a step of forming an inclined surface at the inner surface side corner portion before butting the side ends of the metal strip; and wherein the side ends are butted and welded to each other such that the inclined surface remains on an excess metal of the metal pipe after electric resistance welding and a discharged metal is not welded to the excess metal.
US10906122B2	Portable drawn arc stud welder including a lithium ferrophosphate battery A portable drawn arc stud welder apparatus with a lithium ferrophosphate (LFP) battery and stud weld battery control system (SWBCS) is provided for welding a stud onto a workpiece. The portable drawn arc stud welder apparatus includes a housing, an LFP battery disposed in the housing and including a plurality of LFP battery cells, a weld stud gun configured to hold a stud and is electrically connected to the LFP battery for receiving energy from the LFP battery to pass a current through the stud and the workpiece to form a weldment. The SWBCS is disposed in the housing and electrically connected to the LFP battery of the portable drawn arc stud welder apparatus. The SWBCS includes a computer, a memory, and instructions therein to implement control and monitoring of the operation of the portable drawn arc stud welder apparatus.
US10906119B2	Systems and methods for communication via a welding cable A welding system having a weld torch, a first transmitting circuit, and a first receiving circuit is provided. The weld torch is coupled to a weld cable and is configured for a welding application. The first transmitting circuit includes a first processor and a sensor system with at least one sensor configured to detect sensor information related to the weld torch. The first processor transmits one or more control signals based on the received sensor information. The first receiving circuit includes communications circuitry and a second processor that receives the one or more control signals and generates information related to a trigger status based on the one or more control signals. The communications circuitry transmits the information to the wire feeder, and the wire feeder controls an operating parameter of the welding system based at least in part on the information related to the trigger status.
US10906117B2	System and method for providing welding type power on multiple outputs A method and apparatus for providing welding type power on one of at least two output terminals is disclosed. Input power is received and welding type power is derived and provided by a shared power circuit. The welding type power is provided across a shared terminal and only two process terminals in response to a desired process. The desired process can be set bu user input, feedback, or sensing working connections. The process terminal is selected by selectively opening and closing at least two controllable switches.
US10906114B2	System for arc welding with enhanced metal deposition A welding system includes a power supply configured to output power to a welding device. The power supply is configured to alternate the power output between an arc phase and a hotwire phase. The power output in the arc phase produces an arc between a welding electrode and a workpiece, and the power output in the hotwire phase heats the welding electrode without producing an arc.
US10906111B2	Method of using a cutting blade A method of using a cutting blade on a portable band saw. The method includes the step of providing a portable band saw. A cutting blade is provided which includes at least one tooth that has a linear rake face with a positive rake face angle transitioning uninterruptedly from a tip of said cutting tooth into a single radius to define a portion of said cutting tooth. The portable band saw is used to cut and object with the cutting blade of the portable band saw in a single continuous linear cut direction.
US10906110B2	Power tool with integrated measurement device and associated methods Various embodiments of tools with integrated measurement devices are described. An apparatus may include a tool to be applied to a workpiece, an integrated measurement device in a feed path of the tool, and a controller. The integrated measurement device may generate signals indicative of rotation of a roller in a feed path of a workpiece. The controller may generate, based on the signal, a distance measurement of the workpiece. The distance measurement may indicate a distance between an end of the workpiece and a location of the workpiece to which the tool is to be applied.
US10906107B2	Single-sided four-way indexable positive cutting insert and insert mill therefor A single-sided four-way indexable cutting insert includes a positive basic shape, a rake surface, a peripheral surface including four side abutment surfaces, a base bearing surface and a screw hole connecting the rake and base bearing surfaces. The insert has an imaginary square frustum which defines a square base containing the cutting insert's base bearing surface, and further defines four isosceles trapezoid side surfaces respectively containing the cutting insert's four side abutment surfaces. A material volume VF of the cutting insert and a void volume VS of the insert fulfill the condition VS/VF≥0.25.
US10906106B2	Modular turning tool having a replaceable adaptor A turning tool adaptor includes opposite first and second side surfaces and a peripheral surface which extends therebetween. The turning tool adaptor further includes a cutting portion with an insert retaining portion and a clamping portion which extends from the cutting portion. The clamping portion includes a protrusion which extends transversely from the first side surface. The protrusion includes a main abutment surface and spaced apart first and second adaptor clamping bores which open out to the second side surface and also to the main abutment surface. The turning tool adaptor has first, second and third abutment surfaces which are located between the top and bottom surfaces in a side view perpendicular to one of the side surfaces.
US10906104B2	Systems and methods of fabrication and use of wear-resistant materials Discussed herein are systems and methods of forming hardfacing coatings and films containing Q-carbon diamond particles for use in downhole drilling tooling and other tools where wear-resistant coating is desirable. The Q-carbon diamond-containing layers may be coated with matrix material and/or disposed in a matrix to form the coating, or the Q-carbon diamond layer may be formed directly from a diamond-like-carbon on a substrate.
US10906100B2	Heat treatment process for additive manufactured components A method for manufacturing and heat treating a component formed from an alloy or superalloy. The component may be part of a gas turbine engine, such as an airfoil of a gas turbine engine turbine, or a combustor fuel nozzle, that includes internal cooling passages. At least part of the component is formed from the alloy or superalloy using an additive manufacturing process. The method includes determining an incipient melting point range and a recrystallization temperature of the alloy or superalloy. The component is then heated to at least the recrystallization temperature and within the incipient melting point range for a predetermined time, and ultimately cooled.
US10906098B2	Fabrication of three-dimensional porous anode electrode An electrode for the use of an advanced lithium battery is fabricated using three-dimensionally structured metal foam coated with an active material. The metal foam is porous metal foam that can be used as an anode current collector of a lithium-ion battery and is coated with an anode active material, such as tin, through a sonication-assisted electroless plating method. Additionally, the coated metal foam is heat-treated at an appropriate temperature in order to improve the integrity of the coating layer and hence, the cyclic performance of the lithium-ion battery.
US10906097B2	Ultraviolet and/or near-infrared blocking agent composition for transparent material An object of the present invention is to provide an ultraviolet and/or near-infrared shielding agent composition for transparent material using silicon compound-coated silicon-doped zinc oxide particles that are controlled in properties in an ultraviolet region and/or a near-infrared region. The present invention provides an ultraviolet and/or near-infrared shielding agent composition for transparent material used for a purpose of shielding ultraviolet rays and/or near-infrared rays, the ultraviolet and/or near-infrared shielding agent composition for transparent material featuring that the ultraviolet and/or near-infrared shielding agent contains silicon compound-coated silicon-doped zinc oxide particles, with which surfaces of silicon-doped zinc oxide particles that are zinc oxide particles doped with at least silicon are at least partially coated with a silicon compound.
US10906094B2	Decompression shut-off valve device and method for controlling same Provided are a decompression shut-off valve device having high responsiveness and a method for controlling the same. The decompression shut-off valve device 10 includes an on-off valve 30, a detection pin 50, and an interlocking member 60 which operates the on-off valve 30 by displacement of the pressure-receiving section 52, a valve chamber 31, an accommodating chamber 17, and a cylinder 40 which accommodates an enlarged diameter section 37 provided in a rod section 33 of the on-off valve 30. The rod section 33 is slidably held through a second partition wall 18, and a rod end portion 36 of the rod section 33 is connected to the detection pin 50 via the interlocking member 60. The cylinder 40 is partitioned into a small diameter low-pressure chamber 80, and a large diameter high-pressure chamber 70 in which the working fluid having a higher pressure than the low-pressure chamber 80 is accommodated.
US10906090B2	Method of producing insert die of casting apparatus for manufacturing cast product from molten metal, and casting apparatus A casting apparatus for manufacturing a cast product from molten metal includes a molten metal and a cooling portion. The molten metal contacts a surface for contact with the molten metal. The cooling portion forms a cooling flow passage. The cooling flow passage is configured to cool the molten metal contacting surface. At least a part of an inner surface of the cooling flow passage is constituted of a welding portion formed by welding, the welding portion sealing the cooling flow passage. The welding portion is constituted such that an exposure to the molten metal becomes equal to or less than a predetermined ratio with respect to an area of the welding portion constituting the inner surface of the cooling flow passage.
US10906087B1	Die for the manufacturing of elongate bodies A die holder mounts a die to form heads on nails or screws. A top surface of the die includes a groove for longitudinally receiving and holding an elongate body. The die has a recess merging into the groove at one end of the groove to form a nail or screw head. The die is conical for press fit by contact with an inner surface of a bore or hole in the die holder. A top surface of the die is planar to a top surface of the die holder with a bottom surface engaging bottom part of the die holder. The bottom portion of the die has a recess or engaging with a corresponding protrusion die holder fixing an angular orientation of the groove relative to the die holder. Two opposite dies are brought together by two opposite die holders forming the head.
US10906085B2	Rolling element bearing cage with supporting frame and reinforcing frame The invention relates to a rolling element bearing cage formed of one or more segments, each segment comprising: a supporting frame having a plurality of spaced apart openings each for accommodating a rolling element; and a reinforcing frame, inserted within the supporting frame, having a corresponding plurality of openings each for aligning with the openings of the supporting frame.
US10906082B2	Laminated core manufacturing apparatus and laminated core manufacturing method A Laminated core manufacturing device includes: an overlapping unit configured to overlap the plurality of laminated core materials conveyed along different conveyance routes; an edge aligning unit configured to align edge positions in a width direction of the plurality of laminated core materials between the plurality of laminated core materials; an uplift prevention unit configured to prevent uplift of the plurality of laminated core materials; an edge position correction unit configured to correct the edge positions in the width direction of the plurality of laminated core materials; and a punching unit configured to punch out the plurality of laminated core materials which are overlapped by the overlapping unit and have been subjected to an edge position alignment process performed by the edge aligning unit, an uplift prevention process performed by the uplift prevention unit, and an edge position correction process performed by the edge position correction unit.
US10906080B2	System and methods to radially orient extruded tubing for vehicle body component A method of orienting a weld seam in an aluminum vehicle body tube is provided. The method may include measuring a periphery of a first end of the tube to locate a position of a pip disposed on a wall of the first end of the tube and rotating the tube so that the weld seam is positioned in a predetermined location suitable for tube forming.
US10906073B2	Adjustable focus laser cleaning galvanometer, cleaning system and cleaning method Adjustable-focus laser cleaning galvanometers, cleaning systems, and cleaning methods in the field of laser cleaning are disclosed. According to aspects herein, an adjustable-focus laser cleaning galvanometer includes a body, a laser, an adjustable lens set and a galvanometer. The adjustable lens set and the laser may be mounted on the body. In some implementations, the adjustable lens set may be configured to convert or transform a laser beam emitted from the laser into a focused beam and adjust the focal length of the beam. Further, the galvanometer may be mounted on the body and can rotate or swing on the body.
US10906071B1	Methods for removal of reaction sites on metal surfaces and application of a nanotube containing protective coating A method of preparing and decontaminating a substrate surface to remove contaminants including the steps of applying a first dry or fluid composition having a pH of 4 or less comprising an acidifier and an oxidizer, allowing the first composition to remain on the substrate surface for a predetermined period of time, and rinsing the first composition from the substrate surface with a second composition having a pH of 8 or more comprising an alkaline material liquid mixture formed utilizing activated carbon filtered potable water to achieve a neutral pH condition on the surface, and then applying a nanotubes coating on the surface.
US10906067B2	Modular and separable equipment for automatically sorting parcels into bags Equipment for sorting parcels into bags comprises a bag support having a modular structure with modules that are provided with braked wheels and that are arranged to be coupled together in separable manner, at least one mobile shuttle robot cart and trolley assembly that is caused to be moved by being remotely controlled by a monitoring and control unit to move parcels to be sorted along the bags, and floor marking that is arranged along the bag support modules and that is detectable by the shuttle cart and trolley assembly while said shuttle cart and trolley assembly is moving along the bag support modules.
US10906066B2	Appartuses and processes for producing optical effect layers comprising oriented non-spherical magnetic or magnetizable pigment particles The present invention relates to the field of magnetic assemblies and processes for producing optical effect layers (OEL) comprising magnetically oriented non-spherical magnetic or magnetizable pigment particles on a substrate. In particular, the present invention relates magnetic assemblies and processes for producing said OELs as anti-counterfeit means on security documents or security articles or for decorative purposes.
US10906065B2	Laminate, surface-protected articles, and manufacturing method of the laminate The invention of the present application is a laminate in which thermoplastic polyurethane is used, excellent antifouling and adhesion properties are obtained, and glue residue is minimized. The laminate is provided with a substrate film formed from thermoplastic polyurethane, and an adhesive layer formed on one surface side of the substrate film. The substrate film has a surface layer on the opposite side of the first surface, a mixture of the thermoplastic polyurethane and a curable resin composition being present in the surface layer. The content ratio of the curable resin composition is configured so as to gradually decrease from the surface of the surface layer towards the interior of the substrate film. The curable resin composition contains at least one fluorine compound selected from the group consisting of fluorosilsesquioxane and fluorosilsesquioxane polymers, and a curable resin. The adhesive layer has a surface roughness of 350-750 nm.
US10906058B2	Systems and methods for inspecting and cleaning a nozzle of a dispenser Systems and methods for inspecting and cleaning a nozzle of a dispenser are disclosed. The systems may include a platform supporting a cleaning substrate. The cleaning substrate may have a plurality of hook structures configured to remove a material from the nozzle. The systems may also include a camera configured to capture an image of the nozzle and a controller configured to control the system. The methods may include providing a cleaning substrate having a plurality of hook structures, and moving at least one of the nozzle and the cleaning substrate relative to the other to remove a material from the nozzle. The methods may also include capturing an image of the nozzle after dispensing with a camera, processing the image to generate a value, utilizing the value to determine if the nozzle should be cleaned, and if the determination is that the nozzle should be cleaned, cleaning the nozzle.
US10906055B2	Device for packaging and dispensing a product comprising a moveable piston The device for packaging and dispensing a product comprises a container (12), a moveable piston (16) mounted inside the container and delimiting at least one compartment (22) containing the product, and a dispensing member (14) mounted on the container and comprising at least one outlet orifice in communication with the compartment. The container comprises an adapter portion for the dispensing member provided with an outer skirt (12d) extending from an end wall (12c) of the container, with an inner skirt (12e) radially surrounded at least in part by the outer skirt and with a wall (12f) connecting the outer and inner skirts, the wall and the skirts delimiting a groove (30) oriented axially on the side opposite to the compartment (22) and inside which the dispensing member (14) is fitted.
US10906054B2	Device for dispensing a fluid product A dispenser device having a dispenser head; an air expeller (20) for generating a flow of air with a piston (21) that slides in an air chamber (22); and a reservoir (30) containing a dose of composition, the reservoir (30) including an air inlet (31) connected to the air expeller (20), and a composition outlet (32) connected to the dispenser outlet (10), the air inlet (31) including a composition retainer member (40), and the composition outlet (32) closed by a closure element (50). The device has an opening system (61, 62) and an indicator (100; 50) that before actuation is in a first state and after actuation passes into a second state. The device includes a pusher element (25) secured to the piston (21). The dispenser head (1) includes a skirt (5) arranged around the air chamber (22), the bottom axial edge of the skirt (5) including a cutout (6).
US10906053B2	Modular device for cell spraying Systems and methods for spraying a liquid treatment solution include a syringe attachment device and a handheld device. The syringe attachment device can be configured to secure a syringe containing the liquid treatment solution. The handheld device can have a movable slide configured to dispense the treatment solution from the syringe. The spray deposition system can include a cover' positioned to provide an impervious barrier between at least a portion of the syringe attachment device and the handheld device. The cover can be attached to the syringe attachment device prior to coupling the devices together. In an example, the cover can have a generally tubular shape with a closed end and an open end. The handheld device can be inserted into the cover and the cover can enclose the handheld device in the assembled position. In an example, the cover can be sterile and at least a portion of the syringe attachment device can be sterile.
US10906051B2	Pushing-dispensing and/or dosing element for dispensing and/or dosing of medium, in particular composite heavy fluid compound (CHFC) A pushing-dispensing and/or dosing element for dispensing of medium, in particular Composite Heavy Fluid Compound (CHFC), solves the technical problem of implantation of avoiding and/or limiting sliding and/or moving parts, exposed to the heavy medium, such as CHFC, thereof by using a flexible cartridge that behaves one way during the pushing of the CHFC, and another way during pumping of said CHFC out of the tank in which it is held.
US10906050B2	Modular dual vector fluid spray nozzles Various embodiments of modular dual vector fluid spray nozzles are disclosed. Embodiments of the nozzles are characterized by specially shaped fluid channels, impingement surfaces and exit orifices used to generate atomized mists of fluid under pressure. Embodiments of the nozzles are generally characterized by composite fluid spray density patterns having horizontal and vertical components, i.e., dual vector in nature. The nozzles disclosed are modular and may be easily installed or removed from a given fluid spray system, nozzle head, or fixture as dictated by any given application.
US10906049B2	System for multi-processing and separation of biological fluids A system for the processing and separation of biological fluids into components comprises an apparatus that cooperates with a disposable set, comprising a cabinet (100) for housing a hollow centrifugal processing chamber (20) of the disposable set. The cabinet comprises a plurality of side-by-side locations (110) for receiving a corresponding plurality of centrifugal processing chambers (20) in side-by-side spaced-apart relation. Each location comprises an individual drive means (52) for driving its centrifugal processing chamber. Remotely-actuable valves (124) associated with the disposable sets are located on the apparatus' cabinet in the proximity of said locations. Valve actuation provides a display of the state of actuation of the valves (124). Selection of this state of actuation is arranged to control connection of the centrifugal processing chamber (20) of each fitted disposable set with a flexible container (200) of the same disposable set or another container, and to control connection of the centrifugal processing chambers (20) with flexible containers of the same or other fitted disposable sets in different combinations, in particular with series and/or parallel connections.
US10906046B2	System and method for infusion and desiccation of foodstuffs A food recycler includes a base, at least one air intake opening, a gearbox, and a motor. An airflow component is on top of the motor. A fan is configured on the airflow component and a filter is positioned at an output port of the airflow component. A bucket receptacle is configured on the gearbox. The fan and the filter are configured adjacent to an upper portion of the bucket receptacle. A casing has a lower rim complimentary to a base rim. The casing has an interior volume complimentary to a fan module and an interior volume complimentary to an air filter module. A control switch and lid latch are configured in the casing and next to each other. A lid is hinged to the casing such that air flows from a bucket through the lid to the fan and back from the filter to the lid and out an exhaust vent in the lid.
US10906045B2	Dimensionally stable ring element for a heat exchanger casing A dimensionally stable ring element (1, 2) for a heat exchanger casing (3) includes: a cylindrical sleeve (10, 20) having a cylinder axis (102, 202), a first end (104, 204) and a second end (106, 206) remote from the first end, and having an inner wall (108, 208), a dividing wall (11, 21) which projects inwards from the inner wall (108, 208) of the sleeve (10, 20) and extends helically around the cylinder axis (102, 202) along the inner wall (108, 208) from the first end (104, 204) of the sleeve (10, 20) to the second end (106, 206) of the sleeve (10, 20). At its first end (104, 204) the sleeve (10, 20) includes a projection (109, 116, 209, 216) extending parallel to the cylinder axis (102, 202), which projection is arranged in a predetermined circumferential position on the sleeve (10, 20).
US10906035B2	Modified sample processing device A sample processing tubule is provided including, from a proximate to a distal end, an opening through which a sample is introducible, at least three segments, and an extraction port operatively connected to a distal segment of the at least three segments. The extraction port enables extraction of a reaction mixture in the distal segment of the tubule without piercing the tubule or one or more seals separating each of the segments in the tubule.
US10906034B2	Method for dosing a liquid using a pipette and a syringe, and pipette for operating a syringe for dosing a liquid A method for dosing a liquid using a pipette with adjustable dosing step size and an indicating equipment and a syringe that can be operated using the pipette, wherein the syringe is detachably connected to the pipette, at option, the dosing step size is set, or the dosing step size set before is maintained, the dosing volume adjusted via the dosing step size is indicated by means of the indicating equipment, the maximum number of dosing steps possible without refilling the syringe, with the set dosing step size and completely filled syringe is indicated by means of the indicating equipment, liquid is aspirated into the syringe, a reverse stroke is performed after the syringe is filled with liquid, dosing steps are performed, the performed dosing steps are counted and the number of performed dosing steps and/or the number of dosing steps still possible without refilling the syringe is determined and indicated by means of the indicating equipment, after performing the maximum number of dosing steps possible without refilling the syringe, either the syringe is detached from the pipette, or the previous steps are performed anew by means of the same syringe, wherein in the dosing step, the overall performed number of dosing steps with the syringe with the set dosing step size is counted, and/or the number of dosing steps still possible without refilling the syringe is determined and indicated by means of the indicating equipment.
US10906031B2	Intra-crystalline binary catalysts and uses thereof The present disclosure describes, inter alia, binary catalyst compositions including a (metal) zeolite having a crystal lattice that incorporates a metal oxide, wherein the metal oxide is covalently bound to elements within the crystal lattice. The metal oxide forms an integral part of the (metal) zeolite crystal lattice, forming covalent bonds with at least the Si or Al atoms within the crystal lattice of the (metal) zeolite, and is dispersed throughout the (metal) zeolite crystal lattice. The metal oxide can substitute atoms within the crystal lattice of the (metal) zeolite.
US10906030B2	Process for preparing a catalyst based on IZM-2 from a solution comprising specific precursors and use for the isomerization of paraffinic feedstocks The present invention relates to a process for preparing a difunctional catalyst using a zeolite IZM-2, a hydrogenating function and a matrix. The preparation process according to the invention simultaneously allows preferential localization of said hydrogenating function on the surface and/or in the microporosity of zeolite IZM-2 and homogeneous distribution of the hydrogenating function in the catalyst and preferably on zeolite IZM-2 by means of using an impregnation solution comprising specific noble metal precursors combined with the presence of ammonium salts, with a quite precise ratio of ammonium salt to noble metal.
US10906025B2	Gold-based catalyst for oxidative esterification of aldehydes to carboxylic acid esters The present invention relates to novel catalysts for oxidative esterification, by means of which, for example, (meth)acrolein can be converted to methyl (meth)acrylate. The catalysts of the invention are especially notable for high mechanical and chemical stability even over very long periods. This especially relates to an improvement in the catalyst service life, activity and selectivity over prior art catalysts which lose activity and/or selectivity relatively quickly in continuous operation in media having even a small water content.
US10906023B2	Production of metal-organic frameworks An apparatus for producing metal organic frameworks, comprising: a tubular flow reactor comprising a tubular body into which, in use, precursor compounds which form the metal organic framework are fed and flow, said tubular body including at least one annular loop.
US10906017B2	Solar thermochemical reactor and methods of manufacture and use thereof Disclosed herein is a solar reactor comprising a reactor member; an aperture for receiving solar radiation, the aperture being disposed in a plane on a wall of the reactor member, where the plane is oriented at any angle other than parallel relative to the centerline of the reactor member; a plurality of absorber tubes, wherein the absorber tubes are oriented such that their respective centerlines are at an angle other than 90° relative to the centerline of the reactor member; and wherein the aperture has a hydraulic diameter that is from 0.2 to 4 times a hydraulic diameter of at least one absorber tube in the plurality of absorber tubes; and a reactive material, the reactive material being disposed in the plurality of absorber tubes.
US10906013B2	Gas canister connector with insertion limiter A connector for connecting a gas canister to a carbonation machine includes holding structure with a threaded socket that is configured to hold an exteriorly threaded valve head that is screwed into the socket to enable operation of a gas release mechanism of the carbonation machine to release a gas from the gas canister. A rotatable projection extends distally from the holding structure and that is configured to engage cooperating structure on the gas canister. When the valve head is fully inserted into the socket, a gasket in the socket is sufficiently compressed to prevent escape of the gas between the valve head and the socket when the gas is released from the gas canister compression while overtightening damage to the gasket is prevented.
US10906012B2	Process for making membranes Process for making membranes M comprising the following steps: a) providing a dope solution D comprising at least one polymer P and at least one solvent S, b) adding at least one coagulant C to said dope solution D to coagulate said at least one polymer P from said dope solution D to obtain a membrane M, wherein said at least one solvent S comprises more than 50% by weight of at least one compound according to formula (I) (I), wherein R1 and R2 are independently C1 to C20 alkyl, R3 is selected from H or an aliphatic rest, 20 R4 is selected from H or an aliphatic rest, AO represents at least one alkylene oxide, n is a number from 0 to 100.
US10906009B2	Method for manufacturing gas separation membrane A method for producing a gas separation membrane, including the following steps: step (a): treating the surfaces of silica nanoparticles dispersed in a first solvent with a reactive functional group-containing compound, while nanoparticles are being dispersed in the solvent, to thereby prepare a first solvent dispersion of reactive functional group-modified silica nanoparticles; step (b): replacing the first solvent dispersion's dispersion medium of reactive functional group-modified silica nanoparticles prepared in step (a) with a second solvent without drying of dispersion medium, and then reacting functional group-modified silica nanoparticles with dendrimer-forming monomer or hyperbranched polymer-forming monomer in the second solvent's presence so that dendrimer or hyperbranched polymer is added to reactive functional group, to thereby prepare dendrimer- or hyperbranched polymer-bound silica nanoparticles; step (c): mixing dendrimer- or hyperbranched polymer-bound silica nanoparticles prepared in step (b) with a matrix resin; and step (d): applying mixture prepared in step (c) to a substrate, and then removing the solvent.
US10906006B2	Homogeneous fiber reinforced PVDF hollow fiber membrane and preparation method thereof A homogeneous fiber reinforced PVDF hollow fiber membrane and a preparation method thereof are provided. The membrane includes a hollow tubular reinforcement made of PVDF fibers and a polymer separation layer made of PVDF casting solution; wherein the polymer separation layer casting solution comprises 4-25% PVDF resin, 5-20% pore-forming agent, 0-3% inorganic particles and 52-91% solvent according to mass fraction. The preparation method includes steps of: (1) preparing a hollow tubular reinforcement made of PVDF fibers; (2) preparing a PVDF polymer separation layer casting solution; and (3) obtaining the homogeneous fiber reinforced PVDF hollow fiber membrane.
US10905999B2	Methods for separating isotopes from a sample of fission products Systems and methods for efficient, effective, and safe separation and isolation of multiple isotopes (e.g., Mo, Zr, Ba, Sr, Te, and lanthanide isotopes) from fission products includes use of a plurality of chromatography columns, each containing a chromatographic resin formulated to target one or more particular isotopes. The system is operable in a “series” configuration to load the multiple columns by a single pass of the sample. Then, the system may be transitioned (e.g., using valves) to a “parallel” configuration in which multiple columns of the system may be operated simultaneously to elute targeted isotopes. Additional parallel operations of the columns, using different eluent compositions, may be used to elute different targeted isotopes. The system may be reconditioned in preparation for a subsequent sample.
US10905998B2	Process and apparatus to remove carbon-14 from carbon-dioxide in atmospheric gases and agricultural products grown in controlled environments This invention relates to a process and apparatus for growing agricultural products with a reduced abundance of radioactive carbon-14 (14C) by employing centrifugal separation of atmospheric gases to selectively remove carbon dioxide (CO2) with 14C. Agricultural products with reduced 14C content can be grown in controlled environments with filtered atmospheric gases for the benefit of reducing harmful damage to human DNA that is unavoidable with our current food chain, due to the natural abundance of 14C in atmospheric gases. Bilateral and unilateral compression helikon vortex apparatus provide efficient and economical removal of CO2 with 14C from atmospheric gases with a single filtration pass, which is ideally suited for large scale agricultural production.
US10905997B2	Moisture separation system A moisture removal system for removing moisture from a gas is disclosed including a water absorption vessel with a microemulsion. The system also includes a gas-liquid phase separator in fluid communication with a water absorption vessel gas outlet, a gas outlet for conditioned air in fluid communication with a conditioned space, and a liquid outlet. An optional heat exchanger heats used microemulsion from the water absorption for water desorption in a water desorption vessel. An optional microemulsion regenerator provides thermal regeneration of microemulsion from the water desorption vessel for returning regenerated microemulsion to the water absorption vessel.
US10905996B2	Systems and methods to manage heat in an integrated oil and gas processing plant with sour gas injection Disclosed are systems and methods for producing oil and gas while removing hydrogen sulfide from fluids produced from oil and gas reservoirs. Hydrogen sulfide-selective membranes are used to remove hydrogen sulfide from bottlenecked plant process steps including hydrogen sulfide removal. In some embodiments of the present disclosure, plant processing efficiency is improved for processing of high temperature associated gas streams by using membranes while integrating heat from other existing process streams. In other embodiments of the present disclosure, plant processing efficiency is improved for processing of high temperature associated gas streams by using high temperature tolerant polymer membranes. Oil and/or gas production is increased.
US10905995B2	Method for producing biomethane by purifying biogas from non-hazardous waste storage facilities and facility for implementing the method A method for producing biomethane by purifying biogas from non-hazardous waste storage facilities involves compressing the initial gas flow, introducing the gas flow to be purified into at least one adsorber loaded with adsorbents capable of reversibly adsorbing the VOCs, and subjecting the VOC-depleted gas flow to at least one membrane separation step in order to partially separate the CO2 and O2 from the gas flow. The method also involves introducing the retentate from the membrane separation step into at least one adsorber loaded with adsorbents capable of reversibly adsorbing the major portion of the remaining CO2, subjecting the CO2-depleted gas flow exiting the adsorber loaded with adsorbents capable of reversibly adsorbing the major portion of the remaining CO2 to a cryogenic separation step in a distillation column in order to separate the O2 and N2 from the gas flow, and recovering the CH4-rich flow from the cryogenic separation step.
US10905991B2	Adsorbent breather for enclosure protection An adsorbent breather assembly for filtering contaminants such as particulars and vapor phase contaminants, e.g. volatile organic compounds, for use with electronic devices can include a blocking region adjacent to the adsorbent filter layer to improve filtering performance.
US10905990B2	Nonwoven filtration media including microfibrillated cellulose fibers A nonwoven filtration medium that includes a fibrous base media including synthetic and/or natural fibers and microfibrillated cellulose fibers.
US10905984B2	Method and apparatus for improved solid-liquid filtration of filter cakes The invention is related to a method and vibratory apparatus for the improved solid-liquid filtration of filter cakes, especially for dewatering finely divided thixotropic filter cakes, with the aid of a vibratory apparatus. Further, the invention relates to a filtration apparatus having a vibratory apparatus as described herein, and to the use of the vibratory apparatus for the solid-liquid filtration of filter cakes.
US10905982B2	Water filter A filter arrangement includes: a chamber including a chamber inlet for unfiltered liquid, a chamber outlet for filtered liquid and a wall arranged to keep the unfiltered liquid and the filtered liquid separated, a filter element having a longitudinal extension arranged inside of the chamber, wherein the filter element includes a semi-permeable filtration wall including a folded filter arranged in a zig-zag configuration between an inner perforated cylinder and an outer perforated cylinder and an internally located back-washing arrangement. The back-washing arrangement includes: an elongated and hollow body having a longitudinal extension, which is substantially parallel to the longitudinal extension of the filter element, a mechanism configured to drive the body in a rotational and/or an axial movement, a plurality of nozzles arranged in fluid communication with a cavity inside of the body, the plurality of nozzles projecting laterally from the body such that a distal end of each of the plurality of nozzles is arranged in close proximity to the inner perforated cylinder and an outlet arranged in fluid communication with the cavity of the elongated and hollow body and wherein the plurality of nozzles are arranged parallel to each other along a straight line on the body such that they all project in the same direction.
US10905979B2	Portable filtration apparatus, systems and methods Methods, apparatuses and systems for treating liquid utilizing primary and secondary treatment mechanisms positioned on a portable sled, the primary treatment mechanism of the system being a filter bag used in conjunction with a secondary treatment mechanism including a straw bale layer positioned on a base of the sled. Liquid entering the filter bag exits the bag as filtrate which passes through the secondary treatment mechanism and flows by gravity to the environment. The system is transportable to different locations where filtering may continue utilizing the same filter bag. The filter bag is flexible and removable via a porous lift frame positioned below the filter bag.
US10905973B2	Device for processing a liquid under vacuum pressure A device for processing of a liquid that includes a device-input for receiving the liquid to be processed at an input-pressure, a device-output for returning the processed liquid at an output-pressure, a process chamber having a chamber-inlet and a chamber-outlet with the chamber-inlet being connected to the device-input via a feed-line, and the chamber-outlet being connected to the device-output via a discharge-line. The feed-line includes a pump for increasing the pressure of the liquid from the input-pressure to a feed-pressure at the chamber-inlet, and the discharge-line includes a back-pressure mechanism adapted to maintain a discharge-pressure at the chamber-outlet upstream of the back-pressure mechanism at an excess-pressure above the output-pressure, and to reduce the pressure of the liquid from the discharge-pressure to the output-pressure downstream of the back-pressure mechanism. The pump in the feed-line is a first stage of a multiple-stage gear pump. The back-pressure mechanism in the discharge-line is a second stage of the multiple-stage gear pump. The second stage is mechanically coupled to the first stage.
US10905970B2	Scent blending One embodiment of the present disclosure may take the form of a method of dispersing scents in congruity with entertainment. Multiple scents are dispersed into the environment surrounding a participant at various points in congruity with visual entertainment. The scents are selectively provided at various times to coincide with the display of one or more elements in the entertainment experience such as a location or character. One embodiment of the present disclosure may take the form of a system for blending scents. The system includes an airflow source, a plurality of scent distributors, and a controller operably coupled to the airflow source and plurality of scent distributors to selectively control delivery of the scents from the plurality of scent distributors to bulk airflow delivered to a participant environment.
US10905969B2	Book with integral mechanical sound producing component The present invention relates to children's books and, more particularly, to a book with a mechanical sound producing component that is integral to the book. The book includes at least one page having a page frame component and a movable page component that is movable with respect to the page frame component. A movable sound producing component is attached with one or both of the page frame component and the movable page component, such that the movable sound producing component is positioned between the page frame component and the movable page component. The movable sound producing component is movable with respect to the page frame component, such that movement of the movable sound producing component causes the movable sound producing component to movably engage with one or both of the page frame component and the movable page component to create a mechanically produced sound.
US10905968B2	Bubble generating apparatus A bubble generating apparatus includes an air flow generator, a liquid tray defined by a floor and sidewalls and having one or more bubble forming ports therein, and a pivot arm coupled to a motor for pivoting the pivot arm about an axis so that during pivoting a bubble generating member of the pivot arm passes over one of the bubble forming ports, the air flow generator positioned to direct an air stream through the one or more bubble forming ports, and a gravity feed liquid reservoir, wherein the liquid tray is configured to generate bubbles from the liquid when the air flow generator directs the air stream through the one or more bubble forming ports while the pivot arm pivots about the axis.
US10905967B1	Component based system for assembling geometric structures An assembly structured to form a customizable, variably configured geometric structure, which includes a plurality of hubs each having an interior chamber and a plurality of housings. Each housing includes an open ended interior channel communicating with the interior chamber of a common hub. A plurality of elastic links are each retained within and extend outwardly from a different one of said interior channels, wherein at least one elastic link of each hub is retained within a housing and connected to one other of said plurality of hubs. A predetermined number of the plurality of hubs may be disposed in interconnected relation to one another to define a closed, continuously configured array of hubs. A plurality of the closed, continuously configured array of hubs may be disposed in interconnected relation to one another to define one of a possible plurality of the customizable, variably configured geometric structures.
US10905960B2	Game system, terminal device and program An in-terminal display device causes at least one first icon to appear and displays the at least one first icon in at least one of a plurality of areas. An in-terminal input device receives an operation of switching areas and an operation of selecting a first icon. An in-terminal controller or an in-server controller controls a game corresponding to a selected first icon such that the game can be played when any one of first icons is selected in a switched area. The in-terminal controller of the in-server controller limits the number of first icons to be caused to appear to an upper limit value or less.
US10905959B2	System and method for creating an avatar An avatar or avatar environment to visualize data may be provided within a social networking system or service, for example as part of the Internet, and/or within a desktop widget, panel, gadget, or the like. The avatar may further evolve or alter its appearance, animation, or other visual or audio characteristics in response to the data or other input such as athletic activity performed by a corresponding user. In particular, the avatar of an embodiment may respond to and provide visualization of athletic or sport performance data.
US10905953B2	Method of controlling information processing device, information processing device and non-transitory computer-readable recording medium storing program for information processing A method of controlling an information processing device related to a content platform including transmitting content information relating to content to a user's terminal device, receiving action information relating to actions transmitted from one or more other users' terminal devices with respect to a content situation of the content from a distribution information processing device related to a distribution platform that is configured to distribute the content situation that progresses on the user's terminal device to the one or more other users' terminal devices, and associating benefit information relating to the content with the user in a case where the action satisfies conditions on the basis of the action information may be provided. Also provided is a device and a non-transitory computer-readable recording medium storing a program for performing the method.
US10905952B2	Information processing apparatus, information displaying method and information processing system providing multiple sharing modes in interactive application processing A game image being played by a user A is shared with a user C. A mode setting unit sets one sharing mode from between at least two sharing modes. The first mode is a mode in which a game image is shared while the user C does not have a control right of a game, and the second mode is a mode in which the control right of the game is passed to a user B in place of the user A. The third mode is a mode in which both of the user A and the user C have the control right of the game. The mode setting unit sets one mode from among the modes.
US10905950B2	Head-mounted display tracking A virtual reality (VR) head-mounted display (HMD), a computer-implemented method, and a VR tracking system are described. Generally, a VR HMD includes an inertial measurement unit (IMU) and an optical sensor. When a second VR HMD is located in a same physical environment, the VR HMD can be operated to track a motion of the second VR HMD in the physical environment. For example, image data captured by the VR HMD in addition to inertial data of both VR HMDs are used to determine a three dimensional (3D) physical position of the second VR HMD and to track the 3D physical position over time. Three degrees of freedom (DOF) or six DOF for the motion are derived from the tracking.
US10905948B1	Game controller for hand-held electronic devices having a touch screen display A game controller for use with a hand-held electronic device having a touch screen display, such as a smart phone or tablet, for more comfortably and easily playing a video game on the electronic device. The game controller has one or more control assemblies that define a securing mechanism for securing the electronic device in the game controller. In a preferred configuration, the securing mechanism clamps against the sides of the electronic device. Each control assembly has one or more screen engaging mechanisms that are configured to contact the touch screen display. The screen engaging mechanisms include a trigger that is mechanically connected to a stylus having a capacitive tip. The user can rapidly and repeatedly press the trigger to drive the tip against the touch screen display to control the game and/or one or more game objects thereof. The game controller can include one or more user handles.
US10905946B2	Continuous controller calibration A method including determining a range of values for a proximity sensor, receiving proximity data from the proximity sensor, decaying a limit associated with a maximum value, decaying a limit associated with a minimum value, determining a range of values detected by the proximity sensor, and determining an updated scale factor for the proximity sensor.
US10905943B2	Systems and methods for reducing hops associated with a head mounted system Systems and methods for reducing hops associated with a head mounted display are described. The head mounted display includes a communications circuit for receiving and transmitting interactive media associated with a game program via a network. The interactive media is processed by the game cloud system and streamed directly to the communications circuit of the head mounted display. The head mounted display further includes a user input circuit for receiving an action from a user to generate an input, which includes position and motion detected by the user input circuit. The head mounted display includes a game processing circuit for decoding the interactive media received from the network. The game processing circuit drives a portion of interactivity associated with the game program. The portion of interactivity is generated based on the input.
US10905935B2	Breakaway device for mouthguard A breakaway device for a mouthguard is provided, having a lanyard assembly couplable to a mouthguard assembly. The lanyard assembly includes a mouthguard tether couplable to the mouthguard assembly, and a neck tether that can be worn around a user's neck. The lanyard assembly also includes front and rear breakaway connectors, such that when a tensile force is exerted on the mouthguard tether or the neck tether, one or both of the breakaway connectors detaches before the mouthguard tether or neck tether separates.
US10905933B2	Predictive golf aid The invention provides a golf improvement aid having a plurality of inputs, a golf improvement aid having at least one input for receiving inputted data of a real game of golf of a user, a collator for receiving and automatically collating the input from the input means on a plurality of holes in the game of golf; a determinator for determining a model for the particular user based on the collated input for a plurality of holes in one or more games of golf of the user; and one or more outputs for outputting results or information based on results from the determined model.
US10905932B2	Track-runner pacing system with moving light A system for pacing a runner around a running track at a predetermined pace with a moving visual light cue. The system has at least one light strip that is positioned in sight of at least one running lane of a running track, and the light strip has a plurality of light elements that can be sequentially lighted to make it appear as if a single light source is moving along the track at predetermined pace. There is a controller for the light strip that tracks the position of a runner on the running track and selectively light one or more of the plurality of light elements of the light strip in a sequence to have the runner attempt to keep a specific pace. The controller can be dynamically updateable by the runner, and multiple systems can be used to track the runners.
US10905931B2	Ball bat with stitched composite layers A barrel of a ball bat may include a composite laminate with a plurality of composite plies. One or more translaminar elements may pass through the composite plies and around a circumference of the barrel to reduce relative movement between the plies. The translaminar elements may include a first line of stitching, which may include aramid fiber. In some embodiments, the first line of stitching forms two or more coils around the barrel. Lines of stitching may be positioned on opposing sides of a center of percussion of the ball bat. In some embodiments, the translaminar elements may include a line of staples distributed around the circumference of the barrel. A method of making a ball bat may include arranging plies of composite material to form a cylinder, passing a first translaminar element through the plies, and curing the assembly of plies to form a barrel of the ball bat.
US10905928B2	Putter-type golf club head with alignment feature A putter-type golf club head that, when oriented in a reference position, includes a blade portion having a striking face, a top line, and a sole, the striking face in turn including a face center. The club head further includes a rear portion in communication with, and rearward of, the blade portion, and it includes an alignment element rearward of, and recessed toward the sole from, the top line. The alignment element defines a virtual center line segment oriented in a substantially front-to-rear direction at a height between 19 mm and 24 mm from a lowermost point of the sole, the center line segment having a length no less than 34 mm and being not spaced more than 10 mm from a virtual vertical plane passing through the face center and extending generally perpendicular to the striking face. A width of the club head is no less than 3.0 in.
US10905925B2	Club heads having reinforced club head faces and related methods A golf club head includes face element having a face surface, a rear surface, and a reinforcement device with a reinforcement element that extends out from the rear surface of the face element toward a rear end and away from a front end of a golf club head. The reinforcement element includes a looped rib having an outer perimeter surface and an inner perimeter surface. The face surface is nearer to the rear surface proximal to the face center than proximal to the face perimeter. The outer perimeter surface of the reinforcement element is filleted with the rear surface.
US10905919B2	Ball and method for its manufacture Described are balls, in particular a football, and a method for its manufacture. The ball comprises particles of an expanded material. As examples, the particles are connected, at least partially, to each other by radio frequency welding and/or infrared welding. As examples, the ball has a first layer of the particles of the expanded material, wherein the first layer is provided as an outer shell.
US10905918B2	Golf ball A golf ball having a core and a cover that is formed of a resin composition which includes (A) a polyurethane or a polyurea and (B) a styrenic resin material, when dropped from a height of 3 m and made to collide with a metal plate, has velocities 200 ms before and 200 ms after contact that satisfy the condition: (incident velocity)−(rebound velocity)≥0.80 m/s. The ball has a good controllability on approach shots without a loss in the distance achieved on shots with a driver, and thus is particularly useful to professional golfers and skilled amateurs.
US10905917B2	Methods for applying polyurethane coatings to golf balls having a thermoplastic polyurethane cover and resulting golf balls Golf balls having covers made of thermoplastic polyurethane compositions are provided. Multi-piece golf balls can be made. Polyurethane primer coatings and polyurethane top-coatings are applied to the thermoplastic polyurethane cover. Different coating methods can be used. Isocyanate-rich and polyol-rich polyurethane coatings can be applied. In one embodiment, the golf ball can be treated with a multi-functional isocyanate prior to applying the coatings. The polyurethane cover composition and surface coatings can further include catalysts, ultraviolet (UV)-light stabilizers, and other additives. Heat is used to cure the coatings. The coating methods have many benefits and the finished balls have good physical properties.
US10905909B2	CPVC sprinkler assembly with support member A sprinkler assembly that includes a deflector assembly that translates with respect to the sprinkler frame upon actuation of the sprinkler from an unactuated state. The sprinkler frame includes a support member having an annular member spaced from the outlet to limit or control the axial translation of the deflector assembly relative to the outlet. Moreover, the annular member includes a region to support a closure assembly and thermally responsive trigger assembly under a fluid static load. A cover plate assembly includes a flexible annular wall to allow the cover plate assembly to be pushed on and held about the annular member of the sprinkler frame.
US10905908B2	Dome-based cyclic inert sealing system for external floating roof tank and QHSE storage and transport method thereof A dome-based cyclic inert sealing system for an external floating roof tank includes the external floating roof tank, a dome structure, an inert sealing pipeline, and a gas source servo device; wherein the dome structure is formed by a top portion of a tank wall of the external floating roof tank for sealing; the dome structure together with an internal wall of the external floating roof tank, a floating plate and a sealing device form a gas phase space which is isolated from atmosphere, so as to fill the gas phase space with an inert sealing medium; the inert sealing medium is a gas fire-fighting medium used in a suffocation fire-fighting method; the gas source servo device is connected to the gas phase space through the inert sealing pipeline and communicates through a valve for feedback-controlling states of the inert sealing medium in the gas phase space.
US10905906B2	Breathing mask for aircraft and method for putting a breathing mask in folded position for storage in a storage unit Breathing mask comprising a shell and a harness, wherein: the breathing mask also comprises a folding system adapted to make the harness move from an extended position to a folded position, the folding system also comprises a pulling device and a guide device, the pulling device has a connecting portion connected to the harness and a gripping portion, the guide device is connected to the shell, the pulling device is free to move between a first position and a second position, and the guide device cooperates with the pulling device to guide the pulling device between the extended position and the folded position.
US10905901B2	Ultrasound device for precise tissue sealing and blade-less cutting An electrosurgical instrument for sealing and cutting tissue is provided. The instrument includes a housing having a plurality of transducers included therein and a waveguide coupled to and extending from the housing. An end effector assembly disposed at a distal end of the waveguide includes a pair of opposing jaw members, where at least one of the jaw members includes a transducer. The transducer is configured to receive an acoustic signal from the plurality of transducers in the housing.
US10905899B2	Applicators suitable for brachytherapy and methods using same The invention provides a two-step tapered applicator, which can be used to deliver high-dose-rate vaginal brachytherapy to a female patient's vagina post-hysterectomy. In certain embodiments, once inserted through the female patient's vaginal opening (or introitus), the applicator of the invention causes less physical discomfort to the female patient than currently available applicators. In other embodiments, the applicator is used in a female patient whose vaginal apex is larger in diameter than her vaginal introitus.
US10905894B2	Therapeutic bioelectromagnetic fields, pain relief devices, and related methods A pain relief device is provided. The pain relief device includes: (i) a body portion including a contact region configured for contacting a subject; and (ii) a monopolar transmitter including a single electrical pole for providing an electrical signal to the body portion for treatment of the subject.
US10905893B2	Method of controlling defibrillator with function of analyzing electrocardiogram, and defibrillator A method of controlling a defibrillator with a function of analyzing an electrocardiogram, includes: dividing an electrocardiogram of a patient into a plurality of analysis zones; executing analysis of the electrocardiogram in each of the divided analysis zones; based on a result of the analysis of the electrocardiogram in each of the analysis zones, executing determination whether electric shock on the patient is necessary or not, and calculating reliability of the determination; and based on a combination of the determination and the reliability, instructing a first procedure to be performed on the patient.
US10905891B2	Portable automated external defibrillator A portable automated external defibrillator includes a body and an accessory. The body includes a sub power source, a main controller, and a cable winding unit inside the body, an operation button on a front surface of the body, a main electrode pad on a rear surface of the body, and a plug on a side of the body and to which a cable wound on the cable winding unit is coupled. The accessory includes a main power source and a sub-controller inside the accessory, a sub-electrode pad on a rear surface of the accessory, and an outlet on a side of the accessory. The portable automated external defibrillator may prevent a cable of the electrode pad from being twisted or broken, and stably perform an electric shock by the main power source kept in an inactive state during carrying and which is activated in use.
US10905886B2	Implantable medical device for deployment across the atrioventricular septum An implantable medical device (IMD) may be configured for deployment at a patient's atrioventricular septum in order to sense and/or pace a patient's heart. The atrioventricular septum of the patient's heart may have an atrial facing side defining part of the right atrium of the patient's heart and a ventricle facing side defining part of the left ventricle of the patient's heart. The IMD may include a first component configured to be positioned at least in part in the right atrium of the patient's heart proximate the atrioventricular septum, and a second component configured to be positioned at least in part in the left ventricle.
US10905885B2	Cardiac defibrillation A cardiac defibrillation system that includes a pulse generator to generate therapeutic electrical pulses and at least one lead inserted through an intercostal space in the region of a cardiac notch of the left lung of a patient, the lead having a distal end configured to transmit the therapeutic electrical pulses generated by the pulse generator to defibrillate the heart of the patient.
US10905881B2	Spinal cord stimulator system An implantable pulse generator (IPG) that generates spinal cord stimulation signals for a human body has a programmable signal generator that can generate the signals based on stored signal parameters without any intervention from a processor that controls the overall operation of the IPG. While the signal generator is generating the signals the processor can be in a standby mode to substantially save battery power.
US10905877B2	System and method for the regeneration of at least one severed nerve conduit A system for regeneration of at least one severed nerve conduit, configured for use in a living human or animal body. The at least one nerve conduit comprises at least one motor nerve conduction part and at least one sensory nerve conduction part. The system comprises: a motion device, configured for moving a body part of the human or animal body, for containing at least one skeletal muscle that is otherwise innervatable with the at least one severed nerve conduit, a signal generator, which generates a first electrical stimulation signal and a second electrical stimulation signal, including an evaluation and control, which controls the motion device and the signal generator to be coordinated with one another.
US10905876B2	Electrical stimulation control circuit and control method thereof An electrical stimulation control circuit including a pulse generator, a processing circuit and an electrode is provided. The pulse generator is configured to generate a switching signal. The processing circuit generates an energy signal according to the switching signal. The electrode is configured to contact the skin of a living body and includes a first comb electrode and a second comb electrode. The first comb electrode receives the energy signal and includes a plurality of first electrodes. The first electrodes are electrically connected to each other and extended along a first direction. The second comb electrode receives a ground signal and includes a plurality of second electrodes. The second electrodes are electrically connected to each other and extended along a second direction opposite to the first direction. The first electrodes and the second electrodes are arranged in a staggered manner and electrically insulated from each other.
US10905875B2	Electrical treatment of hydrocephalus A method is provided that includes implanting a first electrode at a first site in a brain of a subject suffering from hydrocephalus, and a second electrode at a second site in the subject. The hydrocephalus is treated by electroosmotically driving fluid out of the first site, by applying a treatment voltage between the first and the second electrodes.
US10905872B2	Implantable medical device with a movable electrode biased toward an extended position An IMD may include a housing with a controller and a power supply disposed within the housing. A distal electrode may be supported by a distal electrode support that biases the distal electrode toward an extended position in which the distal electrode extends distally from the distal end of the housing and allows the distal electrode to move proximally relative to the extended position in response to an axial force applied to the distal electrode in the proximal direction. In some cases, the distal electrode support may include a tissue ingrowth inhibiting outer sleeve that extends along the length of the distal electrode support and is configured to shorten when the distal electrode moves proximally relative to the extended position and to lengthen when the distal electrode moves back distally toward the extended position in order to accommodate movement of the distal electrode.
US10905864B2	Levelling device for positioning of a medical device A levelling device for positioning of a medical device in relation to a patient is disclosed. The levelling device comprises a tube having fluid communication between a first end and a second end, wherein the first end is configured for connection to the medical device and the second end is configured for connection to the patient. The levelling device comprises a control unit connected to a sensor, wherein the sensor is configured to transmit sensor data to the control unit which is indicative of a pressure difference between the first and second end of the tube, and an actuator connected to the control unit, wherein the actuator is configured to connect to the medical device and to arrange a position of the medical device in relation to the patient in dependence on said pressure difference.
US10905860B2	Vascular occlusion balloon catheter The vascular occlusion balloon catheter has a balloon, a main lumen, and a balloon expanding lumen. The balloon catheter has an air discharge passage. The air discharge passage has a distal end opening located at a position distal from the balloon and a proximal end communicating with an inner portion of the balloon. The distal end opening of the air discharge passage is positioned inside a portion disposed proximally from a distal end of the balloon catheter. The air discharge passage communicates with the main lumen at the distal end opening of the air discharge passage. The area of a cross section of the air discharge passage orthogonal to an axial direction of the balloon catheter is set to 200 μm2 to 450 μm2. The length of the air discharge passage is set to 1.0 to 3.0 mm.
US10905858B2	Safety needle system operable with a medical device A safety needle system operable with a medical device includes: a housing with a needle mount having a needle; and a sheath telescopically engaged with the housing and surrounding the needle such that the sheath operates in a retracted position, in which the sheath exposes the needle, and an extended position, in which the sheath surrounds the needle. The sheath is coupleable to the medical device such that removal of the needle from the medical device draws the sheath over the needle, transitioning the sheath from the retracted position to the extended position. The system can include a slider engaged with the sheath and/or housing and including a restraint that engages and disengages the sheath to respectively reinforce and weaken the coupling of the sheath and medical device. The sheath can include a longitudinal track that slidingly engages a setting of the housing between sheath positions.
US10905857B2	Intravenous catheter apparatus The invention relates to an intravenous catheter apparatus comprising a catheter hub arranged at a proximal end of a catheter tube, the catheter hub having an inner surface defining a chamber; a needle having a needle tip at its distal end and extending through the chamber and the catheter tube when in a ready position; and a needle guard slidably arranged on the needle and received in the chamber when the needle is in its ready position, wherein the needle guard is configured to guard the needle tip upon withdrawal of the needle from the catheter hub.
US10905855B2	Elongated surgical manipulator with body position and distal force sensing An elongated surgical manipulator apparatus and method of operating enables determination of the shape of a flexible portion of the elongated surgical manipulator and/or the location of an arbitrary point thereon, as well as a measure of a contact force exerted on a distal portion of the manipulator. A plurality of fiber optics are operatively coupled with the manipulator, each of the fiber optics including a plurality of fiber Bragg gratings for determination of the shape and/or position. Each of the fiber optics further includes a fiber optic strain gauge such as a Bragg grating or a Fabry-Perot resonator at a distal portion of the elongated surgical manipulator that is isolated from the strain associated with the bending of the manipulator. The fiber optic strain gauges at the distal portion may thus be used to detect a force vector (magnitude and direction) imposed on the distal portion.
US10905845B2	Breathing apparatus detection and purging Described are methods for safer nitric oxide delivery, as well as apparatuses for performing these methods. The methods may include detecting the presence or absence of a nasal cannula, and stopping the delivery of nitric oxide or providing an alert if the cannula is disconnected. The methods may also include purging the nasal cannula if it is reconnected after a disconnection or if it is replaced by a new cannula. Other methods pertain to automatic purging of the delivery conduit if the elapsed time between successive deliveries of therapeutic gas exceeds a predetermined period of time.
US10905844B2	Metering valve for a metered dose inhaler An improved aerosol dispensing apparatus includes an aerosol container, a discharge piece movably mounted to the aerosol container, a flow control valve mounted within the discharge piece, a battery, and an electronically controlled metering valve electronically connected to the battery and in fluid communication with the flow control valve. The flow control valve is movable between an open position wherein a volume of an aerosol formulation is directed from the aerosol container through the flow control valve to the metering valve, and a closed position, wherein the metering valve is configured to precisely control a flow of the aerosol formulation outward of the discharge piece. A solenoid is electronically connected to the battery and is movable between an actuated position wherein the solenoid urges the flow control valve into the open position, and an un-actuated position wherein the flow control valve remains in the closed position.
US10905838B2	Ventilator with error detection for flow sensors The present artificial respiration ventilator (10) comprises, inter alia, a flow sensor arrangement (44, 48) for quantitatively detecting a gas flow in a breathing line arrangement (30), comprising a distal flow sensor (48) located farther from the patient end of the ventilation line arrangement (30). and a proximal flow sensor (44) located closer to the patient end of the ventilation line arrangement (30), and has a control device (18) at least for processing measurement signals of the flow sensor arrangement (44, 48), wherein the control device (18) is designed for error detection based on the measurement signals of the distal (48) and/or the proximal sensor (44). According to the invention, the control device (18) is designed to detect an error of the flow sensor arrangement (44, 48) on the basis of a comparison of a change value (62, 76) of a measurement signal (54, 58, 68, 72) of the one flow sensor (44) with a change value (60, 74) of a measurement signal (52, 56, 66, 70) of the respective other flow sensor (48) or/and with a measurement signal (54, 58, 68, 72) of the one flow sensor (44).
US10905828B2	Administration apparatus design system, administration system, administration apparatus design method, administration apparatus design program, and medical apparatus design system Provided is a system for calculating design specifications of an administration apparatus which administers an administration object substance to an object region using a high-energy substance as a driving source. An object administration apparatus to be an object of calculation of the design specifications is specified and substance information related to a prescribed administration object substance to be administered in the object administration apparatus is acquired. Region information related to a prescribed object region is acquired, and distribution information related to a distribution state of the prescribed administration object substance is acquired. In addition, based on the respective pieces of acquired information, design specification information related to a configuration of the object administration apparatus including energy information related to a high-energy substance to be used to administer the prescribed administration object substance is calculated. Accordingly, convenience of the administration apparatus is improved.
US10905827B2	Injection device with cammed ram assembly An exemplary embodiment of injector includes a trigger mechanism, an energy source, and a user-operable firing-initiation member. The trigger member can include a trigger member having a retainer portion, and a ram assembly having a ram configured to pressurize a medicament container for expelling a medicament therefrom and a trigger engagement member configured to engage the retainer portion of the trigger member in a pre-firing condition. The energy source can be associated with the ram for powering the ram to expel the medicament, and the user-operable firing-initiation member can be operable for causing an axial rotation between the trigger engagement member and the retainer portion from the pre-firing condition to a firing condition in which the trigger engagement member is released from the retainer portion to allow the energy source to fire the ram.
US10905822B2	Fluid delivery apparatus having a gas extraction device and method of use A gas extraction device for a fluid delivery apparatus includes a first layer and a vent membrane coupled to the first layer. The vent membrane enables a gas to pass through the vent membrane and prevents a fluid from passing through the vent membrane. The gas extraction device also includes a second layer coupled to the vent membrane opposite the first layer. The second layer has a first channel formed therethrough. In addition, the gas extraction device includes an impermeable membrane coupled to the second layer opposite the vent membrane. The first channel is configured to receive a fluid having a gas dispersed therein. The fluid is pressurized to move the fluid through the first channel against the vent membrane and to move the gas through the vent membrane.
US10905821B2	Capacitor detection for IV pump tube calibration A system and method for calibrating an IV pump infusion system tube comprises a fluid source, an infusion system comprising, an IV pump, a drive unit, a chamber with known constant volume, a control unit, and IV tubing with a known inner diameter tolerance, and a set of conductive plates. The system administers medicinal fluid, calculates the flow rate of the medicinal fluid in the chamber by measuring the time the capacitance level of the medicinal fluid changes from a capacitance level corresponding to a first (initial) position to a capacitance level corresponding to a second (filled) position, compares the calculated flow rate with a set flow rate of the IV pump input in the control unit prior to infusion, and adjusts the IV pump and flow rate based on the compared deviations for more accurate delivery to a patient. This configuration may therefore provide a more precise delivery rate.
US10905820B2	Balloon dilation catheter system for treatment and irrigation of the sinuses A medical device for the treatment and irrigation of a sinus opening is described. The device allows for single-handed operation to access, dilate and irrigate a sinus opening. The device includes a sinus guide catheter, a guiding element, a balloon dilation catheter, a balloon catheter movement mechanism and a guiding element movement mechanism. A method for treating a sinus opening and irrigating a sinus is also described.
US10905819B2	Systems and methods for automated recovery of white blood cells after producing a leuko-reduced blood product The present disclosure relates to systems and methods for the separation of blood into blood products and, more particularly, to systems and methods that permit automated recovery of white blood cells after producing a leukocyte-reduced blood product.
US10905814B2	Video-based upgrade of dialysis machines A medical device, such as a hemodialysis device or a peritoneal dialysis device includes a computation device, may be configured with an image-based support system, a method and/or a computer program for generating displayed instructional information for operation of the medical device. The computation device accesses a graphic memory on which instructional information is stored in a structured format having separately addressable sequences. An identification signal identifies individual sequences for dynamic display based on control data.
US10905812B2	Heating apparatus for heating dialysis liquid, dialysis liquid tube set, set, medical apparatus and methods A heating apparatus for heating a dialysis liquid includes a receiving section for receiving a heating bag through which dialysis liquid to be heated can flow, and a sensor system for determining or monitoring the deformation or the position of the heating bag in the receiving section of the heating apparatus or both. A dialysis liquid tube set, a set, a medical apparatus and a method are also described.
US10905810B2	TETS recharged patient alert system for LVAD patients A medical implant information reporting device and method of charging the same, the reporting device having an integrated harvesting coil configured to couple energy from an electromagnetic field of a source coil to induce current in the harvesting coil, are provided. According to one aspect, a method includes electrically coupling the harvesting coil to the source coil to charge the medical implant information reporting device, the source coil being sized to be removably disposed one of on and around the torso of a patient and configured to inductively power a medical implant about which the medical implant information reporting device reports.
US10905809B2	Method for operating a pump device and a pump device A method may be provided for the operation of a pump device, which comprises at least one pump as well as a suction element which is connected to the at least one pump and which has a suction opening positioned in a cavity of a body of a patient that sucks a fluid by way of producing a reduced pressure in the suction element, wherein an acceleration is measured and monitored during the operation of the pump device, wherein the reduced pressure in the suction element is reduced at least for a limited reaction time period, given the occurrence of an acceleration variable which lies above a fixed threshold valve. A correspondingly configured pump device may be provided.
US10905808B2	Drive cable for use with a blood pump Apparatus and methods are described including placing a blood pump into a subject's body, the blood pump including an axial shaft, an impeller disposed on the axial shaft, and a drive cable extending from outside the subject's body to the axial shaft. The impeller is driven to pump blood from a distal end of the impeller to a proximal end of the impeller by imparting rotational motion to the impeller via the drive cable, in a given direction of rotation. At least a portion of the drive cable includes a plurality of wires disposed in a coiled configuration that is such that, in response to the drive cable rotating in the given direction of rotation, the plurality of wires disposed in the coiled configuration at least partially unwind, such that the portion of the drive cable shortens axially. Other applications are also described.
US10905807B2	High efficiency blood pump Blood pumps discussed herein may be suitable for use as a ventricular assist device (VAD) or the like. The blood pumps cause minimal blood damage, are energy efficient, and can be powered by implanted batteries for extended periods of time. Further, these pumps are also beneficial because they may improve the quality of life of a patient with a VAD by reducing restrictions on the patient's lifestyle. The blood pumps can provide radial and axial stability to a rotating impeller that is driven by a separate rotor. Both radial and axial stability can be provided, at least in part, by one or more permanent magnetic couplings between the rotor and the impeller and/or one or more permanent magnetic bearings between the pump housing and the impeller.
US10905804B2	Aspirator flow path designs and related geometric structures In part, the disclosure relates to an aspirator having a handle that includes a suction connector extending from a proximal end face, a substantially cylindrical sleeve mount having an outer surface and a shoulder. A tubular member defining a bore and having flared end disposed in a suction head having one or more cantilevered protuberances can extend from the sleeve mount. The substantially cylindrical sleeve mount is in relief with respect to the shoulder and extends distally therefrom. The substantially cylindrical sleeve mount defines an aperture. The suction connector bore, bore of tubular member, inner cavity of handle and suction head bore define a fluid flow path or cavity. The aspirator can include a sleeve that receives the suction head. The sleeve engages and interferes with the sleeve mount. The suction head and sleeve's inner wall have one or more engineered clearances between them to enhance assembly.
US10905802B2	Lubricious medical device coating with low particulates Embodiments of the invention include lubricious medical device coatings. In an embodiment the invention includes a coating for a medical device including a first layer comprising polyvinylpyrrolidone derivatized with a photoreactive group; and a first cross-linking agent comprising at least two photoreactive groups; a second layer disposed on the first layer comprising polyvinylpyrrolidone derivatized with a photoreactive group; a second cross-linking agent comprising at least two photoreactive groups; and a polymer comprising polyacrylamide, the polymer derivatized with at least one photoreactive group. Other embodiments are included herein.
US10905800B1	Ocular covering and method of use An ocular covering fabricated from at least one amniotic membrane, at least one chorionic membrane, or at least one amniotic membrane and at least one chorionic membrane obtained from human birth tissue is provided. Methods of preparing the one or more membranes to form an ocular covering are provided. Methods of treating a disease, condition, or surgical site of the eye and surrounding tissue are also provided.
US10905795B2	Autonomously growing implantable device An implantable, autonomously growing medical device is disclosed. The device may have an outer, braided outer element that holds an inner core. Degradation and/or softening of the inner core permits the outer element to elongate, allowing the device to grow with surrounding tissue. The growth profile of the medical device can be controlled by altering the shape/material/cure conditions of the inner core, as well as the geometry of the outer element.
US10905792B2	Fibrinogen-based tissue adhesive patch An improved fibrinogen-based tissue sealing patch having a degradation time of less than two weeks is disclosed. The patch comprises a polyethylene glycol-caprolactone-lactide (PEG-CL-LA) triblock copolymer film in which the PEG-CL-LA units are preferably connected by urethane linkages and into a surface of which a fibrinogen-based sealant comprising less than 8 mg/cm2 fibrinogen and less than 10 IU/cm2 thrombin has been incorporated. In preferred embodiments, the polymer film comprises PEG having a molecular weight of between 3000 and 3500 and a CL:LA:PEG ratio of 34:2:1. Methods of production and use of the patch are also disclosed.
US10905790B1	SARS-CoV-2 combination air purifier and decontamination and bioburden reduction system for surgical masks/respirators The present invention in an embodiment relates generally to an air purifier having an ultraviolet wave chamber which is accessible from the exterior designed for the placement of masks/respirators in need of decontamination. Such device preferably makes use of filters comprising copper foam.
US10905789B2	Fan diffuser An oil fan diffuser having a housing with a first section and a second section. A power source such as a plurality of batteries are disposed within the second section. Disposed within the first section is a fan, an inner housing, a fragrance emitting member, a retaining member, and an inverted fragrance bottle.
US10905786B2	Sterilisation method Embodiments of the present disclosure relate to systems and methods for the application of vaporized chemicals in the sterilization of medical products. For example, embodiments of the present disclosure may relate to systems and methods for the terminal sterilization of medical products using vaporized hydrogen peroxide (VHP). Embodiments of the present disclosure may relate to, e.g., systems and methods for the terminal sterilization of medical products, such as pre-filled syringes (PFS).
US10905785B2	System and method for disinfecting a conduit This disclosure relates to a system and method for disinfecting a conduit, such as a conduit for use in a continuous positive airway pressure (CPAP) system. An example system according to this disclosure includes a sheath a probe magnetically suspended within the sheath. The probe includes an ultraviolet light source configured to emit ultraviolet light. Further, the probe is spaced-apart from an inner dimension of the sheath to allow a conduit to pass between the probe and the sheath.
US10905783B2	Glucosamine and derivatives thereof in imaging Provided are formulations including a contrast agent selected from glucosamine, a salt thereof and a glucosamine derivative, for use in imaging.
US10905782B2	Compositions for enhancing transport of molecules into cells Compositions and methods for enhancing delivery of molecules, e.g. biological agents, into cells are described. The composition is a conjugate of the biological agent, preferably a nucleic acid analog having a substantially uncharged backbone, covalently linked to a peptide transporter moiety as described. Conjugation of the peptide transporter to a substantially uncharged nucleic acid analog, such as a morpholino oligomer, is also shown to enhance binding of the oligomer to its target sequence and enhance antisense activity.
US10905781B2	Reporter platform for real time monitoring of drug efficacy Described herein is a reporter material platform that can be used to directly monitor the drug response in real-time. The reporter material can include an activator element which undergoes a chemical change in response to an immunonological response to a drug, and the chemical change can be detected using a reporter element. The reporter material can include a drug and a reporter element that are physically constrained in a close proximity. The reporter element produces a signal only when the drug induces a direct or indirect physiological change in the tumor or surrounding tissue. The reporter material platform can self-assemble via supramolecular interactions. This reporter material platform can be used to directly monitor the drug response in real-time.
US10905779B2	Methods for screening human blood products comprising plasma using immunocompromised rodent models Methods and compositions are provided for screening candidate compositions for activity with respect to treatment of aging-associated conditions, e.g., cognitive impairment conditions or age-related dementia. Aspects of the methods include administering a human blood product comprising plasma, to an immunocompromised animal, e.g., a mouse or a rat, and measuring the effect of the product on an endpoint, e.g., neurogenesis, locomotor activity, anxiety, spatial memory, and hippocampus-dependent memory.
US10905778B2	Methods and compositions for treating a premature stop codon-mediated disorder Modified tRNAs can be used to express in a mammalian cell a functional gene product encoded by a gene containing a premature stop codon and/or to treat a disease mediated by a premature stop codon.
US10905776B2	Isolation of novel AAV's and uses thereof The invention in some aspects relates to isolated nucleic acids, compositions, and kits useful for identifying adeno-associated viruses in cells. In some aspects, the invention provides kits and methods for producing somatic transgenic animal models using recombinant AAV (rAAV) to an animal having at least one transgene that expresses a small interfering nucleic acid or at least one binding site for a miRNA.
US10905772B2	Method of treating or ameliorating metabolic disorders using GLP-1 receptor agonists conjugated to antagonists for gastric inhibitory peptide receptor (GIPR) Methods of treating metabolic diseases and disorders using a composition comprising an antigen binding protein specific for the GIPR polypeptide conjugated to a GLP-1 receptor agonist are provided. In various embodiments the metabolic disease or disorder is type 2 diabetes, obesity, dyslipidemia, elevated glucose levels, elevated insulin levels and diabetic nephropathy. In certain embodiments the composition comprises an antibody or functional fragment thereof comprising a cysteine at one or more conjugation site(s) wherein the GLP-1 receptor agonist is conjugated to the antibody or functional fragment thereof through the side-chain of the cysteine residue.
US10905766B2	Therapeutic compositions and methods for treatment of muscle wasting diseases mRNA polymer complexes and drug delivery systems are disclosed herein that include a cationic polymer electrostatically complexed to an mRNA molecule that encodes a desired protein. Also disclosed herein are methods of treating as well as methods of slowing the loss of, increasing, and/or maintaining lean muscle mass in a subject, such as using mRNA polymer complexes and drug delivery systems.
US10905763B2	Compositions and methods for treatment of pre-cancerous skin lesions The present disclosure encompasses compositions and methods for the treatment of precancerous skin lesions. Compositions of the invention comprise a cytotoxic agent and a thymic stromal lymphopoietin (TSLP) inducer.
US10905760B2	Chimeric hepatitis D virus antigen and hepatitis B virus pre S1 genes for use alone or in vaccines containing hepatitis B virus genes Disclosed herein are chimeric genes, compositions of chimeric genes, and compositions of polypeptides that are useful for the generation, enhancement, or improvement of an immune response to a target antigen. Some embodiments of the compositions include chimeric genes encoding hepatitis D antigen (HDAg) protein in combination with one or more self-cleavage 2A polypeptides and a preS 1 polypeptide. In certain embodiments the self-cleavage polypeptide is P2A.
US10905758B2	Intranasal vector vaccine against porcine epidemic diarrhea The present invention relates to the field of (vector) vaccines, and especially to a canine distemper virus (CDV) vector comprising a heterologous nucleotide sequence which encodes a porcine epidemic diarrhea virus (PEDV) antigen. Said PEDV antigen is preferably a PEDV spike (S) protein. The viral vector of the present invention is useful for producing an immunogenic composition or vaccine for intranasally immunizing sows, and thereby protecting piglets, suckled by said sows, against the clinical signs associated with a PEDV infection.
US10905757B2	Cross-reactive T cell epitopes of HIV, SIV, and FIV for vaccines in humans and cats The subject invention concerns methods and materials for inducing an immune response in an animal or person against an immunodeficiency virus, such as HIV, SIV, or FIV. In one embodiment, a method of the invention comprises administering one or more antigens and/or immunogens to the person or animal wherein the antigen and/or immunogen comprises one or more evolutionarily conserved epitopes of immunodeficiency viruses. In one embodiment, the epitope is one that is conserved between HIV and SIV, or between HIV and FIV. In another embodiment, the epitope is one that is conserved between HIV, SIV, and FIV.
US10905756B2	Bivalent swine influenza virus vaccine The present invention relates to an immunogenic composition comprising: a) a modified live H3 virus of swine influenza, and b) a modified live H1 virus of swine influenza. Furthermore, the present invention relates to methods for immunizing a subject comprising administering to such subject the immunogenic composition of the present invention. Moreover, the present invention relates to methods of treating or preventing clinical signs caused by swine influenza virus in a subject of need, the method comprising administering to the subject a therapeutically effective amount of an immunogenic composition according to the present invention.
US10905754B2	Factor H binding proteins (fHbp) with altered properties and methods of use thereof Factor H binding proteins that can elicit antibodies that are bactericidal for at least one strain of N. meningitidis, and methods of use of such proteins, are provided.
US10905751B2	Means and methods for active cellular immunotherapy of cancer by using tumor cells killed by high hydrostatic pressure and dendritic cells Disclosed are pharmaceutical compositions for inducing an immune response against tumor cells comprising tumor cells which are made apoptotic by treatment with high hydrostatic pressure and dendritic cells, and methods for producing such compositions.
US10905740B2	Antimicrobial articles produced by additive manufacturing An antibiotic-eluting article for implantation into a mammalian subject, produced by an additive manufacturing process wherein a polymeric material is concurrently deposited with a selected antibiotic. The additive manufacturing process may be a fused deposition modeling process, a selective laser sintering process, a selective heat sintering process, a digital light processing process, or a stereolithography process. The antibiotic-eluting article may be temporary or permanent orthopaedic skeletal component, an orthopaedic articulating joint replacement component, and/or an external hard-shell casing for an implantable device. One or more bone-growth-promoting compositions may be concurrently deposited with the polymeric material. The implantable device may be a cardiac pacemaker, a spinal cord stimulator, a neurostimulation system, an intrathecal drug pump for delivery of medicants into the spinal fluid, and infusion pump for delivery of chemotherapeutics and/or anti-spasmodics, an insulin pump, an osmotic pump, and a heparin pump.

1 2 3 4 5 6 7 8 9 10