最新美国发明专利第2020-07-28期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US10723894B2	Tie layers prepared from particle-containing waterborne suspensions Waterborne suspensions include surface treated silica particles, a water dispersable binder resin, at least one surfactant, and an aqueous solvent. The surface treated silica particles have a mixture of hydrophobic and hydrophilic silane surface treatment agents, where the ratio of hydrophilic silane surface treatment agent to hydrophobic silane surface treatment agent is greater than 1. The waterborne suspensions can be coated and dried to form nanostructured tie layers, especially tie layers to silicone or (meth)acrylate layers.
US10723893B2	Composite structure A composite structure is provided, which includes a support, an active layer wrapping the support, a dendrimer grafted to the active layer through covalent bondings, and a plurality of anti-fouling groups, wherein each of the anti-fouling groups is grafted to terminals of the dendrimer through covalent bondings. The terminals of the dendrimer include amino group, hydroxyl group, or thiol group.
US10723890B2	Curable film-forming sol-gel compositions and anti-glare coated articles formed from them Curable film-forming sol-gel compositions that are essentially free of inorganic oxide particles are provided. The compositions contain: a tetraalkoxysilane; a solvent component; and non-oxide particles, and further contain either i) a mineral acid or ii) an epoxy functional trialkoxysilane and a metal-containing catalyst. Coated articles demonstrating antiglare properties are also provided, comprising: (a) a substrate having at least one surface; and (b) a cured film-forming composition applied thereon, formed from a curable sol-gel composition comprising a silane and non-oxide particles. A method of forming an antiglare coating on a substrate is also provided. The method comprises: (a) applying a curable film-forming sol-gel composition on at least one surface of the substrate to form a coated substrate; and (b) subjecting the coated substrate to thermal conditions for a time sufficient to effect cure of the sol-gel composition and form a coated substrate with a sol-gel network layer having anti-glare properties.
US10723886B2	Self-binding pigment hybrid The present invention relates to a process for preparing self-binding pigment particles comprising the following steps: a) providing an aqueous mineral pigment material suspension; b) providing at least one polymeric binder, wherein the binder comprises at least one modified polysaccharide having a degree of carboxylation in the range of 0.4 to 2.0 and having an intrinsic viscosity in the range of >300 to 500 ml/g, c) mixing the binder of step b) with the aqueous mineral pigment material suspension of step a) and adjusting the solids content of the obtained suspension so that it is >45 to 95 wt.-%, preferably from 45 to 80 wt.-%, based on the total weight of the suspension, and d) grinding the aqueous mineral material suspension of step c).
US10723884B2	Black pigment, method for producing same, pigment dispersion liquid, photosensitive composition and cured product of said photosensitive composition Provided is a black pigment that enables pattern formation of pixel division layer while suppressing generation of development residue. The black pigment comprises (a) a core containing at least one organic black pigment selected from the group consisting of benzodifuranone-based black pigments, perylene-based black pigments, azo-based black pigments, and isomers thereof and (b) a coating layer containing silica and/or a metal oxide and/or a metal hydroxide.
US10723883B2	Spiropyran based composition and application thereof as security tag The present invention discloses the spiropyran compound of formula (I), process for preparation thereof and a composition comprising spiropyran compound of formula (I) on a support, wherein said support selected from polymers such as Poly (ethylene oxide), Polydimethylsiloxane (PDMS), Ethylene propylene diene monomer (EPDM).
US10723876B2	Thermoplastic resin composition and molded article comprising the same A thermoplastic resin composition and a molded article including the same. The thermoplastic resin composition includes about 100 parts by weight of a base resin including about 60 wt % to about 80 wt % of a polycarbonate (PC) resin and about 20 wt % to about 40 wt % of a polyester resin including a repeat unit represented by the following Formula 1 wherein in Formula 1, Ar1 is a substituted or unsubstituted C6 to C18 arylene group and R1 is a C1 to C20 linear alkylene group or a C3 to C20 branched alkylene group; and about 1 part by weight to about 3 parts by weight of a linear (meth)acrylic resin:
US10723873B2	Multistage polymer composition, its method of preparation, its use and composition comprising it The present invention relates to a multistage polymer in form of polymeric particles, its composition and its process of preparation. In particular the present invention it relates to a multistage polymer in form of polymeric particles made by a multistage process while the last stage comprises a polymer with a low molecular weight. More particularly the present invention relates to polymer composition in form of polymeric particles made by a multistage process comprising at least three stages while the last stage comprises a polymer with a low molecular weight, its method of preparation, its use as impact modifier in polymer compositions for composites comprising thermosetting resins or thermoplastic polymers and compositions and articles comprising it.
US10723868B2	Fluoropolymer processing additive, compositions, and methods A polymer composition includes a non-fluorinated, thermoplastic polymer and a minor amount of a fluoropolymer combined with the non-fluorinated polymer. A polymer processing additive composition that includes a fluoropolymer and a polymer processing additive synergist is also disclosed. The fluoropolymer includes diads represented by formula —CF2-CF(R)—CH(R′)—CF(R″)— in a range from about 23 mole percent to about 50 mole percent. Each R is independently —CF3, —Rf, or —ORf, each R′ and R″ are independently H, F, CF3, or —Rf, and each Rf is independently a perfluoroalkyl group having from 1 to 12 carbon atoms and optionally interrupted by one or more —O— groups. A method of reducing melt defects during the extrusion of a polymer is also disclosed.
US10723867B2	Aqueous sealing agent composition for non-aqueous electrolyte batteries An aqueous dispersion which contains a conjugated diene polymer as the main component is contained at a solid content weight of 70 to 97 wt %.
US10723866B2	Rubber composition and pneumatic tire A rubber composition according to an embodiment includes: a rubber component comprising diene rubber; and fine particles which are formed of a specific polymer and have a glass transition point of −70° C. to 0° C. The fine particles are fine particles formed of a (meth)acrylate polymer having a constitutional unit represented by formula (1) or formed of a polymer having a constitutional unit represented by formula (4). In formula (1), R1 represents a hydrogen atom or a methyl group, and R2 represents an alkyl group having 4 to 18 carbon atoms. In formula (4), at least one of R11, R12, R13, R14, R15, and R16 represents an aliphatic hydrocarbon group having 3 to 8 carbon atoms, and the remainder represents a hydrogen atom or an aliphatic hydrocarbon group having 1 or 2 carbon atoms.
US10723857B1	Polyimide aerogels with reduced shrinkage from isothermal aging A polyimide aerogel and method of making the aerogel is disclosed. The polymer backbone of the aerogel includes a cardo-diamine. The disclosed polyimide aerogel is less susceptible to temperature induced shrinkage than a polyimide aerogel that does not include a cardo-diamine.
US10723856B2	Etchant for use in rapid formation of robust porous polymers A trifluoroacetic acid-based etchant is described that can remove a sacrificial component of a multi-component polymer, e.g., a self-assembled block copolymer. The etchant can operate at a high etch rate and with excellent selectivity. The etchant can remove a hydrolysable sacrificial component such as a polylactide block from a self-assembled block copolymer. The etchant enables the macroscopic preservation of the nanostructure morphologies of self-assembled copolymers (e.g., poly(styrene-block-lactide) copolymers) and can yield pristine porous films of the non-hydrolysable component of the starting multi-component polymer.
US10723854B2	Formulation of polymeric mixtures for the production of cross-linked expanded PVC foams and process for producing said foams A formulation of polymeric mixtures for the production of cross-linked expanded PVC foams, of the type comprising PVC, isocyanates, anhydrides and one or more nucleating agents, wherein the nucleating agents are composed of nucleating materials having a porosity of 1-100 nm, preferably 2-50 nm. With respect to known formulations for the production of cross-linked PVC foams, a formulation according to the invention offers the advantage of obtaining the desired degrees of stabilization, nucleation and expansion, even without the use of diazocompounds.
US10723849B2	Method for fusing aramid/aramid fibers A method for welding aramid fibers, wherein a) at least one area of an aramid fiber is treated with an ionic liquid so that the aramid is partially dissolved, b) the aramid fiber is contacted via the dissolved area with another aramid fiber area with pressure being applied to the contact area, and subsequently c) the partially dissolved area of the aramid is re-coagulated.
US10723848B2	Masterbatch composition comprising a high concentration of biological entities The present invention relates to a masterbatch composition comprising high concentration of biological entities having a polymer-degrading activity and uses thereof for manufacturing biodegradable plastic articles.
US10723847B2	Coating powdered polymer with a water-soluble dye as an indicator for polymer hydration state A method for determining hydration of a polymer includes mixing a water-soluble, powdered dye with a powdered polymer and introducing the mixed water-soluble, powdered dye and powdered polymer into a water-based fluid. Full hydration of the powdered polymer is determined when the mixed water-soluble, powdered dye, powdered polymer and water-based fluid comprises substantially no internal optical contrast.
US10723839B2	Process for the synthesis of (per)fluoropolyether amines A process for the manufacture of a (per)fluoropolyether amine comprising reacting a sulfonic ester of a (per)fluoropolyether alcohol with an excess of ammonia or organic amine at selected temperature is herein disclosed. The process allows obtaining (per)fluoropolyether amines, in particular primary, secondary and tertiary (per)fluoropolyether amines with high yields and selectivity and can be conveniently applied on an industrial scale.
US10723833B2	Reactive flame retardants for polyurethane and polyisocyanurate foams The present invention provides novel cyclic phosphorus-containing compounds, namely hydroxyl-functional phospholene-1-oxides, serving as highly efficient reactive flame retardants in urethane systems, particularly in flexible polyurethane foams, rigid polyurethane foams and rigid polyisocyanurate foams. The invention further provides fire-retarded polyurethane compositions comprising said hydroxyl-functional phospholene-1-oxides.
US10723830B1	Product-to-product process for preparation of low viscosity polyoxyalkylene polyether polyols This invention relates to a semi-batch process for preparing low viscosity polyoxyalkylene polyether polyols (P) that have a narrow molecular weight distribution. This process comprises reacting a H-functional starter substance (Si), a H-functional starter substance (Sx) and a H-functional starter substance (Sc) with one or more alkylene oxides in the presence of a double metal cyanide (DMC) catalyst. The resultant polyoxyalkylene polyols (P) have a functionality of 2 to 8 and a hydroxyl number of 5 to 35 mg KOH/g polyol. In addition, the polyoxyalkylation can be completed with a low continuous addition of starter (CAOS) cap.
US10723829B2	Product-to-product process for preparation of low viscosity polyoxyalkylene polyols This invention relates to a process for preparing low viscosity polyoxyalkylene polyols (P) that have a narrow molecular weight distribution. This process comprises reacting a H-functional starter substance (Si), a H-functional starter substance (Sx) and a H-functional starter substance (Sc) with one or more alkylene oxides in the presence of a double metal cyanide catalyst. The resultant polyoxyalkylene polyols (P) have a functionality of 2 to 8 and a hydroxyl number of 5 to 35 mg KOH/g polyol.
US10723828B2	Tack-free polyurethane flexible foam Described herein is a process for producing flexible polyurethane foams, in which (a) polyisocyanate prepolymer, is mixed with (b) polymeric compounds having groups reactive toward isocyanates, (c) optionally chain extenders and/or crosslinkers, (d) catalyst, (e) blowing agent comprising water and (f) optionally additives to give a reaction mixture and reacted to give a flexible polyurethane foam.
US10723819B2	Supported catalyst systems and processes for use thereof This invention relates to a supported catalyst system and process for use thereof. In particular, the catalyst system includes bridged hafnium metallocene compound, an unbridged metallocene compound, a support material and an activator. The catalyst system may be used for preparing polyolefins.
US10723817B2	Vinyl modifier composition and processes for utilizing such composition An oxolanyl compound-containing composition comprising specified amounts of the meso-isomer of one or more of the oxolanyl compounds of specified structure is provided. Also provided are methods for the use of such compositions as vinyl content modifiers in polymerization processes.
US10723815B2	Bulk polymerization of silicone-containing copolymers Methods for preparing silicone-containing polymers by essentially adiabatic polymerization methods are disclosed. The polymerization system includes free radically polymerizable monomers. The monomers include ethylenically unsaturated silicone-containing monomers and/or mercapto-functional silicones as well as additional free radically polymerizable monomers. The silicone-containing polymers are useful as adhesives or release materials.
US10723814B2	Tire comprising a rubber composition including a substituted diene elastomer A tire comprising a rubber composition comprising a substituted diene elastomer is provided. The substituted diene elastomer comprises units bearing an A-B radical, in which: A represents an aliphatic C3-C35 radical which can be interrupted by one or more heteroatom(s), and B represents a linear, branched or cyclic C1-C6 hydrocarbon radical. A and B are such that the melting point of the analogue, H-A-B, is less than 70° C., and the substituted diene elastomer comprises from 10% to 40% by weight of the A-B radical, with respect to the total weight of the elastomer. A tread comprising such a rubber composition is also provided.A rubber composition comprising such a substituted diene elastomer and at least one of the following constituents: a second diene elastomer; a reinforcing filler and, if appropriate, a coupling agent is also provided.
US10723811B2	Homogeneous polysaccharide with immunoregulation activity and preparation method thereof The present invention relates to a homogeneous polysaccharide with an immunoregulation activity and a preparation method thereof. The homogeneous polysaccharide with the immunoregulation activity is a single chromatographic peak and has a molecular weight of 6880±50 Da and an optical rotation value of 158.4±0.5°. An infrared spectrum has an α-configuration sugar characteristic absorption peak at 847.6 cm−1. Hydrogen-proton characteristic chemical shifts in hydrogen spectra of the polysaccharide are δ 5.40, 3.95, 3.84 and 3.61. Carbon signal characteristic chemical shifts in carbon spectra are δ 99.6, 76.6, 73.3, 71.5, 71.1 and 60.4. The homogeneous polysaccharide has an effect of enhancing body immunity, can achieve excellent anti-tumor, antiviral and anti-infection effects and the like in regulation of immunity-related diseases, and has potential development values in drug and health care product industries for treatment and prevention of the diseases.
US10723810B2	Process for obtaining inulin from roots of the cardoon plant This invention relates to a new process for obtaining inulin from roots of cardoon plants, that is those belonging to the Cardueae tribe.
US10723806B2	Method of introducing nucleic acid into plant cells The object of the present invention is to provide a method of introducing a nucleic acid into plant cells, which is simple and widely applicable to various types of plant cells and nucleic acids. The present invention relates to a method of introducing a nucleic acid into a target plant cell, comprising a step of forming a complex by bringing a carrier peptide, wherein the carrier peptide comprises a cell-penetrating sequence and a polycationic sequence, into contact with a nucleic acid and a step of bringing the obtained complex into contact with a target plant cell.
US10723787B2	Methods for alleviating symptoms of sporadic amyotrophic lateral sclerosis by neutralizing a HERV-K envelope protein using an anti-HERV-K envelope protein antibody The present invention relates to a novel antibody against HERV-K envelope that targets a conserved region not affected by glycosylation or by native conformation, and its use in diagnostics and/or in therapy.
US10723777B2	Peptide having anti-obesity and anti-diabetes efficacy and use thereof The present disclosure relates to peptides exhibiting an anti-obesity effect by inhibiting fat accumulation and decomposing already accumulated fats as well as an outstanding anti-diabetes effect by effectively lowering blood sugar levels. The peptides that downregulate the expression of the adipogenic markers PPARγ, ACC and/or aP2, upregulate the expression of the lipolytic factors pHSL, AMPK-α1, CGI-58 and/or ATGL, and reduce sizes of adipocyte and levels of cholesterol in blood are described. The excellent activity and stability of the peptides described herein provides advantages in applications such as drugs and quasi-drug products.
US10723775B2	Method for purifying darbepoetin alfa The present invention relates to a method for purifying darbepoetin alfa by selectively separating only a structural isoform having a high content of sialic acid from a mixture of structural isoforms of darbepoetin alfa having various contents of sialic acid. Since the method of the present invention is a novel method for purifying darbepoetin alfa which can be conveniently and simply produced, it is possible to remarkably increase productivity due to process efficiency improvement, as well as to yield high purity darbepoetin alfa when mass-producing darbepoetin alfa according to the present invention.
US10723769B2	Immunoglobulin-binding protein and affinity carrier using same Provided is an affinity chromatography carrier that maintains high immunoglobulin-binding capacity and high alkali resistance. An immunoglobulin-binding protein including at least one modified immunoglobulin-binding domain, the modified immunoglobulin-binding domain being a polypeptide consisting of an amino acid sequence of an immunoglobulin-binding domain selected from the group consisting of the B domain, Z domain, C domain, and variants thereof of Staphylococcus aureus protein A, in which at least one amino acid residue is inserted between positions corresponding to the 3-position and position 4 of the amino acid sequence of the B domain, Z domain or C domain.
US10723759B2	Inhibitors of glucocorticoid receptor The present invention relates generally to compositions and methods for treating cancer and hypercortisolism. Provided herein are substituted steroidal derivative compounds and pharmaceutical compositions comprising said compounds. The subject compounds and compositions are useful for inhibition of glucocorticoid receptors. Furthermore, the subject compounds and compositions are useful for the treatment of cancer.
US10723756B2	Cyclic dinucleotides for treating conditions associated with STING activity such as cancer This disclosure features chemical entities (e.g., a compound that modulates (e.g., agonizes) Stimulator of Interferon Genes (STING), or a pharmaceutically acceptable salt, and/or hydrate, and/or coccrystal, and/or drug combination of the compound) that are useful, e.g., for treating a condition, disease or disorder in which a decrease or increase in STING activity (e.g., a decrease, e.g., a condition, disease or disorder associated with repressed or impaired STING signaling) contributes to the pathology and/or symptoms and/or progression of the condition, disease or disorder (e.g., cancer) in a subject (e.g., a human). This disclosure also features compositions as well as other methods of using and making the same.
US10723752B2	Azithromycin derivatives with epithelial barrier enhancement properties The invention provides novel compounds that are derivatives of Azithromycin and that have been found by the current inventors to have low antimicrobial activity but significant epithelial barrier enhancement properties. The invention further provides use of the compounds as a medicament, in particular in the treatment or prophylaxis of a disease or condition that is caused by a defect in epithelial cells or tissue, or a disease or condition that benefits from enhancement or restoration of epithelial barrier function, for example diseases of the respiratory tract.
US10723751B2	Compositions and methods for treating infectious disease Provided are cyanogenic compositions for treating diseases, such as infectious diseases.
US10723748B2	Monomaleimide-functionalized platinum compounds for cancer therapy The present invention relates to novel monomaleimide-functionalized platinum compounds of formula (I), including in particular novel monomaleimide-functionalized oxaliplatin and carboplatin derivatives, as well as their use as medicaments, particularly for the treatment or prevention of cancer.
US10723744B2	Transplantation therapies Embodiments of the present invention are directed to methods and dosage forms for treating inflammation and rejection in transplantation injuries with Bryostatin-1, Bryostatin-1 analogs and pharmaceutically acceptable salts thereof.
US10723743B2	Kv1.3 inhibitors and their medical application Compounds of formula (II) or a pharmaceutically acceptable salt or solvate thereof, the medical uses thereof for diseases or medical conditions where the inhibition of the voltage-gated potassium channel Kv1.3 is beneficial, and methods for their preparation.
US10723739B2	Processes for the preparation of Ribociclib and intermediates thereof The present invention provides processes for the preparation of Ribociclib, as well as intermediates useful in the preparation thereof. In particular, processes are provided for the preparation of a compound of Formula (4), and its conversion to Ribociclib (1).
US10723737B2	Compositions and methods for treating neurodegenerative diseases and cardiomyopathy Disclosed herein inter alia are compositions and methods useful in the treatment neurodegenerative diseases and cardiomyopathy, and for modulating the activity of PINK1.
US10723735B2	Process for preparing 1-(4-methanesulfonyl-2-trifluoromethyl-benzyl)-2-methyl-1H-pyrrolo [2,3-B]pyridin-3-yl-acetic acid This invention relates to novel processes for synthesizing [1-(4-Methanesulfonyl-2-trifluoromethyl-benzyl)-2-methyl-1H-pyrrolo[2,3-b]pyridin-3-yl]-acetic acid and to intermediates that are used in such processes.
US10723734B2	Biaryl kinase inhibitors The present disclosure is generally directed to compounds which can inhibit AAK1 (adaptor associated kinase 1), compositions comprising such compounds, and methods for inhibiting AAK1.
US10723732B2	Hydroxyphenyl phenanthrolines as polymerizable blockers of high energy light Described are high energy light blocking compounds and ophthalmic devices containing the compounds. In particular, described are hydroxyphenyl phenanthroline structures with polymerizable functionality that block high energy light and are visibly transparent. The hydroxyphenyl phenanthroline structures can be incorporated into ophthalmic devices, such as hydrogel contact lenses, to protect eyes from high energy light radiation.
US10723729B2	BACE1 inhibitors The present invention provides a compound of formula I, having BACE1 inhibitory activity, their manufacture, pharmaceutical compositions containing them and their use as therapeutically active substances. The active compounds of the present invention are useful in the therapeutic and/or prophylactic treatment of e.g. Alzheimer's disease.
US10723725B2	Aminopyridine derivatives as TAM family kinase inhibitors Provided herein are aminopyridine derivatives and pharmaceutical compositions that are useful as TAM family kinase inhibitors.
US10723724B2	Compounds for treating degenerative diseases of central nervous system or brain tumor, and uses thereof The present invention relates to a compound for treating a degenerative disease of central nervous system or a brain tumor, a composition and a use thereof, wherein the compound has the structure of Formula I. These compounds can be used as SGK1 and JNK dual inhibitors with antioxidant effect, which can be formulated into suitable formulations for treating a degenerative disease of central nervous system or a brain tumor.
US10723722B2	Materials for organic electroluminescent devices The present invention relates to materials for organic electroluminescent devices, in particular carbazolyl compounds substituted by electron-deficient heteroaryl groups, for use as triplet matrix materials in organic electroluminescent devices, for example the compounds of formula (1). The invention further relates to a process for preparing the compounds of the invention and to electronic devices comprising these.
US10723718B2	Small molecule inhibitors of shared epitope-calreticulin interactions and methods of use This invention is in the field of medicinal chemistry. In particular, the invention relates to a new class of small-molecules having a triazole-methyl-piperidinyl-pyrolyl-propenone structure which function as modulators of shared epitope (SE)-calreticulin (CRT) binding and/or interaction, and their use as therapeutics for the treatment of immunoregulatory abnormalities (e.g., autoimmune diseases, inflammatory diseases (e.g., chronic inflammatory disease), and bone erosive diseases) by selectively inhibiting SE-CRT interactions and/or signal transduction pathways commonly overactive or dysregulated in arthritic and/or other diseases or conditions.
US10723717B2	Compounds and methods for the targeted degradation of rapidly accelerated fibrosarcoma polypeptides The present disclosure relates to bifunctional compounds, which find utility as modulators of Rapidly Accelerated Fibrosarcoma (RAF, such as c-RAF, A-RAF and/or B-RAF; the target protein). In particular, the present disclosure is directed to bifunctional compounds, which contain on one end a Von Hippel-Lindau, cereblon, Inhibitors of Apotosis Proteins or mouse double-minute homolog 2 ligand which binds to the respective E3 ubiquitin ligase and on the other end a moiety which binds the target protein RAF, such that the target protein is placed in proximity to the ubiquitin ligase to effect degradation (and inhibition) of target protein. The present disclosure exhibits a broad range of pharmacological activities associated with degradation/inhibition of target protein. Diseases or disorders that result from aggregation or accumulation of the target protein, or the constitutive activation of the target protein, are treated or prevented with compounds and compositions of the present disclosure.
US10723714B2	Processes for the preparation of a diarylthiohydantoin compound Disclosed are processes and intermediates for the preparation of compound (X), which is currently being investigated for the treatment of prostate cancer.
US10723707B2	Heterocyclic substituted 2-amino quinazoline derivatives for the treatment of viral infections This invention relates to heterocyclic substituted 2-amino-quinazoline derivatives, processes for their preparation, pharmaceutical compositions, and their use in treating viral infections.
US10723706B2	Perk inhibitors and uses thereof in treating diseases associated with aggregation-prone proteins Compounds represented by Formula I are disclosed herein, wherein R, Ra and R1-R14 are as defined herein. Further disclosed are uses and methods utilizing said compounds for use in inhibiting an activity of PERK, and in treating a disease or disorder associated with aggregation-prone proteins, a disease or disorder in which downregulating an unfolded protein response is beneficial, and/or Huntington's disease.
US10723705B2	Heterocyclic compounds and uses thereof The present disclosure relates to heterocyclic compounds, and pharmaceutical compositions of the same, that are modulators/inhibitors of HDACs, such as HDAC8 and are useful in the treatment of HDAC-associated diseases.
US10723699B2	Cyclohexene derivative, preparation method thereof, and pharmaceutical composition for preventing or treating metabolic disease comprising the same as active ingredient The present invention relates to a cyclohexene derivative, a preparation method thereof, and a pharmaceutical composition for preventing or treating metabolic disease containing the cyclohexene derivative as an active ingredient. The cyclohexene derivative according to the present invention increases the intracellular activity of cyclic adenosine monophosphate (cAMP) by activating G protein-coupled receptor 119 (GPR-119) and simultaneously exhibits weight loss and hypoglycemic effects by inducing the release of glucagon-like peptide-1 (GLP-1), which is a neuroendocrine protein, and thus can be useful as a pharmaceutical composition for preventing or treating metabolic diseases such as obesity, type 1 diabetes, type 2 diabetes, inadequate glucose tolerance, insulin resistance, hyperglycemia, hyperlipidemia, hypertriglyceridemia, hypercholesterolemia, dyslipidemia and syndrome X.
US10723697B2	Preparation method of polythiol for optical lenses by using metal sulfide Provided is a preparation of a thioether-based polythiol in a high purity using a metal monosulfide for the incorporation of a thioether group, wherein the content of such components as a metal polysulfide present in the metal monosulfide is controlled to a predetermined level or lower. As a result, an optical lens of high quality with a high refractive index can be produced using the polythiol.
US10723691B2	Process for preparing salicyloyl-L-carnitine hydrochloride The present invention relates to a process for preparing 3-(2-hydroxybenzoyloxy)-4-(trimethylammonio)butyrobetaine hydrochloride of formula (I), wherein the process comprises reacting 3-hydroxy-4-(trimethylammonio)butyrobetaine or a salt thereof with a 2-alkoxybenzoyl chloride of formula (III), and where R is selected from benzyl and branched C3-C6 alkyl groups. The present invention further relates to compounds of formula (II) and salts thereof, where R is selected from benzyl and branched C3-C6 alkyl groups, and to a process for preparing same.
US10723680B1	Method of producing deuterated haloform The invention relates to methods of producing deuterated haloform, and apparatus for such methods. In an aspect of the invention, there is provided a method to produce deuterated haloform, the method comprising: (a) providing a mixture comprising a compound of formula (I) heavy water, and a catalyst of formula (II), wherein each X in formula (I) is independently a halogen, and R1 is an aliphatic group, or an aryl group, wherein at least one of R2, R3, R4, R5, and R6 is an anionic functional group, a polymer, or a linker attached to a polymer; (b) heating the mixture to displace the trihalocarbon anion; and (c) forming the deuterated haloform.
US10723679B2	Method for producing (Z)-1-chloro-2,3,3-trifluoro-1-propene Provided is a method for producing (Z)-1-chloro-2,3,3-trifluoro-1-propene where (E)-1-chloro-2,3,3-trifluoro-1-propene and water can be efficiently removed and (Z)-1-chloro-2,3,3-trifluoro-1-propene with higher purity can be obtained at a higher recovery ratio. The method for producing (Z)-1-chloro-2,3,3-trifluoro-1-propene includes: distilling a distillation composition which contains (Z)-1-chloro-2,3,3-trifluoro-1-propene, (E)-1-chloro-2,3,3-trifluoro-1-propene and water to remove (E)-1-chloro-2,3,3-trifluoro-1-propene and water as an azeotropic composition or an azeotropic-like composition.
US10723677B2	Zeolitic granular material having a connected structure The present invention relates to a zeolitic granular material having a connected zeolitic structure across the entire volume thereof, having high mechanical resistance to crushing in the bed, and optimised material transfer in the macro-mesopores. The invention also relates to the method for preparing said zeolitic granular material, as well as to the use thereof as an adsorbent material in co-current or counter-current liquid phase separation methods, typically in a simulated mobile bed.
US10723675B2	Process for making xylenes and phenol from coal derived liquids Processes and apparatus for making xylenes and phenol are described. Phenol and alkyl phenols are separated from coal derived liquid. The phenol is separated from the alkyl phenols. The alkyl phenols can be reacted with aromatics such as benzene and toluene to make xylenes. The xylenes and other aromatics are then separated from the phenol and alkyl phenols. Para-xylene is separated and recovered using a xylene separation process, and meta-xylene and ortho-xylene are optionally converted to para-xylene through an isomerization reaction.
US10723674B2	Unsaturated hydrocarbon production method and conjugated diene production method A method for producing a conjugated diene according to an aspect of the present invention comprises a step of contacting a raw material gas containing an alkane with a dehydrogenation catalyst to obtain a product gas containing at least one unsaturated hydrocarbon selected from the group consisting of an olefin and a conjugated diene. In the production method, the dehydrogenation catalyst is a catalyst having a supported metal containing a Group 14 metal element and Pt supported on a support containing Al and a Group 2 metal element; the dehydrogenation catalyst has pores (a) having a pore diameter of 7 nm or more and 32 nm or less; and a proportion of a pore volume of the pores (a) is 65% or more of the total pore volume of the dehydrogenation catalyst.
US10723672B2	Normal alpha olefin synthesis using dehydroformylation or dehydroxymethylation The present invention discloses processes for producing normal alpha olefins, such as 1-hexene, 1-octene, 1-decene, and 1-dodecene in a multistep synthesis scheme from another normal alpha olefin. Also disclosed are reactions for converting aldehydes, primary alcohols, and terminal vicinal diols into normal alpha olefins.
US10723671B2	Method for the preparation of uniform triaminotrinitrobenzene microparticles A new, rapid and inexpensive synthesis method for monodispersed triaminotrinitrobenzene (TATB) microparticles based on micelle-confined precipitation that enables control of microscopic morphology. The morphology of the TATB microparticles can be tuned between quasi-spherical and faceted by controlling the speed of recrystallization. The method enables improved performance and production consistency of TATB explosives for military grade explosives and propellants
US10723669B2	Special film-coated controlled release fertilizer for peanut in high yield field and preparation process thereof The invention relates to the field of controlled release fertilizer technology, and in particular to a special film-coated controlled release fertilizer for peanut in a high yield field, which comprises an outer layer, an intermediate layer and an inner layer, integrates the ingredients for disease and pest control, chemical control, growth promotion and premature senescence prevention, controls the release period, improves the fertilization efficiency without the need of top application throughout the growth period, saves labor cost, and has positive effects on improving peanut yield and quality.
US10723666B2	Method and apparatus for operating a composter device A method for operating a composter device including directing exhaust from a composting container to a reservoir by way of a first fluid pathway, directing ambient air to the reservoir by way of a second fluid pathway, and mixing the exhaust from the first fluid pathway and the ambient air from the second fluid pathway.
US10723665B1	Poultry litter-based fertilizer and a method for making the poultry litter-based fertilizer from poultry litter A method for producing a poultry litter-based fertilizer by a) supplying poultry litter to a rotating rotary drum, b) adding acid or a source of acid to the rotating rotary drum, wherein acid reacts with the poultry litter to form an acidified mixture, c) adding ammonia or a source of ammonia to the rotating rotary drum, d) drying and cooling the ammoniated product by evaporation of water to form a dried, cooled product in a free-flowing semi-solid or solid form, repeating the steps b) through d) until a desired nitrogen content is reached in the dried, cooled product.
US10723661B2	Drying shrinkage reduction method of cement-based hardened body The present invention is to provide an economical and efficient method of reducing drying shrinkage of a cement-based hardened body without requiring the cost and/or the labor and time. A cement-based hardened body is impregnated with a solution containing urea or a solution containing sulfate together with urea. An impregnation treatment may be by a method of coating or spraying the cement-based hardened body with the solution, or alternatively, immersing the cement-based hardened body in the solution containing both urea and sulfate for a predetermined period of time. The solution containing both urea and sulfate may be a solution prepared simply by dissolving both urea and sulfate in water. Besides, there are no particular limitations on a liquid allowing dissolution of both urea and sulfate, so long as it causes no impairment of a drying shrinkage reduction effect, and therefore, a solution having the drying shrinkage reduction effect in itself is also applicable for use of a solution containing both urea and sulfate in a state of being dissolved in such solution.
US10723659B2	Density gradient in blade to reduce centrifugal load A blade for a gas turbine engine, and methods of manufacture of such a blade having a continuous density gradient so that the portion of the blade nearest the rotator shaft is of a higher density than the portion of the blade furthest from the rotator shaft.
US10723658B2	Method of fabricating a ceramic from a chemical reaction A method of fabricating a ceramic material, the method including forming a ceramic material by performing a first chemical reaction at least between a first powder of an intermetallic compound and a reactive gas phase, a liquid phase being present around the grains of the first powder during the first chemical reaction, the liquid gas phase being obtained from a second powder of a metallic compound by melting the second powder or as a result of a second chemical reaction between at least one element of the first powder and at least one metallic element of the second powder, a working temperature being imposed during the formation of the ceramic material, which temperature is low enough to avoid melting the first powder.
US10723655B1	Agglomerate glass surface product and method of manufacture An agglomerate glass surface product may include an agglomerate formed predominantly of glass aggregate having controlled proportions of different glass particle sizes bound by a cured thermoset binder infused within substantially all inter-aggregate voids. The agglomerate may be in the form of a pressed slab that is substantially non-porous and substantially devoid of air inclusions throughout an entire thickness of the slab. The glass aggregate may be substantially uniformly mixed with the thermoset binder throughout the entire thickness of the slab so as to be exposed at all surfaces of the slab. The agglomerate may have an overall aggregate content that is high enough to produce a slab surface that can be polished in the same manner and with the same machinery that natural stone is polished. Advantageously, the slab may have the look and feel of a natural stone slab. A related manufacturing method is also disclosed.
US10723650B2	Optical fiber preform An optical fiber preform includes a silica-glass core portion, and a cladding portion surrounding the core portion, the cladding portion being composed of a fluorine-containing silica glass having a lower refractive index than the core portion, the core portion including a first region that does not include the central axis thereof, the first region containing a first dopant selected from sodium, potassium, and compounds thereof, and a second region that includes the central axis, the second region containing a second dopant that reduces the viscosity of the silica glass, the second dopant having a diffusion coefficient of 1×10−12 cm2/s or more and less than the first dopant at 2,000° C. to 2,300° C., in which the entire core portion has an average first dopant concentration of 10 atomic ppm or more and 2,000 atomic ppm or less and an average second dopant concentration of 10 atomic ppm or more.
US10723649B2	Black lithium silicate glass ceramics A black lithium silicate glass ceramic is provided. The glass ceramic includes lithium silicate as a primary crystal phase and at least one of petalite, β-quartz, β-spodumene, cristobalite, and lithium phosphate as a secondary crystal phase. The glass ceramic is characterized by the color coordinates: L: 20.0 to 40.0, a: −1.0 to 1.0, and b*: −5.0 to 2.0. The glass ceramic may be ion exchanged. Methods for producing the glass ceramic are also provided.
US10723648B2	Glass composition for micro-D connector sealing The present invention relates to a tellurium-oxide-based glass composition for forming a glass-to-metal seal to alloys or metals having a coefficient of thermal expansion higher than 16 ppm/° C., said composition comprising TeO2, ZnO, TiO2 and optionally K2O and being essentially free of lead oxide, sodium oxide and vanadium oxide.In addition it relates to the use of the glass composition according to the invention to form a glass-to-metal seal between copper or a copper alloy and an alloy or a metal having a coefficient of thermal expansion higher than 16 ppm/° C., in particular aluminum alloys.It furthermore relates to a connector comprising a contact made of copper or of copper alloy, an insert and/or shell made of a metal or alloy having a coefficient of thermal expansion higher than 16 ppm/° C. and, by way of glass-to-metal sealant between the contact and the insert and/or shell, a tellurium-oxide-based glass having the composition according to the invention.Lastly, it relates to a process for forming a glass-to-metal seal between a contact made of copper or of copper alloy and an insert and/or shell made of metal or alloy having a coefficient of thermal expansion higher than 16 ppm/° C.
US10723637B2	Liquid treatment apparatus A liquid treatment apparatus including: a tubular treatment tank whose end along a central axis is closed and sectional shape orthogonal to the central axis is a circular shape; a first electrode disposed on one end of the central axis of the treatment tank and having a bar shape; a second electrode disposed on the other end thereof; a power supply applying voltage between the first electrode and the second electrode; a rotation mechanism rotating the first electrode about a central axis of the first electrode; and an air introduction portion introducing the liquid to the one end of the central axis of the treatment tank from a tangential direction of the circular sectional shape of the treatment tank, and causing liquid to swirl about the central axis of the treatment tank therein to generate a gas phase in a swirling flow of the liquid.
US10723632B2	Magnesium sulfate granulates based on synthetic magnesium sulphate Magnesium sulfate granulates contain at least 90 wt. % synthetic magnesium sulphate hydrate with respect to the total mass of the magnesium sulphate granulate, and have a dry loss of less than 2 wt. % determined by drying of the granulate for 2 hours at 105° C. and 1 bar. Further, a method is used for producing said magnesium sulfate granulates and to their use in urea-containing fertilizer compositions.
US10723631B2	Methods of producing composite zeolite catalysts for heavy reformate conversion into xylenes A method of forming composite zeolite catalyst particles includes combining a silicon source, an aqueous organic structure directing agent having a polyquaternary ammonium compound, water and an aluminum source to form a catalyst gel. The method also includes heating the catalyst gel to form the composite zeolite catalyst particle having an intergrowth region with a mixture of both Mordenite crystals and ZSM-5 crystals. An associated method of making xylene includes feeding heavy reformate to a reactor, the reactor containing the composite zeolite catalyst particles, and producing xylene by simultaneously performing dealkylation and transalkylation of the heavy reformate in the reactor, where each composite zeolite catalyst particle is able to catalyze both the dealkylation and transalkylation reactions.
US10723627B2	Production of activated carbon The disclosure provides a system and method for production of activated carbon from a coal-originating particulate feed material. Feed material and activating gas are introduced into a reaction chamber, the activating gas being introduced at a velocity above the average terminal velocity of particles within the feed material. Feed material is then entrained in the activating gas such that a recirculating flow path for the feed material is established within the reaction chamber. Activated material may then be recovered from the chamber.
US10723618B2	Microelectromechanical device with multiple hinges An example microelectromechanical system (MEMS) switch comprises a hinge plane having two or more intersecting hinges; a switch plate; and a plurality of electrostatic pads. Selective activation of the electrostatic pads causes torsion of at least one of the two or more intersecting hinges to tilt the switch plate to a selected one of three or more positions.
US10723616B2	Structures for packaging stress-sensitive micro-electro-mechanical system stacked onto electronic circuit chip A packaged micro-electro-mechanical system (MEMS) device (100) comprises a circuitry chip (101) attached to the pad (110) of a substrate with leads (111), and a MEMS (150) vertically attached to the chip surface by a layer (140) of low modulus silicone compound. On the chip surface, the MEMS device is surrounded by a polyimide ring (130) with a surface phobic to silicone compounds. A dome-shaped glob (160) of cured low modulus silicone material covers the MEMS and the MEMS terminal bonding wire spans (180); the glob is restricted to the chip surface area inside the polyimide ring and has a surface non-adhesive to epoxy-based molding compounds. A package (190) of polymeric molding compound encapsulates the vertical assembly of the glob embedding the MEMS, the circuitry chip, and portions of the substrate; the molding compound is non-adhering to the glob surface yet adhering to all other surfaces.
US10723614B2	Devices with localized strain and stress tuning A device, such as a MEMS device, with stress tuning to achieve a desired stack stress across the wafer. The stress tuning includes trimming a stress compensation layer over a target layer having different stresses in different target layer regions. The trimming may include ion beam trimming to produce a stress compensation layer having different thicknesses over the different target layer regions to balance the stress of the target layer to a desired stress. The desired stress may result in almost zero residual stress to produce an almost flat MEMS device.
US10723613B2	Device for extracting liquid from a container The present application relates to a device for extracting liquid from a container. The device includes: an extracting unit for extracting the liquid from the container; a hose, where one end of the hose is connected to the extracting unit through a penetration hole formed on a container cover of the container; and a fixing block, including a through hole, where the through hole is connected to the other end of the hose; and one or more abutting members, where one end of the abutting member abuts against the container cover, the other end abuts against the fixing block, and the fixing block abuts against the inner bottom of the container with the through hole facing the inner bottom of the container. The fixing block includes a communicating portion formed on its surface that is opposite to a surface to which the hose is connected, and the through hole of the fixing block is in communicating with the fluid in the container through the communicating portion. According to the present invention, the fixing block can be abutted against the bottom of the container, so that the liquid in the container can be fully extracted.
US10723607B2	Electric personnel lift device An electric personnel lift device that includes a base assembly having two columns that are laterally spaced apart. Each of the two columns has a lift cylinder device mounted in the respective column and extending upward. The electric personnel lift device further includes a height adjustable platform assembly having an operator platform and two laterally spaced apart handrail assemblies connected to the operator platform. The height adjustable platform assembly is connected to an upper end of a movable portion of each lift cylinder device and is slidably coupled to the columns, wherein the height adjustable platform assembly is movable between at least a lowered position and a raised position.
US10723606B2	Elevator system for auxiliary power unit An elevator system (400) to assist the installation of a heavy load (122), such as an auxiliary power unit (APU) in into a compartment of an aircraft (110) compartment (126). The elevator system includes bar assemblies which rotate to lift the load into the compartment. The bar assemblies rotate in synchrony.
US10723605B2	Forklift adapter The invention disclosed herein is a forklift adapter comprising multiple metal bars which create a payload carriage and two insertion points for traditional forklift forks. The adapter is capable of transporting payloads over obstacles and of precisely positioning the payload at the specified drop location. The adapter redirects the forklift insertion point such that the insertion point is perpendicular to the adapter bottom supports thereby transferring the support load of the forks from the bottom of the payload to the top of the payload. The adapter allows a forklift to position a payload over railings and reverse away from the payload.
US10723604B2	Compact removable display hoist A removable display hoist includes a first clamp configured to be removably coupled to a first portion of a telescoping support member, a second clamp configured to be removably coupled to a second portion of the telescoping support member, and an actuator assembly coupled between the first clamp and the second clamp, where the actuator assembly is configured to extend and retract the removable display hoist.
US10723603B1	Off-road jack A jack has a lifting post, a pair of side legs, adjustable leg extensions, and leg locking mechanisms for locking the leg extensions with respect to the side legs. The lifting post has a bottom element and a top element that slide with respect to each other, and a vehicle engaging hook mounted on the top element. A lifting mechanism lifts the top element with respect to the bottom element, once the side legs have been adjusted.
US10723602B2	Cable offset detection with contact A hoist system for cable-reeling operations includes a housing; a drum disposed within the housing and configured to spin about an axis; a motor configured to spin the drum about the axis; an electrically-conductive cable configured to be wound and unwound from the drum as the motor spins the drum about the axis; an electrically-grounded sheave configured to guide the electrically-conductive cable through the housing; and an electrical contact sensor configured to detect contact with the electrically-conductive cable.
US10723601B2	Winch and fairlead with a detachable line guide A fairlead for use with a winch is disclosed. The fairlead includes: a self-reversing screw; a motor for driving the self-reversing screw; and a guide comprising a guide nut and a first guide side and a second guide side. The guide is driven by the self-reversing screw. As a line is coiled onto a winch drum the guide directs the line onto the winch drum. The first guide side and second guide side are detachable from the guide nut and from each other.
US10723597B2	Crane and counter ballast carrier plate The present disclosure relates to a mobile work machine, in particular to a crane or to a mobile crane, comprising an undercarriage, a superstructure rotatable with respect to the undercarriage, and a counter ballast carrier plate that can be mounted to the superstructure via a ballast suspension thereof, wherein the counter ballast carrier plate comprises at least one guide pin that can be guided along at least one guide edge of the undercarriage to bring the counter ballast carrier plate into a predefined installation position on the undercarriage.
US10723589B2	Elevator The invention relates to an elevator comprising an elevator control having a motor drive of an elevator motor driving an elevator car on an movement path, which motor drive comprising a frequency converter with a rectifier bridge designed to be connected to mains, a converter bridge for feeding the elevator motor and an intermediate DC circuit located in-between, the elevator further comprising a brake drive for supplying energy to at least two motor brakes with the brake drive being connected to the intermediate DC circuit as well as an emergency power supply battery designed to allow safe release of passengers in case of a power outage. According to the invention the battery is connected to the intermediate DC circuit, and the elevator control has a measuring circuit connected to the intermediate DC circuit and the elevator control has a battery testing module which is configured to apply a defined load to the battery and to measure the voltage of the DC circuit for a defined time period. The battery testing module comprises a comparator for comparing the measured voltage with at least one stored first threshold value, whereby the elevator control is configured to issue a replacement signal for the battery dependent on the signal of the comparator.
US10723586B2	Method for driving a brake device of an elevator system A method for driving an elevator car brake device, an elevator system for executing the method, and a computer program implementing the method involve the brake device including at least one automatically releasable pressure element effecting a braking action and an electromagnet automatically releasing the pressure element, wherein a respectively required braking torque of the car is ascertained using a model of the elevator system, a direction of car travel, a state of load of the car and a desired car deceleration. A drive signal for driving the electromagnet is generated based on the braking torque and is supplied to the electromagnet, wherein, when the car is braked, an actual car deceleration is ascertained and calibration is performed based on the ascertained actual car deceleration, specifically calibration of the ascertained required braking torque or calibration of the drive signal that is generated based on the ascertained required braking torque.
US10723584B2	Method and device for aligning prefabricated cable ends of a cable harness in correct rotational position The present invention relates to a method and a device for aligning prefabricated cable ends (111, 121) of a cable strand (100), twisted in particular, with at least two cables (110, 120) in the correct rotational position, wherein the entire cable strand (100) is rotated by means of a rotary gripping device (30) on a section (101) which is connected to the cable ends and is rotated by means of a rotary gripping device (30) in particular, and each cable (110) that has already been aligned remains secured in its ideal rotational position in a section (112) of its free cable end (111), in particular untwisted, by means of a respective cable grip (10, 20).
US10723582B2	Method and apparatus for folding a product A method and apparatus include directing an article to a receiving device; transferring the leading portion of the article to a folding device; transferring the leading portion of the article to an oscillating device while holding the trailing portion of the article on the receiving device; reversing the oscillating device; folding the article by overlaying the leading portion of the article on the trailing portion of the article to define a folded state while continuing to hold the trailing portion of the article on the receiving device.
US10723576B2	Sheet feeding apparatus A sheet feeding apparatus includes a support member having a support surface, a feed roller rotatable about a rotation axis located below a portion of the support surface, a separation roller disposed downstream from the feed roller, a separator disposed upstream from the separation roller, a stopper, when viewed in a direction of the rotation axis, disposed at least partially overlapping the separator and movable between a first position in which the stopper crosses the support surface and restricts leading edges of the sheets supported on the support surface and a second position, downstream from the first position in a conveying direction, in which the stopper is spaced apart from the support surface, and a restriction member configured to hold the stopper in the first position and to restrict movement of the stopper while continuing to support the stopper moving from the first position to the second position.
US10723575B2	Separation roller, sheet feeding apparatus, and image forming apparatus A separation roller for a sheet feeding apparatus includes an outer circumferential portion formed from an elastic material, a core portion to which the outer circumferential portion is attached; and a flange portion including a plurality of projecting portions each projecting to an outside in a radial direction with respect to the core portion. At least one of the plurality of projecting portions includes a first surface provided on a side portion thereof on an upstream side in a first direction in which the separation roller rotates in such a manner as to follow the rotary feeding member rotating to feed the sheet. The first surface extends more upstream in the first direction at a position further on an outside in a radial direction with respect to a rotation axis of the separation roller as viewed in the axial direction.
US10723573B2	Sheet accommodating device and image forming apparatus including the same A sheet accommodating device includes a first plate member on which sheets are mounted, a first biasing member, a second plate member; and a second biasing member, and has a configuration in which, according to a size of the sheets, the first biasing member presses up the first plate member or both the first and second biasing members press up both the first and second plate members. The first plate member is provided so as to be turnable with respect to the second plate member around a first fulcrum axis line extending along a width direction orthogonal to a sheet feed direction in which the sheets are fed. The second plate member is provided so as to be turnable with respect to a body of the sheet accommodating device around a second fulcrum axis line extending along the width direction.
US10723572B2	Distribution head of a gravimetric loading system for bulk materials A distribution head of a gravimetric loading system for spreadable bulk materials with a rotatably driven spreader plate, which is composed of a bottom side base plate, which is connected in the central region with the one end of a drive shaft and on which a number of blades evenly distributed on the circumference and with their blade edges approximately in a radially outward direction is arranged. The blade edges of blades are interrupted in the direction of the central axial drive shaft and thus a ring channel extending in the axial direction and free from structures is formed, which channel forms an additional filling and receiving space for the bulk material to be distributed.
US10723564B2	Method for moving a rotor, linear drive, and production or packaging machine A method for moving a rotor onto a segment, a linear drive, a production machine, a machine tool, and a packaging machine comprising such a linear drive, wherein the actual speed of the rotor is ascertained using a sensor paired with the segment when the rotor is moved onto the segment, where the actual speed is selected by a control unit as the first target speed for the rotor, and after the target speed has been determined for the rotor, the regulation of the actual speed is activated for the rotor, and where the actual speed of the rotor is then regulated in accordance with a conventional rule, wherein a rule variable is the ascertained actual speed and/or the position of the rotor such that jerking or an undesired acceleration is prevented during transition of the rotor onto the segment.
US10723561B1	Tool-free belt and conveyor component cover and access hood An access hood assembly for a conveyor cover is provided. The access hood assembly embodies a cammed lock assembly at each corner, for easier and safer opening, with no tools required, wherein each cammed lock assembly can act to lock the hood or as a pivot point to pivot about to an open position, when the hood is opened from the opposing side, where the associated cammed lock assemblies have been moved to an unlocked position. The arcuate hood of the access hood assembly supports multiple connection points for each cammed lock assembly to engaged in a locked position for securely keeping the access hood propped open when desired.
US10723559B2	Transport mechanism and method for transporting objects A transport mechanism and a method for transporting objects are disclosed. The transport mechanism includes a transport unit, a vacuum belt conveyor unit, and a push-type transport unit. The vacuum belt conveyor unit receives objects from the transport unit and conveys the received objects to the push-type transport unit. The vacuum belt conveyor unit can generate a vacuum force to adhere the plurality of objects thereon. When the vacuum belt conveyor unit stops conveying the objects carried thereon, the objects adhered to the vacuum belt conveyor unit would block the objects being transported by the transport unit, and when the vacuum belt conveyor unit starts to convey the objects carried thereon to the push-type transport unit, the transport unit would immediately transport more objects to the vacuum belt conveyor unit. Thus, with the vacuum belt conveyor unit, the objects are conveyed to the push-type transport unit and the position of objects is also accurately controlled.
US10723558B2	Snap on slat for a chain conveyor belt and conveyor belt system comprising same A conveyor belt system provides a continuous flat support surface for a food item that moves the food item through a food preparation device. The conveyor belt system includes a conveyor belt having a plurality of spaced apart rods and a plurality of slats that are removably attached to the conveyor belt with a snap on mechanism. The slats are easily assembled and provide enhanced field service and/or replacement capability.
US10723557B2	Conveyor belt A conveyor belt includes a repeating interconnected arrangement of: rods spaced apart in a longitudinal direction and each extending in a lateral direction and connecting links arranged on both ends of the rods. Each link includes a nose section extending in lateral direction and two legs arranged on either side of the nose section, the legs extending in longitudinal direction. The nose section and the two legs provide a U-shaped structure. Laterally aligned first openings are arranged in each of the legs adjacent to the nose section for reception of a rod. Laterally aligned second openings are arranged in each of the legs adjacent the free ends of the legs. The first openings of a first link are aligned with the second openings of a second link for reception of a rod thereinto.
US10723555B2	Robot inventory updates for order routing A method includes maintaining an inventory database for each warehouse of a plurality of warehouses, where a plurality of robots are deployed at each warehouse, where the inventory database for each warehouse is updated based on messages sent by the plurality of robots at the warehouse during performance of tasks by the plurality of robots at the warehouse. The method further includes receiving an order and determining, for each warehouse, a projected availability time for an item that satisfies the order to be available for pickup at the warehouse based on the inventory database for the warehouse. The method additionally includes selecting a warehouse from the plurality of warehouses based on the projected availability time determined for each warehouse. The method further includes causing at least one robot at the selected warehouse to prepare for pickup the item that satisfies the order at the selected warehouse.
US10723548B2	Hygienic interactive system for sanitary material The present invention relates to a hygienic interactive system for sanitary material comprising a dispenser having at least three drawers, at least three buttons corresponding to the aforementioned three drawers, and a display screen; and, a disposal feature having at least two compartments and at least one sensor located on the top compartment The sensor being connected with the display screen and with drawers of the dispenser. The disposal additionally comprises at least three compartments containing an incinerating compartment.
US10723545B2	Specialized container for the storing of granulated raw materials and operations support base The present invention corresponds to materials storage devices; specifically to a specialized container for the storing of granulated raw materials and its operations support base; which has been created in response to the need of storing granulated raw materials, preferably silica meant to be used in, preferably but not limited to, petroleum wells; and which is fitted with specific modifications that facilitate both the loading and discharge of said raw materials in a shorter time lapse than that displayed by conventional technologies. The invention's preferred configuration contemplates the setting up of three containers on top of the operations support base.
US10723543B2	Metered valve for dispensing product The present device dispenses product from a pressurized container. The device has a metered valve that dispenses a predetermined fixed quantity of product upon actuation. The metered valve can be configured by the customer with a spacer to affect the amount of product continually metered.
US10723540B2	Beverage can holder A thermally insulated holder for beverage cans includes a cylindrical sleeve and a retaining ring that couples to the upper end of the sleeve. A beverage can fits into the sleeve with the upper portion of the can extending above the sleeve. The retaining ring has a circular opening in its upper wall that engages the shoulder of the can to clamp the can in place. The retaining ring has a side wall that extends outward of the sleeve and down over the upper end of the sleeve. The lower edge of the retaining ring side wall defines a ledge. A user can grasp the sleeve with one or more fingers in contact with the ledge to provide a more comfortable and secure grip.
US10723539B2	Insulated shipping container for works of art The invention is directed to a shipping container 1 for transporting works of art 2 comprising an enclosing section 3 obtained by injection moulding and a cover section 7 obtained by injection moulding, retaining means 9 to secure the cover section 7 to the wall sections of the enclosing section 3. The retaining means 9 are not present on at least one wall section 10. The one wall section 10 is not provided with retaining means 9 and is provided with one or more support strips 11 along the length of the side wall 10. The interior of the flat rectangular wall segment and the four wall sections of the enclosing section and at the interior of the cover section a vacuum insulation panel 26 is positioned comprising an air tight envelope and one or more layers of an aerogel core.
US10723537B2	Cartridge pump A cartridge pump according to the present invention includes: a housing unit connected to a container; a head unit rotatably provided in the housing unit; a storage unit provided in the head unit and having a storage space in which contents are stored; and a mixing operator configured to lead the contents in the storage unit into the container in cooperation with an operation of the head unit.
US10723533B2	Conveyable sortation bag A method of sorting a first subset of items in an order handling center, wherein at least a majority of the items of the first subset are sized below a predetermined size limit. The method includes directing the first subset of the items through an opening into a bag having a plurality of panels of flexible material coupled together at a plurality of seams. The method includes causing the bag to assume a substantially cuboid shape as the bag is filled to capacity with the first subset of items and stacking the bag on a pallet at a staging destination within the order handling center. The staging destination is associated with a delivery route from the order handling center.
US10723529B2	Determining use and validity of vehicles through acoustic emissions Arrangements are provided for “smart” functionality with “dumb” containers, such as for determining medication adherence, tracking product use, and validating product authenticity. An acoustic emitter is engaged with a container or other vehicle. Opening the container causes the acoustic emitter to produce an acoustic emission, without requiring power, processing capacity, or sensors. A cell phone or other station receives and registers acoustic emissions, such as by logging opening of the container, verifying authenticity of the acoustic emission, communicating with an oversight system, or similar. Data as may be encoded in an acoustic emission may include vehicle detection data (e.g., logging a container being opened), vehicle information (e.g., lot number, contents name), vehicle validation (e.g., valid or counterfeit numerical code), and audible user recognition (e.g., brand jingles, warning sounds).
US10723527B2	Dispensing closures and dispensers A dispensing closure for dispensing fluid product from a squeeze container consists of an outer cap element (3) and an inner element or valve disc (4) fitting inside the cap element. Each is moulded from thermoplastics; no elastomer is used. The cap element includes an outwardly-deflectable diaphragm wall (35) around a central outlet opening (361). The inner element (4) has a peripheral mounting ring (41), a central blocking portion (48) and a set of support spokes (46) providing flow clearance between them. In a closed position the blocking portion closes the outlet opening. In an outflow condition the diaphragm wall (35) deflects outwardly to allow flow. In a recovery mode the blocking portion (48) deflects inwardly for compensation air or residual liquid product to enter the container.
US10723525B2	Wafer container with latching mechanism for large diameter wafers A wafer container with a latch mechanism that provides sealing for large wafer containers, such as for 450 mm wafers, accomplishes secure door closing and latching with reduced torque requirements for rotating the central rotatable cam plate. In various embodiments, a camming slot formed in the rotatable cammed plate is arcuate and defined by opposing cam surfaces which are selectively engaged by a cam follower, such as a roller, attached to a proximal end of a latch arm. The roller can include unitary axle portions that snap into the proximal end of the latch arm and is supported at both axial ends of the roller. The proximal end of the latch arm can include parallel extensions separated by a gap, and have guide in surfaces to deflect the extensions as the axle portions of the roller are forced into position thereby seating the roller at both axial ends.
US10723520B2	Beverage lid cover for enhancing aroma A lid for a beverage cup includes a mouth opening, an aroma opening, and a concentrator member. The mouth opening is positioned closer to a rim of the lid than the aroma opening. An area of the aroma opening is greater than an area of the mouth opening. The concentrator member surrounds the aroma opening and extends from a plane formed by the aroma opening to a height above the aroma opening. A cross sectional area of the concentrator decreases in a direction from a base to an upper end of the concentrator, creating a concentration of beverage aromas in the space surrounding a user's nose. The concentrator channels a concentrated amount of aroma to the nose, providing an enhanced drinking and tasting experience.
US10723519B2	Closure for a package A closure includes a polymeric top wall portion, a polymeric annular skirt portion, a polymeric continuous plug seal and a polymeric top seal. The annular skirt portion depends from the polymeric top wall portion. The annular skirt portion includes an internal thread formation for mating engagement with an external thread formation of a container. The polymeric annular skirt portion includes an interior surface and an exterior surface. The plug seal depends from the polymeric top wall portion. The continuous plug seal is spaced from the interior surface of the polymeric annular skirt portion. The top seal includes sealing gussets integrally connected thereto. The top seal and the sealing gussets depend from the polymeric top wall portion. The top seal and sealing gussets are located between and spaced from the plug seal and the annular skirt portion.
US10723517B2	Stackable molded cap A blending system is shown and described herein. A blending system may include a base An injection molded plastic closure, stackable with similar closures in a known manner to prevent warping during cooling and to increase box storage capacity, is formed with a lead-in taper at the bottom of the closure skirt, maintaining and enhancing the stacking function while greatly reducing and nearly eliminating problems of cross-threading when the closure is screwed onto a container by machinery during a capping operation.
US10723512B2	Coupling system and an article employing same A container comprises a cover member and a receptacle member axially displaceable therewithin for selective axial arresting therewith. A polygonal locking neck of the cover member telescopingly receives a polygonal portion of the receptacle member. A circumcircle of the polygonal portion is smaller than an inscribed circle of the polygonal locking neck. The polygonal portion of the receptacle member can be reciprocated about a longitudinal axis between a locked position at which an arresting member is engaged with locking teeth of the receptacle member, and an unlocked position at which the at least one arresting member is disengaged from the locking teeth of the receptacle member. Twisting of the cover member and the receptacle member at opposite senses results in disengaging the locking teeth of the receptacle member from the at least one arresting member of the cover member, into the unlocked position.
US10723511B2	Multiple Beverage container assembly A multiple beverage container assembly for containing a plurality of beverages includes a first sleeve. A disk is removably coupled to the first sleeve such that the first sleeve and the disk forms a first container for containing a first beverage. A first cap threadably engages the first sleeve to close the first sleeve. The first cap has an aperture extending therethrough and a drinking straw can be extended through the aperture. A second sleeve is removably coupled to the disk such that the second sleeve and the disk forms a second container for discretely containing a second beverage with respect to the first beverage. A second cap threadably engages the second sleeve to close the second sleeve.
US10723507B2	System and method for locking walls of a storage container The present invention discloses a novel apparatus and way for securing components of a shipping container. A locking mechanism is provided having a pin, spur gear and main gear coupled together and controlled by a handle such that rotation of the handle causes rotation of the gears and translation of a locking pin used to secure adjacent components of the container.
US10723505B2	Storage and shipping box A storage and shipping box includes first closing flaps of the exterior of the box that extend from a pair of opposing sides of the upper face of the box and that are capable of being sealed, stapled or glued in order to carry out one or several shipments. The box further includes second closing flaps of the exterior of the box that extend from the other opposing sides of the upper face of the box. The second flaps include a closing element to open and close the box as many times as needed and are capable of being used for the storage of products or for preparing orders before or after carrying out a shipment.
US10723502B2	Modular travel storage system for liquids A modular travel storage system for transporting liquids, gels, and powders, includes: a holder portion with a plurality of container receptors, including left, right, rear, and top walls, with left, right, and rear inner ledges; and a plurality of container pods, each including a container body with left, right and rear protruding rims, and a lid; such that each container pod slides into a corresponding container receptor.
US10723498B2	Vehicle part hole patch applicator arrangement A patch applicator arrangement for securing a patch over a hole in a vehicle part. The arrangement provides a robotic arm having at least one movable joint that allows the robotic arm to move about several axes. At the end of the robotic arm is a spindle that has several spring loaded patch applicators connected. The arrangement also includes a patch dispensing apparatus that the arrangements uses along with the robotic arm to place patches over holes in a vehicle part. The arrangement also provides a verification method to make sure the holes have been properly covered.
US10723496B2	Container closing and opening article, system, and method Methods, articles, and apparatus that provide a dual function closure/opening system that utilizes a tape serving as both a sealing closure and as an opening mechanism. For example, in one embodiment, a single adhesive tape is introduced between a container flap and a container panel and then the container flap and the container panel are pressed together forming a bond between the flap and the panel via the adhesive tape thereby closing the container. In another embodiment, one end of a container includes two overlapping flaps and a single adhesive tape is introduced between the overlap of the two container flaps and then the container flaps are pressed together forming a bond between the flaps via the adhesive tape thereby closing the container. The methods and apparatus disclosed herein are directed to any container with at least one flap that overlaps a side panel of the container or that overlaps another flap.
US10723495B2	Bag opening device for form-fill-seal machines A bag opening device for a form-fill-seal machine includes two coupling modules for being coupled to each side of a bag for opening the bag. The coupling modules are movable with respect to one another between an open position and a closed position by a driving component. The driving component of the coupling modules includes a motor driving the movement of one of the coupling modules and a synchronizing connecting rod synchronizing the movement of the coupling module driven by the motor with the other coupling module. The bag opening device allows a higher form-fill-seal speed than with conventional form-fill-seal machines.
US10723492B2	Depositor apparatus By swinging a collating chute supplied with items, the items are held in a plurality of holding cells formed in a holding array. After all of the holding cells are filled with the items, a diving funnel array is moved downward to a position so as to contact the upper surface of a container. Then, discharge gates of the holding array are opened to discharge the items from the holding cells into a plurality of pockets formed in the container.
US10723486B2	Methods of using positioning fixtures A method of assembling a structure using a fixture is disclosed. The fixture comprises a first portion and a second portion, and the structure comprises an object and a beam that includes a web. The method comprises installing the fixture on the beam by gripping the beam between a first clamping face of the first portion and a second clamping face of the second portion so that a first contact face of the first portion and a second contact face of the second portion abut each other, and the first clamping face and the second clamping face engage the web; positioning the object relative to the beam between a first positioning face of the first portion and a second positioning face of the second portion without gripping the object; and installing a fastener so that the first portion is drawn toward the second portion.
US10723476B2	Ring of turbojet vanes including an acoustic treatment structure A ring of vanes for an aircraft turbine engine, the ring presenting an axial direction and a radial direction and including a first annular sheath presenting an inside surface and a second annular sheath presenting an inside surface facing the first inside surface of the first annular sheath, the first and second sheaths being coaxial and defining between them a flow passage for a gas stream. The ring further includes both partially annular acoustic treatment panels including resonant cavities and also vanes extending in the radial direction between the first and second sheaths. Each vane includes a radial airfoil with at least two attachment tabs at each radial end of the airfoil fastened to the first or second sheath, and the inside surface of at least one of the first and second annular sheaths and the corresponding attachment tabs are covered by acoustic treatment panels arranged between the airfoils.
US10723475B2	Air intake unit for an aircraft engine and provided with an air filter and with an air filter bypass duct An air intake unit for an engine of an aircraft and having: a housing, inside which a plenum is defined, which can be connected to the engine of the aircraft; a main intake opening; an air filter which engages the main intake opening; a bypass intake opening; a shutter device, which is coupled to the bypass intake opening and has two partitions, which are mounted so as to rotate around respective rotation axes parallel to and spaced apart from one another; and an actuator, which moves the shutter device between a closed position and an open position. In the open position of the shutter device, an upper partition is arranged transversely to the wall of the housing and in a central area of the bypass intake opening, and a lower partition is arranged parallel to the wall of the housing and overlaps said wall.
US10723473B2	Method for dynamic command limiting in a distributed control system According to one or more aspects, a control system for managing operational limits associated with two or more actuators includes a controller. The controller may continually monitor a first operational limit associated with a first actuator and a first operational limit associated with a second actuator. The controller may determine a first overall distributed control system operating limit based on the first operational limit associated with the first actuator, the first operational limit associated with the second actuator, and a type of operational limit associated with both operational limits.
US10723464B2	Injector nozzle configuration for swirl anti-icing system An anti-icing system for annular turbofan engine housings what include a substantially closed annular housing at a leading edge of the turbofan engine housing, the annular housing containing a quantity of air and a conduit extending from a source of high pressure hot gas to the annular housing. The system also includes an injector connected to the end of the conduit and extending into the annular housing; one or more nozzles extending outwardly from the injector in a direction that the quantity of air circulates in the annular housing while the turbofan engine is operating. The nozzles have an entrance in fluid contact with the injector and an exit, wherein a cross-sectional area of the entrance is less than a cross-sectional area of the exit such that gas leaving the nozzles is travelling slower than gas entering the nozzles.
US10723460B2	Toilet module attachment assembly and method of use A toilet module attachment assembly that includes a retainer member that is adapted to be secured to a wall. The retainer member includes a wall attachment flange and a press fit portion extending generally inwardly from the wall attachment flange. When the retainer member is secured to a wall a channel is defined between the wall and the press fit portion. The attachment assembly also includes a seal member that includes a bulge portion that is received in the channel of the retainer member.
US10723452B2	Engine systems for rotorcraft A rotorcraft includes at least one first engine operatively connected to a first rotor, and a second engine operatively connected to at least one of a second rotor or an electrical generator for driving an electrical system, wherein the second engine is a different size than the first engine. The second engine can be smaller than the at least one first engine, for example.
US10723449B2	Helicopter using electric propeller torque arm as power source driving main rotor A helicopter uses electric propeller torque arm as power source directly driving main rotor to rotate. The helicopter may be battery powered. The helicopter may be without an engine, a clutch, a reducer, a tail driver, a tail boom, a tail rotor and a fuel supply system. The main design goal is to have the output shaft of the high-energy motor being coaxial with the main rotor shaft or having output shafts of a plurality of motors as close as possible to the main rotor shaft. The centrifugal force of the motor(s) is negligible or minimized. The torque arm assembly includes a plurality of torque arms. Each of the torque arm of the plurality of torque arms includes a propeller and a driving system. In the case of a malfunction, the helicopter's main rotor will spin like a maple leaf and will facilitate the spin autorotation landing.
US10723448B2	Rotor blade weight system A weight system for a rotor blade includes a weight box open in an outboard direction, a weight guide rod connected to the weight box, the weight guide rod extending in a spanwise direction through an interior of the weight box, and a span balance weight disposed within the weight box, the span balance weight being captured between the weight guide rod and the weight box.
US10723445B2	Strake for aircraft propulsion system nacelle An assembly is provided for an aircraft propulsion system. This assembly includes a nacelle exterior skin and a strake. The strake is configured with a base and an airfoil that projects out from the base. The base is recessed into and connected to the nacelle exterior skin.
US10723438B2	System and methods of constructing composite assemblies A composite assembly has an outer spar component having an outer spar component inner profile, an inner spar component having an inner spar component outer profile substantially complementary to the outer spar component inner profile, and an adhesive disposed between the outer spar component and the inner spar component.
US10723437B2	System for structurally integrated thermal management for thin wing aircraft control surface actuators A thermal management system for transferring heat from a heat load includes a first composite structural member that supports a heat load source, a second composite structural member, and a heat transfer member positioned between the first composite structural member and the second composite structural member and in thermal contact with at least the first composite structural member, and in thermal contact with a heat sink. The system further includes at least one thermally-conductive first fastener that is in thermal contact with the heat transfer member, couples the heat load source to at least the first composite structural member, and conducts heat from the heat load source into the heat transfer member. The heat transfer member conducts heat from the thermally-conductive first fastener to the heat sink.
US10723432B2	Method for controlling the fuel consumption of a ship The present invention relates to a method for controlling the fuel consumption of a ship, the ship comprising an engine and a controllable pitch propeller, wherein torque and engine speed are adjusted to correspond to an output set point value. The adjustment is such that the engine is operated in an operating condition with an engine speed and a propeller pitch of the controllable pitch propeller such that the fuel consumption of the ship is brought and/or held within a desired fuel consumption range.
US10723422B2	Photovoltaic array system and method A system and method of providing, assembling and maintaining floating rows and/or arrays of photovoltaic solar panels and terrestrial or elevated based rows and/or arrays of photovoltaic solar panels.
US10723418B2	Edge rails in a surfboard A surfboard having laterally opposed pairs of axial or lengthwise grooves with the pair forming opposed rails of greater stiffness and reduced mass. At least one of the grooves of each pair is at a board edge extremity and the other groove is nearby, preferably near or on the lower side of the surfboard. The grooves may be laid up with epoxy or fiberglass.
US10723417B2	Water ski fin A fin for a slalom water ski includes a planar body with a convex leading edge and a slot proximate such leading edge. The slot has an arcuate front or leading edge and a wavy rear edge defined by alternating crests and troughs or projections which allow the fin to be smaller without compromising its ability to support ski acceleration. The smaller size allows the ski to be turned more easily. A line of small holes extending in a row proximate the leading edge of the fin body can achieve the same result.
US10723415B2	Mooring system for drifting energy converters A system that maintains the relative and/or absolute geographical positions of two or more buoyant devices floating in a body of water. A plurality of formation restoring tethers are disclosed which permit the unrestricted vertical movement of networked buoyant devices, while resisting increases in their lateral separations by providing restoring forces to oppose such separations. Tensioning mechanisms incorporated into the tethers generate the resistance to the lateral separations of two or more entities by transforming such separations into an increase in the potential energy stored within such tensioning mechanisms, the potential energy of which is released in the process of restoring the original separations and/or positions of the displaced buoyant devices.
US10723414B1	Universal sized accessory platform mount attachable to a boat's t-top A universal fit accessory platform mount uses a pair of coextensive base legs with extensions slidably disposed within either end of the base legs. The extensions have tube clamps on a distal end thereof, the clamps attached to the t-top of a boat. Each extension is slid within the base legs so that its tube clamps align with a leg of the boat's t-top and each extension is attached to the t-top via the tube clamps. Once the extensions are attached and the accessory platform that is attached to the base legs is centered, the base legs are locked to the extensions to prevent sliding movement of the extensions with respect to the base legs.
US10723413B2	Bicycle manual control device and bicycle electronic system A bicycle manual control device for issuing at least one electric-electronic command to at least one piece of bicycle equipment, comprising a support body, configured to be fixed to the bicycle, at least one manual actuation member supported in a movable manner by the support body, and on-board electronics having a standby mode and an operating mode, further comprising a detector of movement of the bicycle configured to emit a wake signal to bring said on-board electronics from standby mode to operating mode. A bicycle electronic system including the bicycle manual control device is also disclosed.
US10723410B2	Vehicle A vehicle, comprising: a forward frame portion; a rear frame portion; and a motion control system comprising a first motion control device that movably interconnects the forward frame portion and the rear frame portion and a second motion control device that movably interconnects the forward frame portion and the rear frame portion, wherein the first motion control device connects to the rear frame portion at a first location, and the second motion control device connects to the rear frame portion at a second location that is a fixed distance from the first location, and the motion control system, by virtue of a geometric arrangement of the motion control system relative to the forward frame portion and the rear frame portion, adopts, in response to a forward acceleration of the rear frame portion resulting from a driving force imparted by a wheel supported by the rear frame portion, an operating state in which forces imparted onto the motion control system by a tensioning of a drivetrain element that transfers driving energy from a driving axle supported by the forward frame portion to a driven axle supported by the rear frame portion, the forward acceleration of the rear frame portion, and an acceleration of a user mass supported by the forward frame portion are in equilibrium.
US10723409B2	Method and apparatus for an adjustable damper A vehicle suspension damper is described. The vehicle suspension damper includes: a pilot valve assembly; a primary valve; and an adjuster, wherein the pilot valve assembly meters fluid to the primary valve, and the adjuster moves the primary valve.
US10723408B2	Compression sensitive suspension dampening A spring for a suspension is described. The spring includes: a spring chamber divided into at least a primary portion and a secondary portion, and a fluid flow path coupled with and between the primary portion and the secondary portion. The fluid flow path includes a bypass mechanism, wherein the bypass mechanism is configured for automatically providing resistance within the fluid flow path in response to a compressed condition of the suspension.
US10723407B2	Line fixing element for lines arranged in bicycle frame tubes, bicycle frame tubes, as well as method for arranging and fixing a line in a bicycle frame tube A line fixing element for lines arranged in bicycle frame tubes includes a loop element. The loop element defines an opening width, with the loop element being designed similar to a cable strap. A holding head of the loop element is received by a holding element. The holding element further serves for fixation in a bicycle frame tube, with the loop element being arranged in the frame tube. The line to be fixed is passed through the loop element and fixed by reducing the opening width.
US10723404B2	System for controlling a vehicle fitted with electrical controls A system for controlling a vehicle fitted with electrical controls, the control system includes a handgrip mounted on a shaft and fitted with a position sensor and with a return spring which is fixed by one end to the handgrip so as to generate a return moment that opposes the twisting of the handgrip. The system includes at least one actuator able to move a cam mounted on the shaft and able to: modify the preload of the return spring according to the position of the cam to which the other end of the return spring is fixed, and/or modify the travel of the handgrip by collaborating with an end stop of the handgrip, the end stop coming into contact with a cam at the end of the travel.
US10723403B2	Scooter assembly with auto-balancing drive wheel A scooter front end and a scooter device incorporating the front end. The front end may be releasably coupled to an auto-balancing drive wheel unit such as a Solowheel or Iota device. The scooter front end may serve as a training aid, or allow faster speeds or the carrying of goods, etc. The front end may include an ascending control structure that is used to steer the device. A support frame may extend rearwardly from a steerable wheel and provide a mechanism for releasable coupling to the auto-balancing drive wheel unit. Various embodiments for the scooter front end and drive wheel units are disclosed.
US10723402B2	Device for a bicycle A device 1 for a bicycle, the device comprising: an elongate member 2, the elongate member 2 having a first end 2a arranged to be connected to the handlebar of the bicycle and a second end 2b arranged to extend freely; at least one light source 6 arranged to illuminate at least a part of the elongate member 2; wherein the elongate member 2 is flexibly resilient such that, if a force causes the elongate member 2 to move from a first configuration to a second configuration, the elongate member 2 will return to the first configuration once the force is removed; wherein the elongate member 2 is of a length so as to extend outwardly beyond an end of the handlebar.
US10723393B2	Vehicle lower portion structure A vehicle lower portion structure includes a resinous floor panel constituting a vehicle cabin floor surface, and a metallic reinforcing member. The reinforcing member is disposed to be bridged between vehicle skeleton members on a lower side of the floor panel and is configured to support a vehicle-mounted object disposed on the lower side of the floor panel.
US10723385B2	Vehicle body lower portion structure A vehicle body lower portion structure includes: a lower frame member formed as a chamber that extends in a vehicle body longitudinal direction, having a guide portion at inner surfaces of wall portions that structure the chamber, the lower frame member being disposed at a vehicle body lower side; and a reinforcing member formed as a second chamber that extends in the vehicle body longitudinal direction, having a plurality of projections at outer surfaces of wall portions that structure the second chamber, the reinforcing member being provided within the chamber of the lower frame member in a state in which the plurality of projections are made to contact the guide portion.
US10723384B2	Vehicle body rear part structure A vehicle body rear part structure includes a rear side frame. The rear side frame includes a general part and a slope part. The general part extends substantially horizontally in at least one of an upper surface and a lower surface. The slope part extends so as to slope downward from the general part. A curved part is formed at a boundary between the general part and the slope part. The rear side frame includes two components which are a front side member and a rear side member. The curved part is provided on a joint part between the front side member and the rear side member.
US10723381B2	Trike vehicle with selectivity pivotable operator cabin The present invention is a hybrid crossover between an automobile and a motorcycle that is able to take tight corners almost like a motorcycle but is driven and handled like an automobile by optionally leaning into turns with one wheel in the front and two wheels in the rear of the vehicle and passenger compartment having an accelerator and brake pedals and steered with a steering wheel and gears that can be selected via a toggle switch gear selector located in the vicinity of the steering or by a floor and/or dash mounted unit.
US10723380B2	Systems and methods to control steering of a vehicle Systems and methods to control steering of a vehicle are disclosed. An example system includes a first sensor to measure a tilt angle associated with a vehicle positioned on a road surface. The example system also includes a vehicle controller communicatively coupled to the first sensor to receive the tilt angle. In addition, the example system includes steering system communicatively coupled to the vehicle controller. The vehicle controller provides feedforward control data to the steering system based on the tilt angle. The steering system generates a first steering torque based on the feedforward control data.
US10723376B2	Car seat holder A car seat holder is used to support a portable infant car seat by providing a flexible support. The apparatus comprises a first support, a second support, and a canvas. The first support and the second support are elongated members that extend across a shopping cart. The first support and the second support are rigid members that distribute the weight of an infant carriage device. The canvas is a flexible surface that extends from the first support to the second support across the shopping cart. The canvas provides a mechanism for transmitting the weight of the infant carriage device to the first support and the second support. In this way, the first support and second support hold the canvas in optimal position for holding an infant car seat. This arrangement frees up space within a shopping cart.
US10723375B2	Interchangeable and modular carts A mobile platform comprising: (a) one or more platforms to support one or more cartridges, (b) one or more compartments within the one or more platforms, (c) one or more vertical supports connected to the one or more platforms, (d) a plurality of wheels connected to a bottom of the one or more platforms, and (e) one or more recesses located in the one or more platforms to receive one or more support accessories, wherein the one or more compartments are shaped to receive the one or more cartridges so that the one or more cartridges are secured to the one or more platforms during movement.
US10723370B1	Self-driving single-car train system A train system having a train element consisting of a single train car configured to travel along a rail system, and including an enclosed first use area and a flat car section. The flat car section includes a drive-on loading area configured to enable a vehicle to be driven onto the flat car section and then transported by the train car. Train element includes a drive system for moving the train element along the rail system and a control system for autonomously controlling the operation of the train car. A sensor system collects sensor data and provides the sensor data, as inputs, to the control system. Sensor data is used by the control system in operating the train car. Lastly, a power system independently powers the drive system and control system.
US10723368B2	Clamp A clamp for a cable-drawn transport device includes clamp jaws having a clamp spine and clamping tongues adjoining the clamp spine. The clamp spine and the clamping tongues form running surfaces for rollers. In the longitudinal direction, the clamping tongues have a substantially S-shaped curved running surface, which merges continuously into the running surface of the clamp spine.
US10723366B2	Intervehicle communication and notification Technologies are shown for intervehicle communication involving notification messages sent from one vehicle to another vehicle. Sensor event data from one vehicle can be sent in a wireless message to another vehicle and information from the wireless message displayed to a driver of the other vehicle providing the driver with information that may not be detectable by the sensors in the driver's vehicle. The information from the wireless message can be displayed to the user on a user interface and can include a representation of an object detected by the other vehicle along with information about the position, speed, type or direction of the detected object. User interfaces can include graphical user interfaces, haptic devices and audio devices.
US10723365B2	Driving assistance device A driving assistance device that performs a notification process for notifying a driver of a risk of a collision with a preceding vehicle in cooperation with a notification device includes: an inter-vehicular distance acquisition section that successively acquires an inter-vehicular distance; a first index calculator that calculates a first risk index indicating a degree of the risk of the collision based on a traveling speed and the inter-vehicular distance; a second index calculator that successively calculates a second risk index based on a relative speed between the own vehicle and the preceding vehicle; a notification level determination section that successively determines a notification level indicating a strength of notification for notifying the risk of the collision, based on the first risk index and the second risk index; and a notification processor that performs the notification process in a notification mode corresponding to the notification level.
US10723357B2	Traction control system and control method thereof Disclosed herein are a traction control system and a control method thereof. The traction control system includes a communicator configured to receive acceleration of a vehicle; and a controller configured to decrease output torque in response to a decrease of the received vehicle acceleration, wherein the controller outputs second torque smaller than first torque corresponding to the decreased vehicle acceleration and then increases the second torque to the first torque during a predetermined first threshold time when the controller determines that the vehicle is traveling on a low-friction road surface into which a high-friction road surface changed on the basis of the vehicle acceleration.
US10723353B2	Vehicle control apparatus Rear lateral detection (RLL) ECU 10 determines whether or not a lane change assist control (LCA) is being performed. The RLDECU 10 sets a performing condition for performing a rear-end pre-crash safety control (rear PCS control) to a moderate performing condition when the LCA is being performed, and sets the performing condition of the rear PCS control to a normal performing condition when the LCA is not being performed. The moderate performing condition is set such that the rear PCS control is performed more easily compared with the normal performing condition. For example, in the moderate performing condition, a detection area of a target vehicle which is a vehicle subject to the rear PCS control is expanded compared with the detection area in the normal performing condition.
US10723352B2	U-turn assistance Methods, devices and apparatuses pertaining to U-turn assistance. The method may include receiving, by a computing device, vehicle information associated with a vehicle from a plurality of sensors that are placed on a plurality of locations of the vehicle and obtaining a length and a width of the vehicle based on the received vehicle information. The computing device may calculate a turning radius of the vehicle, and provide a recommendation for routing the vehicle based at least in part on the turning radius.
US10723345B2	Horizon-stabilized lateral control for a vehicle Lateral control of a vehicle, based on surroundings sensor signals of a surroundings sensor system of a host vehicle and/or maps, combined with an instantaneous position determination, wherein the course of the instantaneously traveled roadway and the position of the host vehicle on the roadway are determined, based on the surroundings sensor signals and/or the position determination, autonomous steering interventions are made in the host vehicle, which as a result, approximate or correspond to actuations of a steering wheel of the host vehicle, or provide a driver with information concerning steering interventions, a horizon position on the instantaneously traveled roadway to which the host vehicle is to be oriented is repeatedly determined, in that, starting from an instantaneous position of the host motor vehicle, an inner tangent point situated ahead of the host vehicle on the instantaneously traveled roadway is determined, and, starting from a point on the host motor vehicle, a tangent through this inner tangent point to a point of intersection with a horizon point function is determined, and an angle is enclosed between the center longitudinal axis of the host vehicle and the tangent, and is used for determining an angle specification for the steering intervention.
US10723342B2	Arbitration of multiple systems using shared components A brake control system (BCS) may comprise a first controller, a second controller in electronic communication with the first controller, and a valve comprising a first coil and a second coil. The first controller may be configured to actuate the valve via the first coil. The second controller may be configured to actuate the valve via the second coil. The first controller may be configured to disable the second controller to take over control of the valve.
US10723339B2	Valve block for electronic control brake system A valve block for an electronic brake system is disclosed. The valve block is configured to have two hydraulic circuits, a plurality of accommodating bores in which valves, pumps, low pressure accumulators, pressure sensors, and a motor are installed in order to control the braking hydraulic pressure supplied from a master cylinder to a wheel cylinder installed in each wheel, and a plurality of flow passages for connecting the plurality of accommodating bores, wherein on opposite side surfaces of the valve block, pump accommodating bores are formed symmetrically to each other to accommodate the pump, and first damping bores having an arrangement parallel to the pump accommodating bores are formed above the pump accommodating bores, wherein on an upper surface of the valve block, a pair of second damping bores is formed so as to be positioned above the first damping bores, and wherein first hydraulic lines are formed in a straight line from a bottom surface of the pair of second damping bores toward a bottom surface of the valve block, so that a discharge side of the pump accommodating bores and a suction side of the first damping bores, and a discharge side of the second damping bores and the bottom surface of the second damping bores are connected by the first hydraulic lines.
US10723337B2	Brake control system channel protection A brake control system (BCS) may comprise a shutoff valve configured to receive pressurized fluid, a one-way check valve configured to route the pressurized fluid, a first pressure transducer coupled between the one-way check valve and the shutoff valve, and an accumulator configured to supply pressurized fluid to a brake control valve module (BCVM) in response to the shutoff valve being in a closed position.
US10723336B2	Automatic deceleration control device An automatic deceleration control device includes an electronic control unit including a central processing unit, the electronic control unit configured to: acquire road-type information that is information about a type of a road on which a vehicle is traveling; set a maximum deceleration based on the road-type information; and output a signal to decelerate the vehicle at a first deceleration that is equal to or lower than the maximum deceleration, when an actual vehicle speed of the vehicle exceeds a target vehicle speed of the vehicle.
US10723333B2	Brake fluid pressure control device for vehicle A brake fluid pressure control device for a includes a wheel speed acquisition device that acquires a wheel speed, a slippage amount calculation device that calculates a wheel slippage amount, and a bad road determination device that determines whether a road surface of travel is a bad road. The bad road determination device determines whether the road surface of travel is a bad road using a bad road determination threshold value, and a value that relates to wheel behavior that is calculated based at least upon the wheel speed. The bad road determination threshold value is modified according to the wheel slippage amount. The present invention can appropriately set a bad road determination threshold value that is in accordance with a slippage amount, which corresponds to braking power, and can improve bad road determination precision without depending on variation in change of wheel speed.
US10723328B2	Vehicle wash system with pivoting side brushes and method for avoiding vehicle antenna A vehicle wash system includes a vehicle treatment area and an overhead frame portion supporting a pair of side brushes. The side brushes are configured to treat the lateral sides of the vehicle and may also treat the front and back of the vehicle. The side brushes are configured to pivot between a vertical position and an outwardly angled position, in which the side brushes are generally aligned with the side glass of the vehicle windows. The side brushes may travel along the side of the vehicle in both the vertical and pivoted orientations. The side brushes may make multiple passes along the side of the vehicle, and the side brushes may change orientation during or between passes to treat different segments of the vehicle. The side brushes may be oriented vertically at a location of a vehicle antenna to avoid the antenna.
US10723327B2	Dual scrubber vehicle treatment brush assembly A rotary brush assembly for use in a vehicle wash system, including a base portion, a linkage portion in rotational communication with the base portion and a treatment portion moveable between a first position extended into the vehicle treatment area for engagement with an exterior of a vehicle and a second position retracted from a vehicle treatment area. The treatment portion includes a brush assembly configured to rotate about an axis of rotation. The brush assembly has a backing member, a plurality of media elements secured to the backing member, and a plurality of spray nozzles encapsulated within the plurality of media elements. A plurality of pockets formed on the brush assembly where none of the first plurality of media elements are disposed. The plurality of spray nozzles being disposed at an angle to direct separate streams of high pressure fluid away from the axis of rotation and through the area of the pockets such that the separate streams are substantially not obstructed by any of the plurality of media elements.
US10723325B2	Vehicle sensor cleaning system Systems and methods for cleaning sensors of a vehicle using a spray pattern are provided. A sensor cleaning system can include a fluid source that supplies a fluid and a nozzle configured to provide a spray of the fluid to a sensor of an autonomous vehicle to remove debris from the sensor. The sensor cleaning system can further include a controller comprising one or more processors and one or more non-transitory computer-readable media that collectively store instructions that, when executed by the one or more processors, cause the controller to perform operations. The operations can include obtaining sensor data from the sensor, determining a spray pattern based at least in part on the sensor data; and controlling a flow of the fluid from the fluid source to the nozzle based at least in part on the spray pattern.
US10723324B2	Windshield washer reservoir conditioner A system and method of collecting and conditioning rainwater and other moisture, such as dew, from a windshield of a vehicle and utilizing the collected fluid to replenish the fluids in the windshield washer reservoir. A collection funnel is positioned on a vehicle in order to collect rainwater and other moisture. Rainwater and other fluids from the collection funnel are directed to a conditioning cartridge capable of treating the fluid with a surfactant to form a mixed fluid. An anti-freeze material may also be added. The mixed fluid is directed to the pre-existing windshield washer reservoir.
US10723323B2	Windscreen wiper device A windscreen wiper device (1) of the flat blade type, particularly for automobiles, includes an elastic, elongated carrier element, as well as an elongated wiper blade (2) of a flexible material, which can be placed in abutment with a windscreen to be wiped. The wiper blade includes at least one longitudinal groove (3), in which groove at least one longitudinal strip (4) of the carrier element is disposed. A connecting device (5) is connected to the flexible material of the wiper blade by at least one pin (14), that cooperates with a recess (21) provided along an exterior edge of the longitudinal strip in order to limit any movement of the wiper blade in longitudinal direction thereof relative to the longitudinal strip at the location of the interconnection of the connecting device and the wiper blade. The connecting device has a substantially U-shaped cross-section, wherein free ends of legs (8) of the U-shaped cross-section extend inwardly so as to form grooves for receiving longitudinal sides of the wiper blade. At least one of the legs is provided with a hole (13) for receiving the pin, with the special feature that the pin is glued to an inner wall (25) of the hole or the pin is form-locked inside the hole.
US10723321B2	Windshield wiper device having improved creep behavior The invention relates to a method for reducing material creep processes of a windshield washer device. The method comprises the providing (201) of a windshield washer device for a vehicle. The windshield washer device comprises a wiper blade (2) having an elongated top part (10) and an elongated bottom part (12), which are designed to be at least partially bendable. Furthermore, there is a plurality of connecting elements (18) for connecting the top part and the bottom part, wherein the connecting elements are spaced apart from each other along a longitudinal extension (8) of the wiper blade. The connecting elements (18) are designed to enable a movement of the top part (10) and the bottom part (12) relative to each other, having a movement component along a longitudinal extension (8) of the wiper blade. The method further comprises a loading (202) of the windshield wiper device before final assembly of the windshield wiper device on a vehicle such that, after final assembly of the windshield wiper device, a primary creep behavior of the windshield wiper device is substantially reduced, in particular by at least 80%.
US10723315B2	Electronic key system for vehicle, and portable device Provided is an electronic key system for a vehicle. The electronic key system for a vehicle includes an in-vehicle device and a portable device and performs a predetermined control process on a vehicle on the basis of verification successfully made between the in-vehicle device and the portable device. When receiving a verification signal, the portable device transmits a response signal in accordance with the verification signal. When an operation detection unit detects a user operation, the portable device transmits an instruction signal for controlling a state of locking of a door of the vehicle. An output level of the response signal from the portable device is lower than an output level of the instruction signal.
US10723314B2	Vehicle alarm system with multiple devices A vehicle alarm system comprising a primary device and at least one secondary device. The primary device is adapted to be connected to the vehicle and the secondary device is adapted to not be connected to the vehicle but adapted to be arranged in the vehicle, wherein the secondary device is adapted to take the role of the primary device if the primary device is disabled or removed from the vehicle.
US10723311B2	Webbing take-up device In a vehicle emergency, rotation of a lock base in a pull-out direction opposite to a take-up direction is restricted. A first pinion-configuring portion formed at an outer circumferential portion of the lock base configures one width direction side of a pinion section that is rotated in the take-up direction by a rack that moves due to fluid pressure in a vehicle emergency. A coupling member disposed between the lock base and the torsion shaft is fixed to the lock base and to a torsion shaft. A second pinion-configuring portion that configures a width direction other side of the pinion section is formed alongside the first pinion-configuring portion at an outer circumferential portion of the coupling member.
US10723304B2	Front pillar structure A front pillar structure includes: a front frame member; a rear frame member: a transparent member, a front side of the transparent member being supported by the front frame member, and a rear side of the transparent member being supported by the rear frame member; a front interior decorative member covering the front frame member from a vehicle interior side; a rear interior decorative member covering the rear frame member from the vehicle interior side; a head protection airbag, at least part of which is stowed between the rear frame member and the rear interior decorative member; a cover disposed between a lower end portion of the front interior decorative member and a lower end portion of the rear interior decorative member, and a jutting-out portion jutting out from the lower end portion of the rear interior decorative member toward a lower face side of the cover.
US10723301B2	Airbag for retractable steering wheel A restraint system includes a retractable steering wheel, an airbag inflatable from the steering wheel, two primary tethers, two secondary tethers, and a tether release engaged with both secondary tethers. The airbag when inflated includes a front panel adjacent the steering wheel and an impact panel opposite the front panel. The primary tethers extend from the front panel to the impact panel. The secondary tethers extend from the front panel to each primary tether.
US10723296B2	Method and apparatus for controlling the electrical connection and disconnection between a battery unit and a supercapacitor on an automobile A method and apparatus is proposed for controlling the electrical connection and disconnection between a battery unit and a supercapacitor on an automobile with the objective of preventing the electrical connection between the battery unit and the supercapacitor from being exceedingly long that would otherwise cause degraded power supply performance or even damage to the battery unit due to the self-discharging property of the supercapacitor. This feature can help to improve the power supply performance and extends the battery life. The proposed method and apparatus is characterized by the steps that the supercapacitor is electrically connected to the battery unit only at a temporal point when there is a need to use the supercapacitor, and immediately disconnected from the supercapacitor whenever there is no more need to use the supercapacitor.
US10723291B2	Holding clamp for holding vehicle parts in a vehicle The present disclosure relates to a holding clamp for use in a motor vehicle that includes a base body with a main through-opening for receiving a fastening bolt. Fastening devices for fastening to the fastening bolt are arranged in a portion of the main through-opening proximate to the bolt. At least one latching unit arranged in a freely movable manner along a region of the main through-opening is provided which has a form-fitting element. In addition, a separate locking element is provided to make a form-fitting connection to the form-fitting element when the latching unit is in a predetermined position.
US10723289B2	Combination cable for vehicle Provided is a combination cable for a vehicle that is capable of reducing noise interference and cross-talk between twisted pair wires. The combination cable for a vehicle includes a wire bundle and a sheath covering the wire bundle. The wire bundle includes a two-core first twisted pair wire, a two-core second twisted pair wire, a one-core first wire, and a one-core second wire. When viewed in cable cross-section, the wire bundle has the first twisted pair wire disposed on one side of a center line that runs from a center of the first wire to a center of the second wire, and has the second twisted pair wire disposed on the other side of the center line, and the first twisted pair wire and the second twisted pair wire are separated from each other.
US10723287B2	Retroreflective body with color effect and production method A retro-reflective body with an optically perceptible feature includes a substrate on whose upper side a binder layer is disposed. A plurality of transparent elements is at least partially embedded into the binder layer in such a way that light can enter the transparent elements. The surface of the transparent elements is configured as a spherical segment at least in some portions and wherein the spherical segments of the transparent elements are embedded into the binder layer and are orientated towards the upper side of the substrate. The retro-reflective body has a first partial region which a first share of the transparent elements, in each case with the spherical sections, is adjacent at least in some portions to spaces -filled with an optically thinner medium or a vacuum, wherein the optically perceptible feature is formed by the first partial region.
US10723286B2	Separator for a motor vehicle A separator for sealing a cavity in a motor vehicle includes a first separator part for sealing a portion of the cavity that includes a first expandable layer located around an outer edge and a second separator part for sealing a second portion of the cavity that includes a second expandable layer. The first separator part abuts the second separator part when installed in the cavity of the motor vehicle. The first expandable layer and second expandable layer expand to provide a seal around the first separator part and second separator part when heated. The separator further includes a third separator part for sealing a third portion of the cavity that includes an expandable tape that adheres to a surface of the third portion of the cavity. The expandable tape expands to seal the third portion of the cavity when heated.
US10723281B1	Calibration of vehicle sensor array alignment In one embodiment, a method includes detecting multiple reference markers on a vehicle and multiple reference markers on a sensor array attached to the vehicle. The method includes determining a pose of the vehicle and a pose of the sensor array based on the detected reference markers on the vehicle and sensor array and a model of the vehicle and sensor array that includes expected locations of the detected reference markers on the vehicle and sensor array. The method includes computing an observed relative orientation between the sensor array and the vehicle based on a comparison of the determined pose of the sensor array and vehicle. The method includes determining a calibration factor for a sensor of the sensor array based on a comparison of the observed relative orientation between the sensor array and the vehicle to an expected relative orientation between the sensor array and the vehicle.
US10723279B2	Method for operating a motor vehicle and motor vehicle A method for operating a motor vehicle, in which a control device of the motor vehicle receives a control input conducted by a vehicle occupant. By means of a sensor device of the motor vehicle, it is checked whether at least one predetermined criterion is met. When the at least one predetermined criterion is met and when the control input is received, the control device brings about a movement of at least one sun visor of the motor vehicle from a stowed position into a functional position, in which the at least one sun visor is flipped down. Furthermore, the invention relates to a motor vehicle.
US10723278B2	Trunk mounted rack A bicycle rack for mounting on the trunk or rear hatch of a vehicle is described with improved mechanisms for adjusting the components of the rack to fit the rack to different vehicles. The rack is provided with hinge assemblies having releasable latches for quickly releasing the hinges to allow the rack components to be moved with respect to one another, and the latching components back into a fixed configuration during use for carrying a bicycle. The bicycle rack is also provided with inventive support members for holding a bicycle on the rack during use.
US10723277B2	Vehicle article carrier system with end support having tunable clamping force The present disclosure relates to a vehicle article carrier system for supporting articles above an outer body surface of a vehicle. The system makes use of a pair of support rails fixedly secured generally parallel to one another on the outer body surface, and at least one cross bar assembly clampable to the support rails, and having a cross bar element having opposing ends. First and second end supports are secured at the opposing ends and able to engage the support rails to secure the cross bar against movement on the support rails. At least one of the end supports includes fixed and movable jaw portions, an actuating lever, and a pivot component pivotally coupled to the actuating lever and including a bore. A barrel nut is positioned in a bore of the movable jaw portion. A threaded member is coupled to both the barrel nut and the pivot component for changing an effective distance between the bore of the movable jaw portion and the pivot component, to thus effectively change a clamping force able to be applied by the movable jaw portion relative to the fixed jaw portion when the actuating lever is moved into a closed position.
US10723271B2	Running board configured for absorbing energy and method of forming same A running board configured for absorbing energy includes an attachment portion extending along a longitudinal axis and a step-assist portion extending from the attachment portion along a latitudinal axis that is perpendicular to the longitudinal axis. The attachment portion defines a plurality of voids therein each disposed along a respective one of a plurality of horizontal axes that are perpendicular to the longitudinal axis. The running board further includes a plurality of tubes disposed within a respective one of the plurality of voids. A device including the running board and a method of forming a running board are also set forth.
US10723267B2	Display rear passenger view on a display screen in vehicle An automotive audio visual system includes a display screen on the vehicle, such as the central display screen on the vehicle's dashboard, and one or more rear cameras facing a rear passenger seat of the vehicle. The image or video feed from one or more rear cameras is displayed on the display screen in the vehicle, so that the front passengers can view the rear passenger area on the vehicle's display screen.
US10723265B2	Imaging display system According to an aspect, an imaging display system includes an imaging device, a display device, and a processing device. The imaging device includes a rolling shutter image sensor that takes an image. The display device displays the image. The processing device performs image processing on the image. The imaging display system is mounted on a movable body that moves in a certain direction on a reference plane. The imaging device is arranged at an angle with respect to a moving direction of the movable body on the reference plane. An imaging scanning direction of the image on the image sensor is horizontal with respect to the reference plane. A display scanning direction of the image displayed on the display device coincides with the imaging scanning direction.
US10723262B1	Light guide for ring gauge illumination Uniform illumination is provided to a ring-shaped or round instrument panel guage by a light-conducting ring made the exterior surface of which is roughened. The ring is formed to have a light inlet tab that receives illuminating light from a bulb or LED. The ring can have any odd or even-number of light inlet tabs.
US10723259B2	Module for connection of engine brake system to existing vehicle brake lights A brake light control module for activating brake lights of a vehicle in response to activation of an engine brake of said vehicle. A control circuit of the module features a thyristor, a power lead and service lead for connection to the vehicle's electrical system and brake light service line across the thyristor, and a trigger lead for connection between the thyristor's gate terminal and an engine brake activation line of the vehicle to switch the thyristor to its conductive state when the engine brake activation line is energized. A delay circuit is installed in the power lead to prevent energization of the service lead in the event of a momentary gate signal indicative of an engine brake assisted gear shift. An operational indicator mounted within the housing is activated when the engine brake activation line is energized, thus confirming proper installation of the module.
US10723257B2	Multi-color luminescent grille for a vehicle A vehicle lighting assembly is provided herein. A grille has raised members pointing in a vehicle-forward direction. Light sources are disposed within each raised member and a photoluminescent structure is coupled to each raised member and is configured to luminesce in response to light excitation from one or more of the light sources.
US10723253B2	Front tower for machine A front tower for a truck body of a machine includes a beam member. The front tower includes a landing plate. The front tower also includes a first plate member connected between the beam member and the landing plate, and a second plate member disposed adjacent to the first plate member. The second plate member is connected between the beam member and the landing plate. The front tower includes a first side plate and a second side plate spaced apart from the first side plate. The front tower further includes a cover plate assembly extending between the first side plate and the second side plate. The cover plate assembly, the first side plate, and the second side plate enclose the first plate member and the second plate member.
US10723250B2	Acoustic transducer assembly disposed in vehicle seat The technology described in this document can be embodied in a system that includes a seat headrest enclosing at least one first acoustic transducer that generates audio output in a first frequency range. The system also includes an adjustable headrest wing disposed in front of the seat headrest, the headrest wing being pivotally coupled to the seat headrest and adjustable to one of multiple positions. The headrest wing includes at least one second acoustic transducer that generates audio output in a second frequency range that includes frequencies higher than the upper end of the first frequency range. The system further includes a controller configured to adjust, for a given position of the headrest wing, one or more parameters of at least one of: (i) the first acoustic transducer and (ii) the second acoustic transducer in accordance with a target acoustic distribution.
US10723248B2	Vehicle seat A mechanism for suspending a skin material on a seat rear surface with a simple and light structure is described. A vehicle seat including a seat back forming a backrest surface includes a seat back pad which is a cushion material of the seat back, a skin material which covers the seat back pad, a wire of which a part is embedded inside the seat back pad and another part is exposed to a seat rear surface, and a hook which is attached to an end portion of the skin material on the side of the seat rear surface. The wire engages with the hook so that the skin material is suspended and fixed to the seat rear surface of the seat back.
US10723247B2	Vehicle seat A vehicle seat, which is provided with a collision prediction sensor and with a seat cushion having a seat cushion top face and a seat cushion frame, includes: a pelvis movement suppression member disposed along a seat width direction inside a front portion of the seat cushion; a vertical movement-enabling unit supporting the pelvis movement suppression member at the seat cushion frame and allowing vertical movement of the pelvis movement suppression member to follow vertical movement of the seat cushion top face; and a stopper unit attached to the seat cushion frame and, in a case in which a rapid deceleration of a vehicle is detected or a collision of the vehicle is predicted by the collision prediction sensor, restricting downward movement of the pelvis movement suppression member.
US10723243B2	Seat adjuster A seat adjuster includes a first fastener, a second fastener, a third fastener, and/or a motor assembly. The motor assembly may include a motor, a first mounting portion, a second mounting portion, and/or a third mounting portion. The seat adjuster may include a pinion, a sector, and/or a side member. The first fastener, the second fastener, and/or the third fastener may connect the motor assembly to the side member. The first fastener may be connected to the side member and/or the first mounting portion via a torque prevailing connection. The third fastener may extend through and/or may restrict movement of the sector. The pinion may be engaged with the sector substantially without play. The side member may include a first aperture, a second aperture, and/or a third aperture.
US10723242B2	Dismountable seat A dismountable seat assembly for attaching to an anchoring component of a vehicle includes an individual back hingeably attached to an individual seat, an attaching component and an emergency connecting component. The emergency connecting component connects at least a part of the individual seat which is attached to the individual back to the attaching component in a detachable way, so that the individual back and the at least part of the individual seat attached to the individual back are detachable together from the attaching component.
US10723241B2	Vehicle occupant monitoring system with front and rear sensors and method thereof Generally described, a vehicle occupant monitoring system with front and rear sensors that scan different sections or areas at different times within a vehicle is presented. A number of different sensors may be included that monitor the front row, second row, third row and rear storage of the vehicle. The system may deactivate the front and rear sensors when the vehicle is unlocked. The system may determine whether a rear door has been closed. If the rear door has not been opened, the rear sensors may remain inactive. However, and when the rear door has been closed, the system activates the rear sensors until the vehicle begins moving. A notification may be provided when an occupant has been detected by the rear sensors after the vehicle is placed in park. The front and rear sensors may be activated when the vehicle is locked.
US10723239B2	Multi-outlet vehicle charge device and control strategy A vehicle charge station including charge cords and a controller is provided. Each of the charge cords may include an electrical connector to mate with a vehicle. The controller may be programmed to, responsive to detecting a first active one of the charge cords having a change in current draw greater than a second active one of the charge cords for a same time period, increase power provided to the first active one of the charge cords. The controller may be further programmed to, responsive to detecting the first active one of the charge cords having a continually active duration less than the second active one of the charge cords for another same time period, increase power provided to the first active one of the charge cords.
US10723235B1	Flexible battery system for a vehicle A configuration instruction associated with configuring a plurality of batteries which supply power to a plurality of motors in a vehicle is received. The batteries are configuring as specified by the configuration instruction, where the batteries are able to be configured in a plurality of configurations, including: a first configuration where at least some of the batteries are electrically connected together in parallel and a second configuration where at least some of the batteries are electrically connected together in series.
US10723234B2	Battery housing A battery housing for an electric-motor-driven vehicle comprising a tub-like housing part having a plurality of support elements arranged at a distance from each other, and having a bottom part supported on the support elements. The bottom part is convexly curved toward the outside of the housing part in the longitudinal and/or transverse extent in the span of the bottom part between each pair of adjacent support elements arranged at a distance from each other, and is connected in the direction of the curvature to the support elements between which the span of the arch extends.
US10723232B2	Dual rail track system for industrial control The present invention provides a dual rail track system for independently moveable carts in an industrial control environment in which upper and lower rails of a track are substantially “L” shaped to allow upper and lower groups of rollers of a cart to orthogonally contact the upper and lower rails, respectively, to provide vertical and horizontal control of the cart while in motion along the track. The shape of the rails and arrangement of the rollers, orthogonal with respect to the rails in vertical and horizontal planes, provides an efficient support system allowing high speed movement of carts, including through turns, with only two rails and with symmetric weight distribution of the cart. Flexible members provided with respect to each roller also provide resiliency to allow the rollers to adapt to variations in the track.
US10723228B2	Power source system A power source system includes a first power source, a second power source, a Direct Current to Direct Current converter, a first load including a vehicle control device configured to perform predetermined control regarding at least one of traveling, steering, and braking of the vehicle regardless of a driving operation performed by a driver of the vehicle, and an electric actuator as a control target of the vehicle control device, and connected to the first path so as to be supplied with power from the first power source, and a power source control device configured to control an operation of the Direct Current to Direct Current converter such that power is supplied to the first path from the second power source in a case where the predetermined control is performed.
US10723227B2	Brake system and method for four-wheel drive electric vehicle and electric vehicle A brake system (100) and a brake method for a four-wheel drive electric vehicle and a four-wheel drive electric vehicle, in the system, according to a brake mode of the electric vehicle, a state of charge of a battery pack (4) and a vehicle speed, a first brake control unit controls a motor (6) to brake a wheel (9) through a motor controller (2) and a second brake control unit controls a brake actuator (12) to brake the wheels (9). The first brake control unit further determines whether a brake torque of the brake actuator (12) on the wheels (9) fails. If yes, the first brake control unit controls the motor (6) to brake the corresponding wheel (9) through the motor controller (2).
US10723224B2	Electric vehicle drive unit An electric vehicle drive unit includes: first and second traveling motors that include first and second rotors, respectively; and a first planetary gear mechanism that includes first to third rotation element, The first rotation element is rotatably coupled to the first rotor. The second rotation element is rotatably coupled to the second rotor via a connection portion. The third rotation element is coupled to an output shaft coupled to a drive wheel side. Rotary axes in the first planetary gear mechanism, the first traveling motor and the second traveling motor are coaxially arranged. The electric vehicle drive unit further includes a clutch that disconnectably connects any two rotation elements among the first to third rotation elements to switch the two rotation elements to a directly coupled state at the time of connection.
US10723221B2	Filler cap for fuel tank A filler cap for a fuel tank is disclosed and is configured to prevent environmental pollution and improve fuel consumption without discharging fuel or harmful gas to an exterior of the fuel tank. A rise/fall member and a valve body are lowered by an urge force that is less than a total weight of the valve body and the rise/fall member, thereby opening a valve portion. When the fuel tank inclines, a coil spring expands and the valve body contacts with convex portions on an inner surface of a cylinder main body. After a pressure reduces at a communication port of a resistance member, the fuel flows from a small diameter space of a blow-up member. The flowing fuel pushes up the valve body and the rise/fall member thereby closing the valve portion together with the urge force of the coil spring.
US10723220B2	Fuel tank system A fuel tank system includes: a fuel tank capable of storing fuel; a canister that has a ventilation port and an introduction port and that accommodates an adsorbent capable of adsorbing evaporative fuel introduced into the canister; a housing attached to the canister, and accommodating a pump configured to apply a pressure to an interior of the canister through the ventilation port; a pipeline that has an atmosphere opening port opening to an outside, the pipeline extending from the atmosphere opening port toward the ventilation port; and a filter unit having an internal space in which an air filter is arranged, the filter unit being removably fitted to the housing and the pipeline, the housing and the pipeline communicating with each other via the internal space.
US10723217B2	Drive train system A drive train system includes at least one internal combustion engine, at least one generator driven by the internal combustion engine for generating electrical energy, at least one electrical machine electrically connected to the generator, at least one driven front axle and at least one driven rear axle, an automatic or manual transmission located between the internal combustion engine and the respective axles, and at least one epicyclic gear unit. Each of the at least one drive front axle and at least one drive rear axle includes output means and is driven by the internal combustion engine.
US10723214B2	Drive device for a motor vehicle A drive device for a motor vehicle, having a first drive assembly, a second drive assembly that can be coupled to the first drive assembly with a fixed transmission ratio by an intermediate clutch, as well as a driven shaft that can be coupled to the first drive assembly and to the second drive assembly. Here, the first drive assembly is directly coupled or can be coupled to a third drive assembly, and that the driven shaft can be coupled to the second drive assembly, on the one hand, by way of a first shift clutch and a first transmission stage, and, on the other hand, by way of a second shift clutch, which is coupled to the second drive assembly parallel to the first shift clutch, and a second transmission stage.
US10723213B2	Roll restrictor system for an automotive powertrain An aspect of the invention provides a roll restrictor system for an automotive powertrain, comprising: a torque roll restrictor bracket configured for attachment to the automotive powertrain; wherein attachment is mediated by a bushing; wherein the bushing is provided within a bearing which facilitates rotation of the bushing within the torque roll restrictor bracket.
US10723212B2	Quick locking-unlocking assembly The present application relates to the field of swapping batteries of electric vehicles, particularly to a quick locking-unlocking assembly. The present application aims at solving the problem in the prior art that each locking mechanism of current electric vehicle power battery has too many parts and sophisticated structure, occupying larger space and thus increasing cost in manufacturing the electric vehicles. The quick locking-unlocking assembly of the application includes: a first sliding block and a second sliding block slidably connected to the electric vehicle body, a retaining sheath fixed to the outer shell of the power battery, a first spring and a second spring for forcing the first and second sliding blocks to move closer to each other, a bolt capable of extending through the retaining sheath and the first and second sliding blocks, and a third spring forcing the bolt away from the vehicle body. Further, the bolt is provided with a cam, by rotating which the first and second sliding blocks are forced to separate away from each other. Thus, the bolt is able to leave the electric vehicle under effect of the third spring. Accordingly, the quick locking-unlocking assembly of the present application is simple in structure and convenient in operation.
US10723211B2	Integrated powertrain system A powertrain system including a first housing, a first electric motor that drives a first wheel, a first inverter coupled to the first electric motor, a first gear reducer coupled to the first electric motor. The first gear reducer couples to a first wheel. The powertrain system also includes a second electric motor that drives a second wheel, a second inverter coupled to the second electric motor, a second gear reducer coupled to the second electric motor. The second gear reducer couples to a second wheel. The housing houses the first electric motor, the first inverter, the first gear reducer, the second electric motor, second inverter, and the second gear reducer.
US10723210B2	Seals and method for making same Extruded seals including a sealing portion with a honeycomb profile and method for making extruded seals with honeycomb profiles. An extrusion tool is provided with a first and second plate connected together. The first plate has a plurality of pins, which are vented to form a honeycomb profile. The second plate has a profiled opening receiving the plurality of pins and forming the overall shape of the part, including the outermost surfaces of the part. The pins serve as mandrels for extruded molten material to flow around. Varying the pin configuration and dimensions changes the honeycomb profile. The honeycomb structure is provided in the sealing portion of the extrusion. The honeycomb profile is formed by itself, co-extruded with a rigid or semi-rigid structural member, or applied to the rigid or semi-rigid structural member after the structural member is formed.
US10723209B2	Resin back door for vehicle and method of manufacturing the same A resin back door includes a resin inner panel, a resin lower outer panel, and a metal reinforcing member disposed in a hollow space defined by the inner panel and the lower outer panel. In the resin back door, the reinforcing member has an annular shape extending along an outer peripheral edge of the inner panel, and includes right and left reinforcing members and a lower-side reinforcing member which are separated from each other and fixed to the inner panel with an adhesive leaving a gap. The reinforcing members are connected by using right and left corner connecting members and an upper connecting member to constitute the reinforcing member.
US10723208B2	Tailgate for vehicle A tailgate for a vehicle including an inner panel and an outer panel. The outer panel includes an appearance wall and an edge wall adjacent to the appearance wall and taking part in delimiting a housing for receiving an optical unit. The outer panel further includes a bridge wall, located on the inside face of the outer panel, forming a bridge between the edge wall and the appearance wall and serving as a part of a bonding interface between the outer panel and the inner panel. A process for molding the outer panel for the tailgate for a vehicle, wherein a movable slider is built and used in a mold to create a naturally non-demoldable hollow cavity delimited by the appearance wall, the edge wall and the bridge wall.
US10723207B2	Module carrier for a door module of a motor vehicle door and method of producing the same It is provided a module carrier for a door module of a motor vehicle door, wherein at least one functional element is to be fixed to the module carrier. The module carrier is formed substantially by an organic sheet and is delimited by an encircling outer edge with at least one sealing element. On the module carrier, there is provided a multiplicity of interfaces firstly for fixing the module carrier to a door structure of a motor vehicle door and secondly for connecting the at least one functional element and/or further components of the door module to the module carrier.
US10723196B2	HVAC system inlet assembly An HVAC system according to an example of the present disclosure includes a blower rotatable about an axis. The blower has a first blower section and a second blower section fluidly isolated from the first blower section. An inlet assembly at an axial end of the blower includes a first compartment configured to control fluid flow through the first blower section and a second compartment configured to control fluid flow through the second blower section.
US10723195B2	Moving body A moving body includes a frame, a pair of right and left first wheels, a pair of right and left second wheels, a pair of right and left first parallel links connecting the first wheels and the second wheels, and a second parallel link connecting the pair of right and left first parallel links. Furthermore, a height changing unit connects the second parallel link and the frame and changes a position of the frame in a height direction with respect to the second parallel link, and a controller controls the height changing unit so as to maintain a height of the frame from a road surface.
US10723191B1	In-wheel three-arm suspension for vehicles An in-wheel suspension system includes an assembly with a main arm that is pivotally connected at a connection point on the main arm to a shaft point of a wheel, a first linkage unit pivotally connected at one end to a first end of the main arm, and a second linkage unit pivotally connected at one end to a second end of the main arm. At least one second end of the first linkage unit and at least one second end of the second linkage unit, that are not connected to the main arm, are pivotally connectable each to a reference frame at a defined distance between them, such as to form a substantially “Z” like shape.
US10723188B2	Lightweight gooseneck-mounted trailer hitch A trailer coupler system can include one or more skid plates made from extruded aluminum, one or more support tubes attached to the skid plates, a plurality of struts having a first end attached to the one or more skid plates, a ball housing attached to a second end of at least two of the plurality of struts, a first towball positioned within the ball housing, an adapter sleeve attached to the ball housing, a support plate extending from a support tube or skid plate to the adapter sleeve, an adapter having a kingpin coupler for coupling to a kingpin of a trailer, and a towball coupler for directly coupling with the first towball.
US10723179B2	Tire A tire has a tread portion including a groove extending in the tire-circumferential direction, a first land portion positioned to the inner-side in the tire-width direction and having a first groove wall of the groove, and a second land portion having a second groove wall. Protrusions extend from the first groove wall to the second groove wall on bottom of the groove. In a tread-surface view, the protrusion has a linear portion and a curved portion that is contiguous with the linear shaped portion. A slit crossing the protrusion is formed in at least one of the end parts of the protrusions. The first land portion includes shallow grooves having shallower depth than the groove and extending at an angle with respect to the tire-width direction. The linear portion of the protrusion extends at an angle in the same direction, with respect to the tire-circumferential direction, as the shallow grooves.
US10723175B2	Quick attachment arm and bracket for supporting a wheel upon a vehicle hoist A quick attachment arm is provided for securing to an elevated and structurally supporting location. A multi-sided and compressible pair of bands are constructed of a spring-loaded material attached around a perimeter of a tubular cross section supporting location. A member extends form the band and, at a remote end of the member, an elongated arm is pivotally supported to and extends from the member, the arm adapted to supporting a weighted article placed thereupon.
US10723173B2	Coupling system for a low-friction sealing assembly, and wheel hub unit equipped with said sealing assembly A coupling system for a sealing assembly with a rotating annular member. In particular, a bearing ring provided with a flange. The sealing assembly provides at least one first annular shield having a sleeve portion integrally coupled with the rotating annular member and a flange portion that radially and overhangingly protrudes from the sleeve portion and is arranged close to the flange. The sleeve portion is defined by a solid tubular body of rotation delimited by a mounting surface facing towards the rotating annular member and having cylindrical geometry, In combination, the sleeve portion couples with an assembly seat of the rotating annular member, formed by an annular shallow recess delimited by a cylindrical bottom surface and by an axial shoulder arranged on the side opposite to the flange; the first annular shield being placed, at the same time, in axial contact with the flange portion and the axial shoulder.
US10723172B2	Rim for a wheel A non-metallic rim for a wheel which may be used for motorised vehicles. The rim has a barrel, a first flange, a second flange, a first bead seat, a second beat seat and a primary structural component. The primary structural component extends into at least the first flange and the barrel, and the primary structural component is capable of bearing the majority of the radial and/or lateral load that is borne by the rim during usage. Additionally, the rim has at least a portion of the first bead seat spaced apart from the primary structural component and/or has a protective insert in between the outer face of the first flange and the primary structural component.
US10723166B1	See-through highlighter A highlighter with a see-through area comprising a housing having a hollow body and an opening, an ink reservoir disposed inside the housing for storing ink, a nib disposed at the opening and an ink feeder disposed inside the housing for transporting ink from the ink reservoir to the nib. The housing further comprises a cut-out section disposed behind the nib to provide the see-through area for a user. The see-through area allows the user to see a section of text before highlighting. Alternatively, a section of the housing behind the nib can be constructed using transparent material such as plastic to provide a see-through area for a user.
US10723160B2	Carbide, nitride and silicide enhancers for laser absorption A universal or all-purpose laser marking composition for forming satisfactorily dark laser marks on a wide variety of substrates is provided. The marking composition comprises an enhancer of nitrides, carbides, silicides, and combinations thereof. The enhancer may be selected one or more of ferromanganese, ferrosilicon, FexSi(1-x) where X can range from about 0.005 to 0.995, Fe5Si2, MgFeSi, SiC, CaSi, (Co)Mo, MoSi2, TiSi2, ZrSi2, WSi2, MnSi2, YSi, Cu5Si, Ni2Si, Fe3C, Fe7C3 and Fe2C, MoC, Mo2C, Mo3C2, YC2, WC, Al4C3, Mg2C, Mg2C3, CaC2, LaC2, Ta4C3, Fe2N, Fe3N, Fe4N, Fe7N3, Fe16N2, MoN, Mo2N, W2N, WN, WN2, and combinations thereof and combinations thereof. Upon disposing the marking composition on a substrate and exposing the marking composition to laser radiation, the marking composition absorbs the laser radiation, increases in temperature, chemically bonds with the substrate, and when formed on each of a metal, glass, ceramic, stone, and plastic substrates, the mark has a negative ΔL dark contrast value of at least −1 compared to a mark formed by the marking composition without the enhancer.
US10723159B2	Multilayered printed matter A multilayered printed matter includes print layers (pattern layers) formed on a medium and having patterns printed thereon, and a concealing layer interposed between the print layers. The concealing layer conceals the pattern printed on one of the pattern layers not to affect the pattern of the other pattern layer. The concealing layer is formed on a back side relative to the other pattern layer. The print layers between the medium and one of the print layers on the back side of the other pattern layer (back-side print layers) respectively have recessed parts recessed into their surfaces toward the back side. The back-side print layer between the other pattern layer and the medium has a protruding part to fill one of the recessed parts and thereby planarize a surface of the back-side print layer. Hence achieving improved appearance and visual quality of the multilayered printed matter.
US10723154B2	Image forming system including plurality of sheet feeders and method therefor having switching control features An image forming system has a transmission assembly, standard and auxiliary sheet feeders, standard and auxiliary trays, an image forming device and a controller. The transmission assembly is for switching transmission of a drive force of a motor selectively to the one of the standard and auxiliary sheet feeders. The controller determines whether sheet is absent in the standard tray. The controller, based on determining the sheet is absent in the standard tray and receipt of preceding data, control the transmission assembly to initiate to switch the transmission of the drive force to the auxiliary sheet feeder. Also the controller, based on receipt of control data received after preceding data, control the image forming device to form an image based on the control data.
US10723152B2	Electric field generating transport member A printer includes a printhead assembly and a dryer. A transport mechanism conveys the printed media in a downstream direction between the printhead assembly and a dryer and between the dryer and an output device. The transport mechanism includes an electric field-generating transport member. The transport member includes a continuous belt supported by rollers. The belt is driven to transport the printed media on an upper surface of the belt. The belt includes an electrically-insulating inner layer and an electrically-insulating outer layer. First and second sets of electrical conductors are positioned intermediate the inner and outer layers. Electrical conductors in the second set are grounded and alternate with electrical conductors in the first set, A charging unit selectively applies a voltage to only a subset of the electrical conductors in the first set at a time, to electrostatically attract the printed media to the upper surface of the belt.
US10723148B2	Recording apparatus A printer includes a recording unit which performs recording on paper, an discharge portion which discharges the paper after the recording by the recording unit, a first paper discharge tray on which the paper which is discharge from the discharge portion is placed, and a retainer which includes a plurality of retaining portions which retains the paper toward the first paper discharge tray on a downstream in a medium discharge direction of the discharge portion, in which the plurality of retaining portions includes a first retaining portion and a second retaining portion which retains closer to an upstream in the medium discharge direction than a retaining position of the first retaining portion.
US10723147B2	Digital thermal binder and powder printing A method of forming a digital print on a surface by applying powder of dry ink including colourants on the surface, bonding a part of the dry ink powder to the surface by a digital heating print head such that the digital print is formed by the bonded dry ink colourants and removing non-bonded dry ink from the surface.
US10723144B2	Method and fixer for fixing of print images on a recording medium In a method for fixing a print image on a recording medium, data is determined for controlling one or more radiation sources to fix the print image. The data can be determined based on a deformation model of the recording medium such that a deformation of the recording medium is reduced or minimized.
US10723143B2	Formation of gloss level areas having a glossy finish and a matte finish in an image A method includes printing an image on substrate by a printhead using ultraviolet (UV) curable ink. The method includes selectively applying a first amount of UV radiation by a first region of a light source to a first area of the image after a first amount of time passes from printing the first area to form a first gloss level area having a glossy finish. The method also includes selectively applying a second amount of UV radiation by a second region of the light source to a second area of the image after a second amount of time passes from printing the second area to form a second gloss level area having a matte finish. At least one of the second amount of UV radiation is greater than the first amount of UV radiation and the first amount of time is greater than the second amount of time.
US10723138B2	Printing systems The present disclosure is drawn to printing systems. In one example, a printing system can include an electrode having a plurality of electrode protrusions associated therewith and a conductive plate. The electrode and conductive plate can be positioned with respect to one another to generate an electric field therebetween and to allow a media substrate to be positioned therebetween to be exposed to the electric field. Additionally, an inkjet print head can form a printed image on the media substrate after exposure to the electric field.
US10723137B2	Control apparatus and control method A control apparatus for generating a control signal for controlling a printer on the basis of an input signal includes: an arithmetic unit configured to generate an error diffusion processing signal by subtracting, from the input signal, an error diffusion output signal output from a diffusion matrix that determines a distribution of a print density error; a multiplier unit configured to generate an intermediate signal by multiplying the error diffusion processing signal by a correction gain for controlling a correction amount of the print density error; and a quantizer unit configured to generate the control signal by quantizing the intermediate signal.
US10723136B2	Image formation device An image formation device includes a plurality of nozzles, a processor which forms an image on the basis of print data, and a memory which stores computer-readable instructions that, when executed by the processor, perform processes including, performing first ejection control which ejects a first amount of the ink at a timing of one of a forward path and a return path in the main scan direction, when printing is performed by a multi-pass method in which each of pixel arrays is printed by a plurality of main scans and, in each of the plurality of main scans, the ink is ejected onto the same pixel array from the respectively different nozzles, and performing second ejection control configured to eject a second amount of the ink at a timing different from the previous timing of the ejection of the ink, the second amount being smaller than the first amount.
US10723134B2	Liquid tank A liquid tank includes a liquid supply portion, a first liquid chamber, a liquid communication flow path and an air communication flow path. The liquid communication flow path includes an upstream end which is connected to the first liquid chamber, a rising flow path which is located on a downstream side with respect to the upstream end and which extends upward in a mounting state, a lowering flow path which is located on the downstream side with respect to the rising flow path and which extends downward in the mounting state and a downstream end which is located on the downstream side with respect to the lowering flow path and which is connected to the liquid supply portion. In the mounting state, the liquid supply portion is located lower than the downstream end and extends downward toward a liquid supply port.
US10723129B2	Liquid ejecting head and liquid ejecting apparatus Disclosed is a liquid ejecting head including a flow passage forming section in which a pressure chamber which communicates with a nozzle ejecting liquid and a circulation liquid chamber which communicates with the pressure chamber to circulate the liquid are formed, a driving element that generates pressure change in the pressure chamber, a circuit board for driving the driving element, and a connecting terminal that electrically connects the driving element with the circuit board, in which the connecting terminal overlaps the circulation liquid chamber in a plan view.
US10723120B2	Ink delivery system and method An ink delivery system is provided. The ink delivery system includes at least one ink cartridge dispenser including an ink cartridge holder for holding an ink cartridge storing printing ink, at least one ink level sensor, a rotatable ink fountain roller and an ink fountain blade, forming a dispensed ink area receiving printing ink from the ink cartridge. The ink delivery system also includes a support supporting the at least one ink cartridge dispenser movably across a longitudinal axis of the ink fountain roller. The ink cartridge dispenser is movable along the support and fixable to the support manually. A method for supplying printing ink is also provided.
US10723117B2	Lift tool assembly for stencil printer A conveyor system for a stencil printer includes a pair of rail members extending through a frame and configured to transport the substrate through the stencil printer. A lift tool assembly is configured to support the substrate at a transport height and a print height. The lift tool assembly includes a lifter portion configured to be engaged by a support of the lift table assembly. A foot of the lifter portion has at least two permanent magnets configured to secure the foot of the lifter portion to the support when engaging the support to the lifter portion, and at least one vacuum pocket formed in a bottom surface of the foot of the lifter portion. The vacuum pocket is configured to selectively secure the lifter portion in place on the support.
US10723116B2	Apparatus and methods for fabricating components An additive manufacturing method for fabricating a component having a surface substantially free of imperfections may include providing a mold having a configuration corresponding to the component, and depositing a material on at least one surface of the mold to fabricate the component having the surface substantially free of imperfections.
US10723112B2	Method of transferring thin film The present invention discloses a method for transferring a thin film from a first substrate to a second substrate comprising the steps of: providing a transfer structure and a thin film provided on a surface of a first substrate, the transfer structure comprising a support layer and a film contact layer, wherein the transfer structure contacts the thin film; removing the first substrate to obtain the transfer structure with the thin film in contact with the film contact layer; contacting the transfer structure obtained with a surface of a second substrate; and removing the film contact layer, thereby transferring the thin film onto the surface of the second substrate.
US10723111B2	Film laminator for cell phones According to the utility model, there is provided a film laminator for cell phones, useful for film lamination on a surface of a cell phone, including: a cell phone fixing plate, on which a through hole for receiving the cell phone is established, and a top surface of which is a horizontal face; with at least one position limiting plate for abutting the cell phone within the through hole being also fixed on the top surface. The film laminator for cell phones further includes: a film laminating plate for fixing a cell phone film; one end of which is hinged to the cell phone fixing plate, and the other end of which is movable freely so that the film laminating plate is bonded with the top surface of the cell phone fixing plate. With respect to the film laminator for cell phones according to the utility model, because the position limiting plate is provided on the cell phone fixing plate, the surface of the cell phone to which a film is to be attached can handily be kept in flush with the top surface of the cell phone fixing plate. Upon film lamination, the film laminating plate can contact with the top surface of the cell phone fixing plate and the surface of the cell phone to which a film is to be attached at the same time, so that the stress that is laid on it in the course of film lamination is very even, and a good effect of film lamination is obtained.
US10723110B2	Method and device for producing a profiled element What is described is a method for manufacturing a profile element for sealing building-structure joints, especially for sealing against sound and smoke and optionally against fire, to an apparatus for manufacturing such a profile element and to the use of the profile element manufactured according to the invention for the acoustic, smokeproof and/or fireproof sealing of connecting joints in drywalls, especially of expansion joints. In particular, an improved method is described for continuous and endless manufacture of such a profile element.
US10723102B2	Durable low emissivity window film constructions In certain embodiments, the present disclosure relates to low emissivity films and articles comprising them. Other embodiments are directed to methods of reducing emissivity in an article comprising the use of low emissivity films. In some embodiments, the low emissivity films comprise a metal layer and one or more zirconium nitride layers adjacent the metal layer. This type of assembly may serve various purposes, including being used as a sun control film. These constructions may be used, for example, on glazing units for reducing transmission of infrared radiation across the film in both directions.
US10723101B2	Optical laminate structure and touch sensing device having the same An optical laminate structure including first and second layers each having a bonding face, at least one step on at least one of the bonding faces, a retarder layer between the first and second layers, and first and second adhesive layers. The first layer may cause outgassing. The retarder layer has first and second bonding faces facing the first and second layers, respectively. The first adhesive layer bonds together the bonding face of the first layer and the first bonding face of the retarder layer and has such hardness that suppresses the outgassing at an interface between the first layer and the first adhesive layer. The second adhesive layer bonds together the bonding face of the second layer and the second bonding face of the retarder layer, is more flexible than the first adhesive layer, and has such hardness as to get distorted by the step and thereby absorb height of the step.
US10723096B2	Method for producing packaging, and packaging machine The invention relates to a method for producing packaging (18) from paper material (5), in particular paper, cardboard or paperboard, said method comprising the following steps: forming packaging (18) from a blank (19) made of paper material (5), which paper material overlaps at at least one joining site (21); positioning the at least one joining site (21) between a sonotrode (2) and an anvil (3); applying the joining site (21) with a joining force in a joining force direction (6); and making the sonotrode (2) ultrasonically vibrate in order to ultrasonically weld the paper material (5) at the joining site (21), which method is characterised in that the paper material (5) is moistened, preferably on the inner sides of the joining sites (21), before forming the packaging (18) and/or while forming the packaging (18) and/or after forming the packaging (18) and/or during the ultrasonic welding.
US10723095B2	Press drive device for a press, and press comprising a press drive device A press drive device includes a connecting rod with input and output ends. A drive shaft mounts to rotate about a shaft axis and includes a connecting rod bearing in eccentric relation to the shaft axis. The input end mounts on the connecting rod bearing. At least first and second drive housings are provided on axially opposite sides of the connecting rod bearing. The drive shaft projects into both drive housings. A motor mounts in at least one of the drive housings and includes a stator rotationally fixed to a drive housing peripheral wall located coaxially around the shaft axis. A rotor supported by a rotor hub is arranged radially within the stator with mounting space between the shaft axis and the rotor for possibly mounting a braking device.
US10723094B2	Annular ring and non-pneumatic tire The present invention provides an annular beam of monolithic construction of one homogeneous material and a related efficient, low-cost non-pneumatic tire. Specific geometric design, combined with nonlinear elastomer physical properties, enable the suppression of all reinforcing belts, continuous fibers, or other strengthening layers in the annular beam. The annular beam consists of at least two bands that are continuous in the circumferential direction and connected by a web geometry. The non-pneumatic tire consists of the annular beam, a ground contacting portion, a central wheel, and a plurality of web spokes that connect the wheel and beam. When the tire is loaded to a design load against a flat surface over a design contact length, a contact area of essentially uniform pressure is produced, while the load is transmitted from the beam to the hub via tension in the web spokes. The tire can be economically manufactured.
US10723090B2	Method of manufacturing a composite laminate structure The present disclosure provides a method of manufacturing a composite laminate structure of a wind turbine blade part by means of resin transfer moulding, preferably vacuum-assisted resin transfer moulding. In a resin transfer moulding, fibre-reinforcement material is impregnated with liquid resin in a mould cavity. The mould cavity comprises rigid mould part having a mould surface defining a surface of the wind turbine blade part.The method comprises alternately stacking on the rigid mould part: i. a number of unidirectional fibre-reinforcement layers comprising electrically conductive fibres, such as carbon fibres, and ii. a flow-enhancing fabric layer for enhancing a flow of the resin during infusion of the fibre-reinforcement layers, the flow-enhancing fabric layer comprising an open-structured layer made of a first material, wherein the flow-enhancing fabric layer comprises a longitudinal direction and a transverse direction, The flow-enhancing fabric layer further comprises filaments or bundles of fibres made of a second material, which is an electrically conductive material and which are arranged and configured to provide a conductive path from first electrically conductive fibres of a first fibre-reinforcement layer on a first side of the flow-enhancing layer to second electrically conductive fibres of a second fibre-reinforcement layer on a second side of the flow-enhancing layer.
US10723089B2	Method of manufacturing a composite laminate structure of a wind turbine blade part and related wind turbine blade part A method of manufacturing a composite laminate structure of a wind turbine blade part is performed by resin transfer moulding. The fibre-reinforcement material is impregnated with liquid resin in a mould cavity which includes a rigid mould part having a mould surface defining a surface of the wind turbine blade part. The method includes alternately stacking on the rigid mould part: i) a number of fibre-reinforcement layers including electrically conductive fibres and ii) a flow strip layer in form of a layer of flow strips having a strip width and which are arranged so as to form voids having a void width between two juxtaposed strips. The method includes sealing a second mould part against the rigid mould part in order to form the mould cavity, optionally evacuating the mould cavity, supplying a resin to the mould cavity, and curing the resin to form the composite laminate structure.
US10723084B2	Method for producing a tube skirt decorated with an aesthetic lateral weld A method for producing a tube skirt for a flexible tube, said tube skirt being manufactured from a flat strip 1 comprising a decorative film 15 superimposed on a primary film 16, said primary film 16 comprising a sealable inner layer 14 at the lower surface 20 of the strip 1 as well as two stabilizing layers 11, 13, said decorative film 15 comprising a sealable outer layer 7 at the upper surface 19 of the strip 1, and a decorative layer 8, 9. This method comprises the following steps: winding the flat strip 1 into the form of a sleeve to shape the tube skirt; superimposing a first side border 2 of the strip 1 on a second side border 2′ of the strip 1 to form an overlapping area 3, the sealable inner layer 14 of the primary film 16 of the first side border 2 overlapping the sealable outer layer 7′ of the decorative film 15′ of the second side border 2′; applying a heating temperature T2 to the inside of the tube skirt at the inner face 22 of the overlapping area 3 to produce the side weld of the tube skirt; simultaneously with the application of the heating temperature T2, applying compression between the outer 21 and inner 22 faces of the overlapping area 3 so as to finalize the side weld of the tube skirt.
US10723077B2	System to enable folding in an additive manufacturing machine A system is provided for rotating a structure to assume a folded position or an upright position. The structure enables movement of a print head of an additive manufacturing machine along a vertical axis. The system comprises a hub and a second member. The hub comprises a first member defining an arched surface and a plurality of notches. The second member is pressed against the first member by a tensioning member. The hub is operable to be rotated to assume the upright position or the folded position of the structure. Rotation of the hub results in at least a portion of the arched surface to slide against the second member, which is enabled by retraction of the second member. The second member is received by one of the plurality of notches to retain the structure in the folded position or the upright position.
US10723075B2	System and method for automated successive three-dimensional printing A system and method for autonomously creating subsequent physical objects using a 3-dimensional printer. The system includes a build platform that melts or sublimates at a lower temperature and pressure than the glass-transition temperature of the printed object, allowing the printed object to become detached and removed from the build area with minimal force.
US10723072B1	Electrophotographic additive manufacturing process An apparatus for fabricating a 3D object. The apparatus may be comprised of a charged powder transferring system, a first charged powder layer generating device, a second charged powder layer generating device, a powder layer consolidation station, and an object build platform. In operation of the apparatus, a portion of a powder transferring surface of the flexible web traverses a directional change member during cyclic motion, and exceeds a radius of curvature defining a delamination threshold between the powder transferring surface and a first fused slice of the object. The apparatus may include an oven operable to fuse a stack of delaminated fused slices on a support substrate into a fused stack comprising fused second powder material and fused first powder material forming at least a portion of the object. A method of fabricating a 3D object is also disclosed.
US10723071B2	Device and method for generatively producing a three-dimensional object A method for producing a three-dimensional object (2, 10) and a boundary region (8, 9, 18) by layer-wise applying and solidifying of at least one building material, wherein the three-dimensional object (2, 10) is produced with a first generative production method on the basis of a first building material and the boundary region (8, 9, 18) is produced with a second generative production method, which is different from the first generative production method, on the basis of a second building material. The first generative production method comprises the steps: applying a layer of the first building material on a building base (11, 12) or on an already previously applied layer, selectively solidifying the applied layer at positions corresponding to the cross-section of the object (2, 10) in the respective layer and repeating the steps of applying and selectively solidifying until the object (2, 10) is completed. The first and the second generative production method are carried out such that the boundary region (8, 9, 18) encloses the object (2, 10) at least partially.
US10723068B2	Additive manufacturing by selective liquid cooling A method of additively manufacturing parts by selectively cooling a liquefied thermoplastic material.
US10723065B2	Adhesive sheet material application device and method According to one aspect of the present invention, an adhesive sheet material application device is disclosed, which includes a roller support bar, a roller support member, a first and second handle, and a roller. According to another aspect of the present invention, an adhesive sheet material application device is disclosed which includes a roller support member, a roller, and a second handle.
US10723061B2	Method for manufacturing hollow molded article and apparatus for molding hollow molded article While naturally suctioning air between a first thermoplastic resin sheet and a second thermoplastic resin sheet from a fluid passage formed in a first thermoplastic resin sheet, the first thermoplastic resin sheet is subjected to vacuum-molding by a first vacuum molding die, a first shaping section is formed in the first thermoplastic resin sheet by a molded section of the first vacuum molding die, the second thermoplastic resin sheet is subjected to vacuum-molding by a second vacuum molding die, a second shaping section is formed in the second thermoplastic resin sheet by the molded section of the second vacuum molding die, and a hollow section is defined between the first thermoplastic resin sheet and the second thermoplastic resin sheet by the first shaping section and the second shaping section.
US10723058B2	Liquid blow molding apparatus and preform A construction that prevents liquid from dripping from a nozzle and adhering to a product when the nozzle is separated from a mouth of the product after liquid-blow molding. A preform includes a mouth, a body, and a neck support portion, and is provided with a step surface on an inner peripheral face adjacent to the neck support part. A liquid blow molding apparatus includes a nozzle that is inserted in the mouth of the preform, a pressurized liquid-supply unit that supplies pressurized liquid to the nozzle, and a sealing member that is formed in a cylinder and fits on an outer peripheral face of the nozzle abuts the step surface, in an axial direction, when the nozzle is inserted in the mouth of the preform to seal the gap between the nozzle and the inner peripheral face of the preform.
US10723055B2	Polyester-based resin foam and method for producing resin composite A resin composite having excellent strength is easily produced by using a resin foam having a specific surface roughness (Ra) as the core material of the resin composite.
US10723052B2	System and method for forming an oral care implement A system for forming an oral care implement and an oral care implement formed thereby. The system may include a first mold defining a first mold cavity having a first mold cavity axis; first and second injection orifices formed into the first mold and providing passageways directly into the first portion of the first mold cavity, the second injection orifice being spaced apart from the first injection orifice; first and second hot runner sub-systems fluidly coupled to the first and second injection orifices, respectively; wherein the system is configured to dispense the first material into the first portion of the first mold cavity via the first injection orifice, and after passage of a period of time, to subsequently dispense the second material into the first portion of the first mold cavity via the second injection orifice, the second material being injected into the first material to displace the first material.
US10723050B2	Method of manufacturing a window seal assembly with a molded bracket A method of manufacturing a seal assembly for attachment to a vehicle having a securing point spaced from a vehicle point at a distance with an apparatus having first and second receptacles defining a cavity, and a bracket apparatus defining a bracket cavity, including: forming a first strip having a first body with first ends; forming a second strip having a second body with second ends; positioning one first end into the first receptacle with the first body adjacent to the bracket cavity; positioning one second end into the second receptacle; forming a molding bonding the strips together to define a mold point; forming a bracket with a receiver at a receiver point, and an interface bonded to the first body spaced such that a distance between the receiver point of the bonded bracket and the mold point is equal to the distance between the securing and vehicle points.
US10723048B2	Method for a post process treatment for manufacturing at least a part of a molded sporting good The present invention is directed to methods for a post process treatment of a plurality of individual expanded particles for manufacturing at least a part of a molded sporting good, in particular a midsole of a shoe. Furthermore, it is directed to a sporting good and a sports shoe. The method for a post process treatment of a plurality of individual expanded particles for manufacturing at least a part of a molded sporting good, in particular a midsole of a shoe, may include the steps of providing a plurality of expanded particles of a particle foam and controlling a heat treatment to increase the density of the individual expanded particles.
US10723046B2	Surface fastener molding apparatus and its operational method, and a method for producing a surface fastener A surface fastener molding apparatus includes a supporting structure and a second supporting structure for axially supporting a mold roll in a rotatable manner at a first end side and a second end side of the mold roll which is opposite to the first end side. The mold roll includes a circumferential surface in which a plurality of mold cavities for molding engaging elements of the surface fastener is provided. A first linear driving means and second linear driving means are provided which are for, respectively, advancing or retracting the first supporting structure and the second supporting structure. The degree of closeness between the extruding nozzle and the mold roll is regulatable across the first end side and the second end side of the mold roll, based on at least one activation of the first driving means and the second driving means.
US10723042B2	Saw wire and cutting apparatus A saw wire includes a metal wire containing rhenium-tungsten alloy. A rhenium content of the metal wire is at least 0.1 wt % and at most 10 wt % with respect to a total weight of rhenium and tungsten, an elastic modulus of the metal wire is at least 350 GPa and at most 450 GPa, a tensile strength of the metal wire is at least 3500 MPa, and a diameter of the metal wire is at most 60 μm.
US10723041B2	Core drill bit A core drill bit can include a first region and a second region. The first region can include abrasive particles in a first bond matrix, and the second region can include abrasive particles in a second bond matrix. The first region is connected to the second region. A composition of the first bond matrix can be different from a composition of the second matrix. In a particular embodiment, the first bond matric can include a Co-containing material.
US10723039B2	Composite wood panels with corrugated cores and method of manufacturing same A composite wood panel is manufactured from thin wood laminae cut from wood unsuitable for peeler logs or dimensional lumber. A cold set adhesive is applied to the wood laminae and they are formed into a randomly oriented mat that is cold rolled into a thin, pliable cold rolled stock that can be corrugated. A hot set adhesive may also be applied to the laminae to improve strength of the composite wood panel. The hot set adhesive is set in a hot press after the cold rolled stock is produced.
US10723038B2	Device for forming add-on parts The device has a support segment for supporting a workpiece, in particular a flat workpiece, and a carrier segment, in particular a cantilever, a gantry, or an articulated-arm robot, which carrier segment holds a working unit. According to a preferred embodiment, the carrier segment can extend at least partially over the support segment. The working unit, in turn, comprises a feeding unit for feeding a forming material and an attachment segment for a die. According to the invention, the die can be placed against a workpiece and comprises a cavity for forming a component.
US10723032B2	Formation of thin uniform coatings on blade edges using isostatic press The invention discloses utilizing isostatic-press (IP) processes apply a polymeric material (e.g, a PTFE foil) to uncoated razor blade edges forming thin, dense, and uniform coatings on blade edges which in turn exhibit low initial cutting forces correlating with more comfortable shaves. The isostatic press may be a hot isostatic press (HIP) or a cold isostatic press (CIP) or any other isostatic press process. The HIP conditions may include an environment of elevated temperatures and pressures in an inert atmosphere. The CIP conditions may include room temperature and elevated pressure. The polymeric material may be a fluoropolymer or non-fluoropolymeric material or any composite thereof. The lower surface of the polymeric material may be modified (e.g., chemical etching) to enhance adhesion to the blade edge. Two or more layers of polymeric material of similar or different properties may be isostatically pressed onto the uncoated blades.
US10723029B2	Safety protection method of dynamic detection for mobile robots The present invention discloses a safety protection method of dynamic detection for mobile robots. The mobile robot is provided with a sensor. Said sensor obtains the obstacle information in the detection areas in front of a mobile robot, and the mobile robot is caused to progressively slow down and dynamically adjust the detection area when an obstacle appears in the detection area. If no obstacle is detected in the detection area after adjusting, then the mobile robot is caused to keep on moving, and if an obstacle is still detected in the detection area after adjusting, then the mobile robot is caused to keep on decelerating until they are stopped. The sensor sets different detection areas according to the traveling speed and traveling direction of the mobile robot, or presets the detection area according to the path and dynamically adjusts it when the mobile robot is running. The safety protection method of dynamic detection for mobile robots of the present invention enables a mobile robot to pass through a path with many obstacles, having good capability of anti-interference and meanwhile ensuring the consistency of the detection range and processing mechanism at curved and linear paths.
US10723025B2	Computer-implemented methods and systems for generating material processing robotic tool paths In some aspects, computer-implemented methods for selecting a robotic tool path for a manufacturing processing system to execute a material processing sequence in three-dimensional space can include: providing to a computer-readable product including robotic system data of a robotic tool handling system and workpiece data relating to a processing path of a tool along the workpiece; generating a plurality of possible robotic tool paths to be performed to move the tool along the processing path; identifying one or more obstacles, or an absence of obstacles, associated with the robotic tool paths; comparing robotic tool paths based on a predetermined robotic parameter to be controlled as the tool moves from the start point to the end point; and based on the identified obstacles, determining feasible tool paths, between the start point and the end point that avoid the obstacles, that can be obtained by adjusting the predetermined robotic parameter.
US10723023B2	Control device and control method for controlling workpiece moving device and robot to operate in cooperation with each other This control device is able to prevent the position displacement of a workpiece supported by a workpiece moving device. The control device includes a workpiece moving device controller configured to control the workpiece moving device wherein a time constant corresponding to a time period from a commencement to an termination of acceleration and deceleration of the workpiece moving device is longer for causing the robot and the workpiece moving device to perform an operation other than the workpiece processing operation, compared with the time constant for performing a workpiece processing operation in which the robot and the workpiece moving device perform work on the workpiece in cooperation with each other.
US10723022B2	System and calibration, registration, and training methods One variation of a method for manipulating a multi-link robotic arm includes: accessing a virtual model of the target object; extracting an object feature representing the target object from the virtual model; at the robotic arm, scanning a field of view of an optical sensor for the object feature, the optical sensor arranged on a distal end of the robotic arm proximal an end effector; in response to detecting the object feature in the field of view of the optical sensor, calculating a physical offset between the target object and the end effector based on a position of the object feature in the field of view of the optical sensor and a known offset between the optical sensor and the end effector; and driving a set of actuators in the robotic arm to reduce the physical offset.
US10723021B2	Manufacturing device A manufacturing device includes a first hinge defining a first axis of rotation and having an arm connected thereto. A parallel link mechanism includes a second hinge connected to the arm and first and second links pivotably connecting the second hinge to an attachment such that the attachment is vertically movable relative to the second hinge. A nut runner is configured to rotatably drive a fastening tool about a third axis of rotation and is connected to the attachment. A first motor is provided on the first hinge and is configured to horizontally rotate the arm about the first axis of rotation. A second motor is provided on the second hinge and is configured to horizontally rotate the parallel link mechanism about a second axis of rotation that is parallel to the first and third axes of rotation.
US10723018B2	Systems and methods for remote operating and/or monitoring of a robot Systems and methods for remote operating and/or monitoring of a robot are disclosed. In some exemplary implementations, a robot can be communicatively coupled to a remote network. The remote network can send and receive signals with the robot. In some exemplary implementations, the remote network can receive sensor data from the robot, allowing the remote network to determine the context of the robot. In this way, the remote network can respond to assistance requests and also provide operating commands to the robot.
US10723015B1	Tire top tool tray apparatus A tire top tool tray apparatus for storing tools on top of a tire while working on a truck includes a tray body comprising a tray inside. A pair of pivot rods is coupled to the tray body and a pair of legs is coupled to the pair of pivot rods. The pair of legs comprises a left leg and a right leg each having a pair of support arms coupled to a left pivot rod and a right pivot rod, respectively. The pair of legs each has a cross bar extending between the pair of support arms. The pair of legs moves between a collapsed position and an alternate extended position. A plurality of springs is coupled to the pair of pivot rods and applies pressure on the pair of pivot rods to move the pair of legs towards the collapsed position.
US10723013B2	Device for assembling panels An apparatus for assembling a panel, the apparatus including a main support, a press head and a movable stop, where the movable stop has at least two adjustable tensioning elements, a stop element and gripping mechanisms, each of the adjustable tensioning elements including a front end and a rear end, each admitting at least one opening position and one closing position, where the stop element is joined in an articulated way to the front ends of the adjustable tensioning elements, where the gripping mechanisms are joined to the rear ends of the adjustable tensioners, the gripping mechanisms admitting a first position in which the adjustable tensioning elements are configured in the opening position and a second position wherein the adjustable tensioning elements are configured in the closing position.
US10723011B2	Power tool The invention relates to a power tool including a support arm and a tool member supported at a first end of the support arm, where a drive motor at a second end of the support arm is arranged to power a drive belt that drives the tool member. The support arm comprises a frame member and a cover attached to the frame member, wherein the first end of the support arm further supporting a shield at least partially enclosing the tool member. A distance member is arranged between the frame member and the shield and extends radially at right angles to the drive shaft, wherein a radially outer portion of the distance member is spaced a predetermined distance(s) from the shield.
US10723001B2	Ball locking weld nut clamp A multi-stage tooling pin clamp capable of holding weld nuts of different sizes includes a housing having a proximal end, a distal end, and a plurality of longitudinal stages extending between the proximal and distal ends. A plunging pin within the housing and includes a plurality of tapered surfaces configured to radially displace at least one locking ball ring assembly disposed in at least one of the plurality of longitudinal stages of the housing. An actuating mechanism is in communication with the plunging pin configured to move the plunging pin toward the distal end of the housing to displace the at least one locking ball ring assembly radially outward to hold the weld nut, and a restoring mechanism in communication with the plunging pin configured to move the plunging pin toward the proximal end of the housing to release the hold on the weld nut.
US10722999B2	High removal rate chemical mechanical polishing pads and methods of making A chemical mechanical polishing pad for polishing a semiconductor substrate is provided containing a polishing layer that comprises a polyurethane reaction product of a reaction mixture comprising (i) one or more diisocyanate, polyisocyanate or polyisocyanate prepolymer, (ii) from 40 to 85 wt. % based on the total weight of (i) and (ii) of one or more blocked diisocyanate, polyisocyanate or polyisocyanate prepolymer which contains a blocking agent and has a deblocking temperature of from 80 to 160° C., and (iii) one or more aromatic diamine curative. The reaction mixture has a gel time at 80° C. and a pressure of 101 kPa of from 2 to 15 minutes; the polyurethane reaction product has a residual blocking agent content of 2 wt. % or less; and the polishing layer exhibits a density of from 0.6 to 1.2 g/cm3.
US10722995B2	Window for display apparatus, manufacturing method thereof, and manufacturing method of display apparatus A method of manufacturing a window for a display apparatus according to the present invention includes: providing, on a stage, a substrate including a foldable part bending around a folding axis extending in a first direction, and forming a groove on the foldable part. The forming the groove includes: grinding the foldable part by using a first machining wheel; grinding the foldable part by using a second machining wheel; and machining the foldable part by using a polishing wheel. The groove has at least one radius of curvature. The first machining wheel includes first abrasive grains, and the second machining wheel includes second abrasive grains less in size than the first abrasive grains.
US10722992B2	Workpiece placement system for placing workpiece in containment area or on jig A workpiece placement system includes a robot for placing a workpiece in a containment area or on a jig; a sensor for measuring a three-dimensional shape of the containment area or jig; a processor for performing a process to determine a workpiece placement position and a workpiece placement posture based on the three-dimensional shape; and a robot controller for controlling the robot based on the workpiece placement position and the workpiece placement posture. The processor obtains a workpiece shape of the workpiece to be placed; retrieves workpiece placement postures chosen by a user; calculates a vacant area of the containment area or jig based on the three-dimensional shape; calculates workpiece placeable areas that satisfy the workpiece shape and the workpiece placement posture in the vacant area; and determines the workpiece placement position and the workpiece placement posture suitable for placement of the workpiece in the workpiece placeable areas.
US10722991B2	Entrance floor system An entrance floor system is provided. The entrance floor system includes a base mat and a plate. The base mat has opposing bottom and top surfaces. The bottom surface of the base mat is configured to rest on a floor surface. The plate has opposing bottom and top surfaces. The bottom surface of the plate is configured to rest on the top surface of the base mat. The top surface of the plate has a border region and a non-border region. The non-border region is substantially parallel with the bottom surface of the plate and the non-border region has a pattern machined therein. The pattern includes a plurality of slots. At least one slot is configured to receive fluid and debris. The top surface of the plate in the border region includes a transition from the floor surface to the non-border region of the top surface of the plate.
US10722985B2	Method for assessing the structural quality of three-dimensional components A method for assessing the structural quality of three-dimensional components which are produced by laser sintering or laser melting. The component is produced by the successive solidification of individual layers of a construction material solidified by the action of radiation, by sintering or fusing the construction material. The fusion region is captured by a sensor device and sensor values for evaluating the quality of the component are derived therefrom. The sensor values with the co-ordinate values which localize the sensor values in the component are stored with a division of the calculated sensor values into values which are critical to the structural quality of the component and non-critical values to said quality and with a representation of those values critical to the structural quality of the component as to their distance from a reference point lying or arranged in the region of the surface.
US10722983B2	Method for manufacturing semiconductor device A method for manufacturing a semiconductor device includes the steps of: preparing a semiconductor substrate including a first semiconductor layer and a second semiconductor layer; and irradiating the semiconductor substrate with laser light from the first semiconductor layer side to divide the semiconductor substrate into individual semiconductor chips. The first semiconductor layer includes a semiconductor material transparent to the laser light. The second semiconductor layer includes a semiconductor material opaque to the laser light. In the step of irradiating with the laser light, laser light having intensity that makes the semiconductor material of the first semiconductor layer opaque to the laser light is irradiated.
US10722980B2	Laser processing apparatus Disclosed herein is a laser processing apparatus including first and second laser mechanisms, a laser oscillator for oscillating an original laser beam, an optical system for branching the original laser beam into first and second laser beams, and first and second operation panels for respectively setting first and second processing conditions for the first and second laser mechanisms. The first and second laser mechanisms include first and second chuck tables for holding first and second workpieces, first and second X moving units for moving the first and second chuck tables in an X direction, first and second Y moving units for moving the first and second chuck tables in a Y direction perpendicular to the X direction, and first and second focusing units for focusing the first and second laser beams to the first and second workpieces held on the first and second chuck tables, respectively.
US10722975B2	Laser processing device capable of starting laser processing while reducing reflected laser beam A laser processing device for efficiently starting laser processing, while eliminating an adverse effect due to a reflected laser beam from a workpiece. The laser processing device detects an intensity of a reflected beam, which is a part of a laser beam irradiated from a laser oscillator and then is reflected by a workpiece surface, continuously increases an intensity of the irradiating laser beam over a predetermined period of time, selects a content of a next process, based on a temporal change in the intensity of the detected reflected beam, and executes the next process subsequent to the laser processing, based on the selected content of the next process.
US10722970B2	Controlling plasma arc torches and related systems and methods In some aspects, methods for limiting damage to a plasma arc torch body resulting from a consumable failure within the torch can include determining a specified conductivity parameter set point of a current to be provided to the plasma arc torch for a material processing operation; measuring a detected conductivity parameter of plasma arc current being provided to the plasma torch to perform the material processing operation; comparing the specified conductivity parameter set point to the detected conductivity parameter of plasma arc current and calculating an error term signal; and based on a determination that the error term signal exceeds a threshold amount, initiating a plasma arc shut down sequence to extinguish the plasma arc to limit damage to the plasma arc torch body.
US10722965B2	Solder ball supplying method, solder ball supplying device, and solder bump forming method A solder-ball-supplying method, a solder-ball-supplying device and a solder-bump-forming method, which are flux-less and capable of being also applied to electrodes having a fine pitch. A substrate on which a resist with openings is positioned on electrode(s), which has a diameter of 10 through 30 μm, of the substrate is prepared. Next, plural solder balls SBL each having a grain diameter of 1 through 10 μm are shaken down to the opening(s) of the resist from a hopper and filled therein. Next, by sliding and moving a squeegee on an upper surface of the resist along X-Y direction, the solder balls SBL shaken down to the resist other than the openings are scrapped and removed and the solder balls SBL in the openings and around them are pushed into the openings by the squeegee.
US10722962B2	Saw wire and cutting apparatus A saw wire and various methods of use and manufacture are provided. The saw wire includes a metal wire containing at least one of tungsten and a tungsten alloy. A nickel plating layer is provided over the metal wire. An adhesion layer is provided at an interface between the metal wire and the nickel plating layer. The adhesion layer contains nickel and tungsten. A plurality of abrasive particles are provided at a surface of the nickel plating layer.
US10722957B2	Device for cutting structural steels A cutting device for cutting a number of structural steels in series is disclosed. The cutting device may include a cutting mechanism coupled to an actuating mechanism, both mounted on a support frame. The cutting mechanism may include a stationary cutting member having a plurality of openings and a movable cutting member mounted in side-by-side abutment with the stationary cutting member. Each lateral opening on the stationary cutting member is aligned with the corresponding opening on the movable cutting member, thereby forming a single extended opening, which is capable of receiving a workpiece therein. The movable cutting member is movable relative to the stationary cutting member from a first position to a second position. As the movable cutting member moves, it moves the aligned openings of the individual cutting members out of alignment one after another thereby shearing the workpieces in the process.
US10722956B2	End mill and method of manufacturing machined product An end mill includes an end mill body having a bar-shape extending along a rotation axis and including a first end and a second end, a side surface, a first end cutting edge, a second end cutting edge, a first peripheral cutting edge extending from the first end cutting edge, and a second peripheral cutting edge extending from the second end cutting edge. In which, L2 is smaller than L1, where L1 is a distance from the rotation axis to the first peripheral cutting edge, and L2 is a distance from the rotation axis to the second peripheral cutting edge in a cross section orthogonal to the rotation axis. And α2 is greater than α1, where α1 is a rake angle of the first peripheral cutting edge, and α2 is a rake angle of the second peripheral cutting edge.
US10722954B2	Dual cutting milling tools and related methods Dual cutting milling tools for removing material from a workpiece include two cutting portions, with one cutting portion being configured for ruled milling, and the other cutting portion being configured for hemstitch milling. In this manner, the number of tool changes for a given manufacturing process may be reduced. Dual cutting milling tools include a first cutting portion and a second cutting portion both formed in a shank, with the first cutting portion being configured to perform hemstitch milling on the workpiece, and the second cutting portion being configured to perform ruled milling on the workpiece. Methods of removing material from a workpiece may include both hemstitch milling the workpiece with the first cutting portion of the dual cutting milling tool and performing ruled milling of the workpiece with the second cutting portion of the dual cutting milling tool, without changing tools in the milling machine.
US10722948B2	Coated cutting tool A coated cutting tool comprising a substrate and a coating layer formed on a surface of the substrate, the coated cutting tool having a rake surface and a flank, in which the coating layer includes an α-type aluminum oxide layer, wherein: the α-type aluminum oxide layer has, on an opposite side to the substrate, a first interface, being the rake surface or a surface substantially parallel to the rake surface, a second interface, being the flank or a surface substantially parallel to the flank, and an intersecting edge between the first interface and the second interface; and the α-type aluminum oxide layer satisfies −600≤σ11≤300, −900≤σ22≤250 and σ11>σ22. (In the above formulae, σ11 denotes a residual stress value (MPa) in a direction parallel to the intersecting edge, σ22 denotes a residual stress value (MPa) in a direction orthogonal to the intersecting edge, and each of the residual stress values is a value measured by a 2D method).
US10722947B2	Micro-selective sintering laser systems and methods thereof A microscale selective laser sintering (μ-SLS) that improves the minimum feature-size resolution of metal additively manufactured parts by up to two orders of magnitude, while still maintaining the throughput of traditional additive manufacturing processes. The microscale selective laser sintering includes, in some embodiments, ultra-fast lasers, a micro-mirror based optical system, nanoscale powders, and a precision spreader mechanism. The micro-SLS system is capable of achieving build rates of at least 1 cm3/hr while achieving a feature-size resolution of approximately 1 μm. In some embodiments, the exemplified systems and methods facilitate a direct write, microscale selective laser sintering μ-SLS system that is configured to write 3D metal structures having features sizes down to approximately 1 μm scale on rigid or flexible substrates. The exemplified systems and methods may operate on a variety of material including, for example, polymers, dielectrics, semiconductors, and metals.
US10722946B2	Methods of fabricating turbine engine components Methods are provided that include depositing a nickel-base superalloy powder including gamma nickel solid solution and gamma prime (Ni3Al) solid solution phases onto a seed crystal having a predetermined primary orientation, fully melting the powder and a portion of the seed crystal at a superliquidus temperature to form an initial layer having the predetermined primary orientation, heat treating the layer at subsolvus temperatures to precipitate gamma prime solid solution phase particles, depositing additional powder over the layer, melting the deposited powder and a portion of the initial layer at a superliquidus temperature to form a successive layer having the predetermined primary orientation, heat treating the layer at a subsolvus temperature to precipitate gamma prime solid solution phase particles, and repeating depositing additional powder, melting the additional powder and the portion of the successive layer at the superliquidus temperature, and heat treating the successive layer at a subsolvus temperature.
US10722944B2	Additive manufacturing system and method for additive manufacturing of components A system for the additive manufacturing of components includes a powder receptacle, which is designed to receive a powdered material in the form of a starting material for a component to be manufactured, a construction platform that is mounted within the powder receptacle and is mounted so as to rotate relative to the powder receptacle about a rotational shaft, a lowering drive, which is designed to incrementally or continuously lower the construction platform within the powder receptacle, and an energy input apparatus, which is arranged above an opening in the powder receptacle and is designed to carry out locally selective melting or hardening of a powdered material introduced into the powder receptacle on a surface of the material. The construction platform can be tilted by an angle of inclination relative to a rotational shaft of the rotatable mount.
US10722943B2	Additive manufacturing method A method of making an article is disclosed involving determining a plurality of patterns of discrete sections for a plurality of layers of fusible material. According to the method, the patterns are determined having section boundaries that avoid alignment with section boundaries of other layer patterns among the plurality of patterns according to criteria specified for the article. Layers of fusible material are repeatedly fused with an energy beam applied in a scanning pattern to each of the discrete sections sequentially for each of the plurality of patterns in the plurality of layers.
US10722941B2	Automated gate cutting system A system for separating a part from a monolithic tree includes a camera positioned facing the tree and configured to identify a cut mark on a gate of the tree; and a cutter configured to cut the part from the tree at the cut mark. A method for separating a part from a monolithic tree includes marking the tree with a cut mark; identifying the cut mark with a camera; determining an orientation and a position of the cut mark; determining an orientation and a position of the tree from the orientation and the position of the cut mark; transmitting information on the orientation and position of the tree from the camera to a cutter; and cutting the part from the tree.
US10722939B2	Production of multi-passage hollow casting A method of fabricating a casting is provided. The method includes creating a mixture of ceramic powder and a binder, pouring the mixture around sacrificial patterns, executing a first thermal treatment to set the mixture into a solid mold without damaging the sacrificial patterns, executing a second thermal treatment to remove the sacrificial patterns without removing any of the binder from the solid mold, executing at least one of a third thermal treatment and a chemical treatment to remove a quantity of the binder to transform the solid mold into a solid breakaway mold and pouring molten metallic material into the solid breakaway mold.
US10722935B2	Mechanical joining apparatus and mechanical joining method Provided is a mechanical joining apparatus enabling stable riveting when joining metal sheets even when the sheets are large in deformation resistance, the apparatus comprising a punch and die, blank holder and power device, wherein the punch and die are arranged facing each other, the holder is configured by an electrode material able to push against and electrically heat the sheets by one end of the holder, the punch is comprised of a material able to drive in a rivet, the die is comprised of an electrode material able to support and electrically heat the sheets, and the power device is configured to start supply of current through the holder and die so as to raise the temperature of the sheets at the same time as the start of driving in of the rivet and to continue to supply current until the end of driving in of the rivet.
US10722932B2	Method of fabricating a one-piece metal vehicle wheel by hydro forming process A new method of building a vehicle wheel utilizing “hydro forming” from a solid piece of steel metal sheet.
US10722930B2	Cooling of dies using solid conductors Dies for forming components, such as sheet components, and methods of producing the dies are disclosed. The die may include a bulk material and a forming surface. A solid conductor may be formed in the bulk material. The solid conductor may be spaced from and extend adjacent to the forming surface and have a melting point that is greater than a melting point of the bulk material. The solid conductor may be configured to absorb heat from the forming surface. There may multiple solid conductors within the bulk material, for example spaced apart and extending along an axis. The solid conductor may be a bundle of carbon fibers, which may be pitch-based. The solid conductor may be conformal to the forming surface, for example, having a constant spacing therefrom. The solid conductor may be cast-in to the die during its production.
US10722929B2	Cooling of a metal strip using a position-controlled valve device To cool a metal strip (1), liquid coolant (5) is supplied to the strip by a supply device (9) from a feed line (10). A valve (13) in the feed line (10) sets the valve (13) to a respective opening position (s) for adjusting the coolant flow (F) to the metal strip (1) per unit of time. An upstream condition detection device (14) upstream of the valve device (13) in the feed line (10) detects an upstream condition (ZV) of the coolant (5). A control unit (6) determines a set point (s) for an opening position (s) of the valve device (13) corresponding to the set point (F) for the coolant flow (F) based on a set point (F) for the coolant flow (F), the upstream condition (ZV) of the coolant (5) and a valve characteristic (C) of the valve device (13). The valve characteristic (C) follows a characteristic curve (K) of the coolant flow (F) as a function of the opening position (s) of the valve device (13), relative to a reference condition (ZR) of the coolant (5) upstream of the valve device (13) in the feed line (10). The control unit (6) sets the opening position (s) of the valve device (13) according to the set point (s*) that has been determined.
US10722922B2	Sorting cast and wrought aluminum A material sorting system sorts materials utilizing a vision system that implements a machine learning system in order to identify or classify each of the materials, which are then sorted into separate groups based on such an identification or classification determining that the materials are composed of either wrought aluminum or cast aluminum.
US10722921B2	Systems, devices, and methods for sorting items Sorting systems and methods for large quantities of items in industrial processes are described. The systems, devices and methods are for receiving, sorting and removing items dynamically. A first group of items, such as letters or other mail pieces, are injected by a belt into a pocket to a form a first stack, and a divider is extended near the first stack. The divider allows for a second group of items to either be injected to form a second stack behind the divider, or to be diverted and injected into another pocket. The first stack can be removed while the second group is being injected.
US10722918B2	Release hole plus contact via for fine pitch ultrasound transducer integration Methods, systems, computer-readable media, and apparatuses for high density Micro-Electro-Mechanical Systems (MEMS) are presented. In some embodiments, a method for manufacturing a micro-electro-mechanical device on a substrate can comprise etching a release via through a layer of the device. The method can further comprise creating a cavity in the layer of the device using the release via as a conduit to access the desired location of the cavity, the cavity enabling movement of a transducer of the device. The method can then comprise depositing low impedance, electrically conductive material into the release via to form an electrically conductive path through the layer. Finally, the method can comprise electrically coupling the electrically conductive material to an electrode of the transducer.
US10722915B2	Valve A valve (100, 200, 300) includes a material with a first side surface (114, 214), a second side surface (116, 216), defining between them a thickness of the material. The material includes at least two self-sealing slits (126, 130, 226, 230) extending through the thickness and includes at least one frangible portion (150, 250) extending laterally between the at least two slits (126, 130, 226, 230) for at least part of said thickness of the material. The material includes confronting, openable portions along the at least two slits (126, 130, 226, 230) to define a normally closed orifice to minimize communication through the valve (100, 200, 300). The openable portions are constrained by the at least one frangible portion (150, 250) from moving away from each other into an open condition.
US10722907B2	Splash water outlet mechanism A water outlet mechanism, includes at least two diversion waterway sets connected to the water source and an outlet, each diversion waterway set has at least two diversion waterways and at least two water diversion passages; water from the at least two diversion waterways impact and converge and then enter the water diversion passages, the flowing direction of the at least two water diversion passages intersect, and water from the at least two water diversion passages impact and then spray out of the outlet. Water from at least two diversion waterways impacts and converges and then enters the water diversion passage, the water particles are refined and shaken; the direction of the at least two water diversion passages intersect, and water in the cavity of the inlet impact again to form wavy water type and then sprays out of the outlet.
US10722905B2	Paint roller cover cleaner A paint roller cover cleaner including an enclosure for a roller cover, a high pressure pump and a nozzle supplied with pressurised fluid which directs a jet of fluid at the nap of the roller cover to rotate the roller cover and facilitate cleaning. In one embodiment a carriage moves the nozzle along the length of the roller cover to effect cleaning along the length of the roller cover. In another embodiment a plurality of controllable nozzles are provided at intervals along the length of the roller cover. In another embodiment the nozzle includes an inner sleeve and an outer sleeve which relatively rotate to align apertures in the respective sleeves to produce jets sequentially along the nozzle.
US10722899B2	Vertical roller mill Provided is a vertical roller mill equipped with a rotary classifier for causing a plurality of classification blades provided above a rotary table and positioned around an axis to rotate about the axis, wherein: of a solid fuel pulverized by a roller, the rotary classifier guides solid fuel fine powder from an outer-circumferential-side space to an inner-circumferential-side space surrounded by the plurality of classification blades, and suppresses, by collision with the plurality of classification blades, an intrusion of solid fuel coarse powder into the inner-circumferential-side space; and each of the plurality of classification blades is shaped in a manner such that there is no interference between a scattering direction in which the coarse powder that collided with the classification blades scatters and an intake direction in which the fine powder is guided to the inner-circumferential-side space, and the scattering direction is oriented upward relative to a horizontal direction.
US10722897B2	Device for communication of process feed material with upstream sifting A device for the comminution of free-flowing feed material is provided that includes a housing enclosing a comminution chamber which contains a rotor that rotates around an axis, and has comminution tools over its circumference. A feeding device to transport the feed material to the comminution chamber in form of a gas-solid matter mixture, wherein the feeding device features a pneumatic sieve passage which uses the effect of gravity for removal of foreign particles from the feed material. In order to operate both the sieve passage and the device under optimal process parameters, the device features at least one inlet port for the supply of secondary air, wherein the at least one inlet port flows into the gas-solid matter mixture downstream of the sieve passage.
US10722895B2	Cone crusher The present disclosure provides a generally cylindrical bowl support for a cone crusher which includes a plurality of evenly, circumferentially spaced ears around the periphery of the support. The ears are designed to have clamping cylinders mounted thereto to provide protection from tramp iron and the like passing through the cone crusher. A plurality of thickened ribs are defined in the support, at least some of the thickened ribs extending downwardly from the ears to form abutting polygon configurations to spread and absorb forces from a crushing operation. Other ones of the ribs define at least one circumferentially-extending, continuous ring forming portions of the polygons.
US10722894B2	Tooth block for a demolition tool A tooth shroud for a demolition tool is disclosed wherein forces produced during demolition operations may be dissipated so as to avoid excessive forces at stress points. A tooth block for a demolition tool comprises a first tooth shroud and a second tooth shroud. The first and second tooth shroud each comprising a body having a front wall and an end wall wherein a cavity is enclosed by the front wall and the end wall; an impact member extending longitudinally from the body; and a cut-out disposed on the end wall, wherein the first tooth shroud is connected to the second tooth shroud.
US10722893B2	Mounting and heating mechanism of sample collection containers A mounting and heating mechanism of sample collection containers for heating sample collection containers includes cup-shaped container heat transfer members for heating sample collection containers from the bottom surface and the side surface, a plate-like bottom surface member heated by a heater, frame members attached to an upper side of the bottom surface member and vertically movably storing the container heat transfer members, and sheet-like elastic heat transfer member disposed between the bottom surfaces of the container heat transfer members stored in the frame members and the upper surface of the bottom surface member.
US10722883B2	Splittable fluid sample collector A splittable fluid sample collector for dividing a fluid sample into two or more portions, includes at least first and second fluid collector portions detachably connected to one another, each of the fluid collector portions including a handle and an absorbent sample pad affixed to an end of the handle. Further, a fluid sampling apparatus includes the aforementioned splittable fluid sample collector, at least one container and a closure for the container. Still further, a method for splitting a fluid sample including providing the aforementioned splittable fluid sample collector, collecting a fluid sample with the absorbent sample pads of the splittable fluid sample collector and splitting the first and second fluid collector portions of the splittable fluid sample collector from one another.
US10722881B2	Centrifugation device, centrifugation method, and separation container The present invention relates to a centrifugation device, a centrifugation method, and a separation container. More particularly, the present invention relates to a centrifugation device for separating substances from a body fluid and tissue using centrifugal force, the centrifugation device including: a separation container configured to receive, centrifuge, and clean a body fluid and tissue therein and rotate around a central rotation axis; a supply part connected to the separation container and configured to supply a cleaning solution to the separation container; a discharge part connected to the separation container and configured to receive substances separated by centrifugation; valves configured to control flows between the supply part, the discharge part, and the separation container; a driving device configured to rotate the separation container, the supply part, and the discharge part around the central rotation axis, the driving device being installed in a direction perpendicular to the separation container, the supply part, and the discharge part; and a controller configured to control an operation of the driving unit, wherein the separation container includes: a piston located outside in a radial direction based on the central rotation axis; and an elastic part placed on an outer side of the piston in the radial direction to push the piston in a direction opposite a centrifugal force direction.
US10722878B1	Weak ion exchange particulate medium prepared from phenol-containing organic matter for anions contained in aqueous solutions A process for the preparation of a granulated or pelletized weak anion exchange medium from a phenol-containing organic material like peat, followed by low-temperature torrefaction of the granules to produce a high degree of physical stability of the granules at high-pH conditions, followed by chemical pretreatment of the stable granule via a hydrolysis reaction, and optionally surface treatment with acids, followed by the main chemical treatment of the hydrolyzed granule via separate aldehyde and amine reagents, or alternatively via an adduct reagent like hexamethylenetetramine is provided by this invention. The weak anion exchange medium of this invention can be used in a variety of aqueous solution treatment processes, such as wastewater treatment for removing mineral acids like H2SO4, HNO3, HCl, HBr, HF, H3PO4, HI, or formic acid from the wastewater. The resulting anion exchanger medium is particularly useful for treating wastewaters in a low-pH environment.
US10722877B2	Honeycomb structure A honeycomb structure includes a pillar-shaped honeycomb structure body having porous partition walls, wherein the partition walls have projecting portions, the projecting portions include specific projecting portions in which side surfaces have a divergent shape inclined at an inclination angle of 40 to 70°, a relation of 0.04≤H/A≤0.40 is satisfied, a relation of 0.04≤H1/A≤0.38 is satisfied, the height H of the specific projecting portion and the height H1 of the hem satisfy a relation of H1
US10722874B2	Methods of preparing a catalyst utilizing hydrated reagents A method comprising a) contacting a solvent, a carboxylic acid, and a peroxide-containing compound to form an acidic mixture wherein a weight ratio of solvent to carboxylic acid in the acidic mixture is from about 1:1 to about 100:1; b) contacting a titanium-containing compound and the acidic mixture to form a solubilized titanium mixture wherein an equivalent molar ratio of titanium-containing compound to carboxylic acid in the solubilized titanium mixture is from about 1:1 to about 1:4 and an equivalent molar ratio of titanium-containing compound to peroxide-containing compound in the solubilized titanium mixture is from about 1:1 to about 1:20; and c) contacting a chromium-silica support comprising from about 0.1 wt. % to about 20 wt. % water and the solubilized titanium mixture to form an addition product and drying the addition product by heating to a temperature in a range of from about 50° C. to about 150° C. and maintaining the temperature in the range of from about 50° C. to about 150° C. for a time period of from about 30 minutes to about 6 hours to form a pre-catalyst.
US10722870B2	Exhaust gas purification catalyst Provided is a novel exhaust gas purification catalyst, which uses a Cu-based delafossite oxide, capable of increasing the exhaust gas purification performance compared to the case of using the Cu-based delafossite oxide alone. Proposed is an exhaust gas purification catalyst comprising a delafossite-type oxide represented by a general formula ABO2 and an inorganic porous material, wherein Cu is contained in the A site of the general formula of the delafossite oxide, one or two or more elements selected from the group consisting of Mn, Al, Cr, Ga, Fe, Co, Ni, In, La, Nd, Sm, Eu, Y, V, and Ti are contained in the B site thereof, and Cu is contained in 3 to 30% relative to the total content (mass) of the delafossite-type oxide and the inorganic porous material.
US10722868B2	ZnWO4 photocatalytic material with oxygen vacancy and preparation method thereof The invention belongs to the field of novel photocatalytic materials, and particularly relates to a ZnWO4 photocatalytic material containing oxygen vacancy. According to the material, absorption exists in a near infrared region of an ultraviolet-visible light diffuse reflection spectrum, wherein the wavelength range of the near infrared region is 780-2500 nm. The invention further relates to a preparation method of the ZnWO4 photocatalytic material containing oxygen vacancy. Na2WO4 and soluble zinc salt are used as raw materials, ZnWO4 crystals are formed through a hydrothermal crystallization reaction and then roasted in the presence of hydrogen so as to achieve partial reduction of ZnWO4, and then the ZnWO4 photocatalytic material containing oxygen vacancy is obtained.
US10722866B2	Titanium oxide film and structure A titanium oxide film by continuous titanium oxide, includes a metallic compound that has a metal atom and a hydrocarbon group and is bonded to a surface of the film, in which absorption occurs at wavelengths of 450 nm and 750 nm.
US10722864B2	Manganese dioxide nanowire @ multidimensional mesoporous metal-organic framework adsorbent and preparation therefor A manganese dioxide nanowire @ multidimensional mesoporous metal-organic framework adsorbent and application method thereof for removing heavy metals from water. A multidimensional mesoporous metal-organic framework material is prepared from metal ions and organic ligands by means of a self-assembly reaction; a manganese dioxide nanowire is prepared from manganese salt and thiosulfate by means of reaction in a reaction kettle. The adsorbent possesses not only the characteristics of a multidimensional mesoporous metal-organic framework material, such as reticulated pore adaptation, a large specific surface area, and abundant reaction sites, but also the oxidative and catalytic properties of manganese dioxide nanowire.
US10722861B2	Reactor system for use with an ionic liquid catalyst Reactor systems for use with ionic liquid catalyst. The reactor systems include one or more stages, which include a reactor and a heat exchanger, and a separation zone. The reactor and the heat exchanger may have a vertical orientation. Additionally, a separation vessel may also include a vertical orientation. The heat exchanger may allow for linear flow of process fluid to control residence time.
US10722860B2	Mixing reactor and related process A mixing reactor for precipitating nanoparticles by mixing a precursor fluid with a second fluid at a higher temperature than the precursor fluid. The reactor comprises: a first fluid conduit with an inlet region configured to receive a flow of the precursor fluid, and an outlet region configured to output a mixed flow; and a second fluid conduit configured to receive a flow of the second fluid. The second fluid conduit extends into the first fluid conduit in a direction substantially perpendicular to the flow within the first fluid conduit, and has an opening for introducing the second fluid into the first fluid conduit. Related processes for producing nanoparticles are disclosed.
US10722846B2	Method and system for cleaning membrane filters The disclosure relates to a system and method for cleaning filters, such as membrane filters. More particularly, a method and system are disclosed for retaining a plurality of small particulates, preferably in the shape of beads, which contact sludge or other despots on the membrane filters to remove unwanted debris that would otherwise form on the cleaning filters. In various embodiments, the plurality of small particulates are retained in a permeable enclosure formed of wedgewire.
US10722844B2	Selective catalytic reduction process and method of regenerating deactivated SCR catalyst of a parallel flue gas treating system Presented is a process for the regeneration of a deactivated nitrogen oxide decomposition catalyst of a selective catalytic reduction system that is a component of a flue gas treating system that is one of parallel flue gas treating systems. The selective catalytic reduction system is isolated to provide a closed system in which a regeneration gas is circulated to regenerate the deactivated nitrogen oxide decomposition catalyst. Denitrified flue gas from a parallel flue gas treating system is introduced and used within the closed system as regeneration gas.
US10722837B2	Capture and release of acid gasses using tunable organic solvents with aminopyridine A class of water lean, organic solvents that can bind with various acid gasses to form acid gas bound molecules having a high degree of intramolecular hydrogen bonding which enables their use as regenerable solvents for acid gas capture. Unlike the other devices described in the prior art, the present invention takes advantage of shortened distances between the portions of the molecule that form hydrogen bonds within the structures when loaded with an acid gas so as to create a molecule with a higher internal bonding affinity and a reduced proclivity for agglomeration with other molecules.
US10722836B2	Hydrogen recovery method Provided is a hydrogen recovery method such that highly concentrated hydrogen gas can be obtained efficiently by adsorbing and removing hydrocarbon gas such as carbon dioxide, carbon monoxide, and methane, using a relatively low pressure, from pyrolysis gas obtained by heat treating biomass. The present invention is the method for recovering hydrogen from pyrolysis gas obtained by heat treating biomass, characterized by including: a first purifying step of adsorbing and removing gas that mainly includes carbon dioxide under pressure from the pyrolysis gas to purify the pyrolysis gas; and a second purifying step of further adsorbing and removing gas that includes carbon dioxide under pressure from purified gas obtained by the first purifying step at a pressure lower than the pressure in the first purifying step to purify the purified gas in order to recover hydrogen from the purified gas.
US10722835B2	Method and device for the reversible adsorption of carbon dioxide The present invention relates to a device for the reversible adsorption of carbon dioxide from a gas mixture, comprising at least one adsorbent vessel comprising one or a plurality of gas permeable cartridge vessels of an inert and dimensionally stable material, and each cartridge comprising a suitable polymeric particular adsorbent having a primary amino functionality; to an arrangement including the device, and to a method for ad- and desorption of carbon dioxide.
US10722832B1	Dust removal system A compact dust removal system that can be mounted on a substantially rigid receptacle, such as a pail, found at construction sites. The compact dust removal system includes an array of cyclonic separators of different sizes disposed within a mesh filter. The system can be mountable to a pail such that an initial dust removal stage occurs by inertial separation along the interior surface of the pail. The system further includes a cyclone inlet manifold configured to distribute dust-laden air among the cyclonic separators at least partially based on the size of dust particles within the dust-laden air.
US10722830B2	Integrated pitot tube and fluid pickup port in rotary separator A rotary separator includes a drum configured to rotate, and a pickup member extending into the drum. The pickup member includes a pickup channel having a first inlet for receiving a liquid, and a pitot channel having a second inlet for receiving the liquid. The liquid exits the drum through the pickup channel in response to a pressure of the liquid being measured through the pitot channel. A valve may be coupled to the pickup channel. A pressure sensor may be coupled to the pitot channel.
US10722828B2	Water container with floatable filter system and method A portable drinking water filter system, such as a pitcher, having a sleeve and a floatable body including a filter opening configured to receive a water filter, the floatable body having a seal extending outward from an outer surface of the floatable body. The floatable body is disposed in a sleeve cavity such that a body seal engages the sidewall and restricts water from passing between the floatable body and the sidewall. The seal is configured to create friction with the sidewall, wherein the friction created when the floatable body rises in the sleeve is different than when the floatable body lowers in the sleeve. The friction created when the floatable body rises in the sleeve is greater than when the floatable body lowers in the sleeve, allowing the floatable body to auto-retract toward a cavity base without burping.
US10722817B2	Oil/water separator with compressed air charging An oil/water separator for removing oil-containing constituents from an oil/water mixture includes a main filter designed to separate oil-containing constituents from the oil/water mixture. Untreated oil/water mixture is supplied to the main filter and is removed from the oil/water separator after passing through the main filter, wherein the oil/water separator is designed for supply and removal of these liquids in accordance with the hydrostatic principle. The oil/water separator has a control unit designed to temporarily charge the oil/water separator with control air, by means of which overpressure can be used to push oil/water mixture through the main filter.
US10722814B2	Continuous extraction unit and double phase change heat exchanger and method for continuous extraction Continuous extraction units (CEUs) are constructed that allow switching of extraction chambers (ECs) that contain extractable material (EM) and extract solution. Extraction chambers can be removable and replaceable, where the CEU has a fluid flow portion and a liquid transfer portion. Quick-connect valves allow exchange of ECs in the CEU while under flow without solvent loss. Alternatively, the CEU employs pairs of ECs where a first EC at equilibrium partitioning of an extract solution drains to an expansion chamber (EXC) with an expansion valve (EV) and a heat transfer tube situated proximal to or shared with a solvent condenser (SC) to form of a double phase change heat exchanger (HE). Solvent from the SC fills a paired EC containing EM. A second pair of ECs has a first EC with EM and solvent establishing equilibrium and a second EC that is emptied of spent EM, filled with fresh EM, and readied to receive solvent.
US10722810B1	Method for low temperature, reduced pressure, distilled beer spirits and concentrates from finished beer and beer residues A distillation system/method for distilling finished beer and beer residues into spirits or non-alcoholic concentrates employs distillation under low temperature(s) via vacuum pressure to beneficially prevent degradation of the base product to further beneficially capture volatile compounds that are distinctly “of beer” (or indicative of other base compounds) aroma and flavor in the final distilled product. The system also distills and separates valuable volatile components, such as hop oils, from beer waste without degradation or contamination of the flavors, thus allowing for their use, reclamation and repurposing. The system/process maintains the quality of beer through the entire distillation process, thus creating spirits and concentrates of higher quality that contain the distinct character of the beers (or other base compound) from which they originate.
US10722809B1	Toy block The present disclosure relates to a toy block, and the toy block includes a main body, a plate-shaped magnetic body located in an accommodation space in the main body and including a first surface and a second surface having different polarities, and a guide part disposed in the accommodation space and configured to guide rotation of the plate-shaped magnetic body.
US10722808B2	Nested counterweight for a rotatable performance device A nested counterweight for a rotatable performance device includes an outer housing and an inner slider. The outer housing defines an interior volume and is configured to be positioned along a string of the rotatable performance device. The inner slider is also configured to be positioned along the string of the rotatable performance device. The inner slider is positioned within the interior volume on the outer housing in a nested configuration. The inner slider is positioned along the string away from the outer housing in a separated configuration.
US10722806B2	Amusement park ride tunnel A ride system includes a tunnel, a vehicle ride path, a ride vehicle, and a projection system. The tunnel includes a first end and a second end and is curved between the first and second ends. The vehicle ride path extends within the tunnel from an entrance at the first end of the tunnel to an intermediate position within the tunnel. The second end of the tunnel is not visible from the intermediate position. The ride vehicle travels along the vehicle ride path and decelerates as the ride vehicle approaches the intermediate position. The projection system projects images onto one or more walls of the tunnel, such that the images are synchronized with the deceleration of the ride vehicle and a perceived speed of the ride vehicle, as perceived by a guest in the ride vehicle, exceeds an actual speed of the ride vehicle.
US10722804B2	Wraparound peripheral device grip A wraparound peripheral device grip comprising a substantially flat continuous sheet is provided. The grip includes a first side and a second side. The first side is configured to adhere to a grip of a peripheral device and the second side is configured to provide improved gripping to a user of the peripheral device. The substantially flat continuous sheet can be cut to fit a geometry of a particular model of peripheral device, or gaming controller. The wraparound peripheral device grip is capable of being placed onto a peripheral device by wrapping the grip around the factory surfaces of a peripheral device. The gripping friction of the grip can be achieved by disposing abrading particles thereon, such as sandpaper, silicon carbide, or grip tape material. Alternatively, the grip side can be made from an elastomer, such as a synthetic rubber, or other material with the property of viscoelasticity.
US10722803B2	Integrated chat and game play platform A system incorporates a managing server executing software on a processor, game servers serving video games, a plurality of network-connected mobile computerized appliances in use by persons to play games served by the game servers; and software executing on processors of the computerized appliances. Software at the computerized appliances provides interactive interfaces, enabling a first player launch a chat session through the managing server with one or more other players, enabling any one of the players in a chat session to associate a game served by one of the one or more game servers with the chat session, and enabling players in the chat session to enter the game associated with the chat session, and to leave the game and return to the chat session.
US10722793B2	Synchronization model for virtual tournaments Data characterizing two players enrolled in a tournament of an online video game is received. Each player is executing a separate instance of the online video game. The online video game is asynchronous between the two players. The data is received by a tournament server hosting the tournament and separate from a game server providing game data to clients associated with the two players. An instruction for synchronous initiation of gameplay between the two players is generated. The instruction is transmitted to the clients associated with the two players, the instruction causing synchronous initiation of the asynchronous games for the two players. Related apparatus, systems, techniques and articles are also described.
US10722791B2	Method for multicasting views of real-time streaming interactive video Systems and methods for creating and delivering an interactive display of thumbnail windows of visual content of different video game sessions are presented. In one embodiment, a method provides for sending, by a server of hosting service, an interactive interface for display on display of a client device. The interactive interface has an array of thumbnail windows and each thumbnail window depicts visual content of different video game sessions being played. Responsive to a selection of a thumbnail window by a user of the client device, the method provides for sending a video stream associated with the selected thumbnail window from the array of thumbnail windows. The video stream enables the user of the client device to view interactive game play of a video game associated with the video stream.
US10722789B2	Integrated game development cloud computing platform In various embodiments, methods and systems for game development based on an integrated game development cloud computing platform are provided. Development components that facilitate game development using an integrated game-cloud component are initiated. An input is received to perform a game development task. The game development task is associated with one or more games. The game development task is executed using the integrated game-cloud component. The integrated game-cloud component comprises a game-development-platform development component and a cloud-computing-platform development component combined into an integrated development component supported on the integrated game development cloud computing platform. The game development task can be associated with a first game-platform and a second game-platform of a selected game. The game-platform functions with a cross-platform support component having an integrated core module and an integrated game-platform module.
US10722788B2	Systems and methods for managing latency in networked competitive multiplayer gaming Systems for managing latency in networked competitive multiplayer gaming may include a latency management server that coordinates communications between game clients and game servers that enable a player to engage in a competitive multiplayer game, as well as other systems that balance the playing field, such as handicapping systems. Exemplary games may include, for example, first-person shooter games, real-time strategy games, fighting games, multiplayer online battle arena games, and the like. The latency management server may analyze network characteristics of the clients and servers and determine an appropriate server for each client or sets of clients. In some embodiments, the latency management server may add latency to particular communications to balance response times between all clients, provide a latency advantage to one or more clients, and the like. Scoring systems may implemented based on in-game actions, and scoring may be weighted based on latencies. Other implementations also are described.
US10722786B2	Video game controller with unitary back shell for button control and battery access A hand-held video game controller includes a controller body having a front and a back, with at least one front control on the front of the controller body. A removable and resilient unitary back shell is removably attached to the back of the controller body. At least one back control button underlies the unitary back shell, and is depressible by flexing of the unitary back shell into contact with that back control button. At least one battery compartment may underlie the unitary back shell, and may be accessible by removal of the removable unitary back shell.
US10722785B2	Information processing system, program, server, terminal, and medium A card has a plurality of contact points attached on the same face thereof, the plurality of contact points being detectable by a detecting method for a touchscreen. In the case where the card is placed on the touchscreen, a recognition unit recognizes a kind of the card and a relative position and orientation of the card relative to the touchscreen on the basis of at least some of the plurality of contact points detected by the touchscreen. On the basis of the results of recognition by the recognition unit, a determining unit determines a relevant image to be displayed on the touchscreen and determines a size, position, and orientation for displaying the relevant image on the touchscreen.
US10722776B1	Timing apparatus for timing competitions Systems, methods and devices for timing manual dexterity and hand-eye coordination competitions are provided. In various embodiments, the present disclosure relates to an apparatus and method for timing cup stacking competitions. The present disclosure includes a timer for timing various competitions and wherein the timer comprises a plurality of trigger points or touch points to ergonomically require a user to perform certain actions to activate and operate the timer.
US10722775B2	Robotic training systems and methods A robotic athletic training system may include a mobile robotic platform, a sensor module associated with the mobile robotic platform and configured to obtain data from an environment. The system may include a drive system that propels the platform, as well as a steering system that steers the platform. The system may include a processor which receives data from the sensor module and control the drive system or steering system to follow a path based on the data received from the sensor module. A method may include controlling a robotic athletic training system (or robotic training platform) so that it moves at a velocity. The robotic athletic training system may include a vision system configured to receive data related to a surface and compare a baseline data of a desired surface to the received data and adjusting a travel direction of the robotic system in response to the comparison.
US10722770B1	Precision real-time laser measurement and marking apparatus A precision real-time laser measurement and marking apparatus is provided. the disclosure also relates to the multiple components of the precision real-time laser measurement and marking apparatus in accordance with an embodiment of the present disclosure. The multiple components of precision real-time laser measurement and marking apparatus are as follows: the main housing; the foam spray can; the universal clip; and the fully assembled precision real-time laser measurement and marking apparatus. A method of using a precision real-time laser measurement and marking apparatus is provided. The method comprising pressing a distance measurement button while aiming an apparatus at a target; displaying an exact distance measurement on a LED screen wherein the exact distance measurement is the distance between the target and the apparatus; determining the exact distance measurement matches a desired distance; and marking a distance boundary using a spray nozzle of the apparatus.
US10722769B1	Cart-attachable mobile golf bag Disclosed is a cart-attachable mobile golf bag, in which the golf bag is configured such that a head cover is detachably attached to an upper portion of a bag body storing golf clubs therein, and the golf bag is attached to a cart in a docking manner by engagement between a docking recess of the golf bag and a docking block of the cart inserted into the docking recess in a one-touch manner, thus making it possible that the golf bag is simply and firmly attached to the cart without requiring any separate tying process. In particular, the golf bag has a hard-shell structure, thus being safe even without requiring a separate wrapping cover when transported by air while being excellent in durability, and further the golf bag provides various storage spaces for storing various equipment other than golf clubs, thus being excellent in use efficiency.
US10722768B1	Golf putter head and putter The disclosure relates to a golf putter head and a golf putter including the putter head. The golf putter head comprises a putter head having a hitting face on which a hitting unit is distributed. The rigidity of the hitting unit is increased from the middle to both sides in the width direction of the hitting face. The golf putter comprises a putter shaft and a putter head coupled to putter shaft.
US10722765B2	Golf club heads and methods to manufacture golf club heads Embodiments of golf club heads and methods to manufacture golf club heads are generally described herein. In one example, a golf club head may include a body portion having a front portion, a rear portion, a toe portion, a heel portion, a top portion, and a bottom portion. The front portion may include a front pocket defined by an interior wall. A face portion may be positioned in the front pocket. The material of the face portion may have a substantially higher yield strength than the material of the interior wall. Other examples and embodiments may be described and claimed.
US10722762B2	Golf club head with high density body and low density face Embodiments of a golf club head having a body comprising a first material and a strike face comprising a second material, wherein the density of the first material is greater than the density of the second material, and the ratio of the density of the first material to the density of the second material is greater than or equal to approximately 1.7 are described herein.
US10722758B2	Golf balls having a core with surrounding intermediate foam layer Multi-layered golf balls having a core, intermediate layer, and cover are provided. The ball includes a non-foamed inner core (center) made of a thermoplastic or thermoset composition such as polybutadiene rubber. An intermediate layer comprising a foamed composition, such as polyurethane foam, is disposed about the inner core. The foamed intermediate layer may have a specific gravity gradient within the layer, wherein the outer surface specific gravity is greater than the midpoint specific gravity. Ball constructions having two intermediate layers, wherein at least one layer is a foamed layer can be made. A cover having at least one layer is disposed about the intermediate layer.
US10722757B2	Golf balls having multi-layered core with thermoplastic outer layer Multi-piece golf balls containing a multi-layered core structure are provided. The core structure includes a small, heavy inner core (center) having a relatively high specific gravity, an intermediate core layer, and a surrounding outer core layer. The layers of the core structure may have different hardness gradients. In one preferred embodiment, each core layer has a positive hardness gradient. The center of the core comprises a metal material such as copper, steel, brass, tungsten, titanium, aluminum, and alloys thereof. The intermediate core layer is preferably formed from a thermoset composition such as polybutadiene rubber, and the outer core layer is preferably formed from a thermoplastic composition such as an ethylene acid copolymer. The resulting ball has high resiliency and good spin control.
US10722755B1	Graphene based golf ball coating A golf ball with a coating disposed on a cover that is infused with graphene in an amount ranging from 0.01% to 5% based on a dry weight of the paint film is disclosed herein. The coating is preferably based on polyurethane chemistry where hydroxyl functional polymers are cured with polyisocyanate-based hardeners. The coating is preferably applied in a dipping process or a spraying process.
US10722747B2	Exercise ring An exercise ring includes a ring comprising a flexible and inelastic material, and the ring includes a plurality of strands in a braid. A plurality of handles are disposed on opposing sides of the ring. The plurality of handles includes a cylindrical body having a first end, a second end, and a center portion, and the plurality of handles can provide an ergonomic gripping surface.
US10722743B2	Multicatalyst polyelectrolyte membranes and materials and methods utilizing the same A multi-catalytic material that includes a polyelectrolyte membrane and methods of preparing the same are provided herein.
US10722740B2	Emergency station and method of use An integrated, portable, battery-powered, variable-pressure electric liquid pump and power emergency station a chassis; an electrically powered, variable-pressure liquid pump carried by the chassis; one or more rechargeable batteries powering the variable-pressure liquid pump to transfer liquid at variable pressures; one or more AC outlets carried by the chassis and powered by the one or more rechargeable batteries to provide emergency back-up power during power outage; wherein the emergency station includes at least one hardware processor; and one or more software modules that, when executed by the at least one hardware processor, initiates at least one of wireless signaling and wire-based signaling to user-determined outboard equipment to activate user pre-selected functions.
US10722737B2	Airbag module An airbag module comprises a control unit, a source of electric current managed by the control unit, a container wherein a gas is stored under pressure, and a hollow body with an inlet duct, in which an outlet of the container sealed by a pierceable membrane is tightly fitted, and an outlet duct on which an inflatable bag is tightly assembled. The airbag module further comprises an actuator assembly configured to pierce open the membrane sealing the container, said actuator assembly comprising a piercing member movably restrained to the body and at least one linear shape memory alloy wire actuator member that is electrically connected to the source of electric current and operably restrained to the piercing member so as to cause it to move beyond the pierceable membrane.
US10722736B2	Rotatable cantilever gantry in radiotherapy system A proton beam therapy system with a cantilever gantry. The cantilever gantry has one end portion (the fixed end portion) affixed to an external structure that supports the weight of the gantry. The remainder of the gantry is suspended and the free end portion is coupled to a beam nozzle. A main bearing is coupled to the fixed end portion and enables the gantry to rotate in a full range of 360° around the iso-center. A large counterweight can be disposed in the fixed end portion to keep the system center of mass close to the bearing. The gantry may have a monocoque housing, including a cantilever section enclosing the magnets and other components of the gantry beamline and a drum section on which the bearing is placed.
US10722735B2	Inner gantry A system includes a patient support and an outer gantry on which an accelerator is mounted to enable the accelerator to move through a range of positions around a patient on the patient support. The accelerator is configured to produce a proton or ion beam having an energy level sufficient to reach a target in the patient. An inner gantry includes an aperture for directing the proton or ion beam towards the target.
US10722725B2	Method and apparatus for applying a rectilinear biphasic power waveform to a load A system to deliver therapeutic energy to a patient, the system including a storage capacitor configured to store and release the therapeutic energy, a boost converter circuit coupled to the storage capacitor, and a current flow control circuit coupled to the boost converter circuit and including a plurality of control circuits configured to control a current output from the current flow control circuit in a therapeutic biphasic voltage waveform upon release of the therapeutic energy from the storage capacitor, wherein the therapeutic biphasic voltage waveform includes a ramped increase in voltage from approximately zero volts to a desired therapeutic voltage level over a time interval greater than 1 millisecond and less than a time associated with a phase switch.
US10722721B2	Antenna and methods of use for an implantable nerve stimulator A pulse generator that includes a communications module is disclosed herein. The communication module includes a transceiver and an antenna circuit. The antenna circuit includes a first pathway having a capacitor and a second, parallel pathway including a capacitor, and a resistor, and a radiating element arranged in series. The antenna circuit is tuned to have a resonant frequency corresponding to a desired transmission frequency and a bandwidth corresponding to shifts in the resonant frequency arising from the implantation of the antenna.
US10722720B2	Methods and systems for improved communication between medical devices At least one of a first medical device and a second medical device may be implanted within a patient while the second medical device may optionally be proximate but external to the patient. At least one of the medical devices has an antenna having at least two electrodes and at least one of the medical devices has an antenna having at least three electrodes. The medical devices can communicate via conducted communication through the patient's tissue between a first pair of electrodes and a second pair of electrodes. At least one of the pairs of electrodes can be selected in accordance with the signal strength of the communication vector between the first and second pairs of electrodes.
US10722719B2	Vibration-based secure side channel for medical devices According to some embodiments, a system for securing communications between an implantable wearable medical device (IWMD) and an external device (ED) is disclosed. The system includes a wireless radio frequency (RF) channel configured for communication between the IWMD and the ED. The system further includes a vibration-based side channel configured for verifying communication between the IWMD and the ED such that the RF channel is activated only when the IWMD detects a vibration signal generated by an ED.
US10722718B2	Systems and methods for treatment of dry eye A stimulation system stimulates anatomical targets in a patient for treatment of dry eye. The system may include a controller and a microstimulator. The controller may be implemented externally to or internally within the microstimulator. The components of the controller and microstimulator may be implemented in a single unit or in separate devices. When implemented separately, the controller and microstimulator may communicate wirelessly or via a wired connection. The microstimulator may generate pulses from a controller signal and apply the signal via one or more electrodes to an anatomical target. The microstimulator may not have any intelligence or logic to shape or modify a signal. The microstimulator may be a passive device configured to generate a pulse based on a signal received from the controller. The microstimulator may shape or modify a signal. Waveforms having different frequency, amplitude and period characteristics may stimulate different anatomical targets in a patient.
US10722717B2	Detecting and responding to anti-tachyarrhythmia shocks In some examples, an implantable medical device determines that another medical device delivered an anti-tachyarrhythmia shock, and delivers post-shock pacing in response to the determination. The implantable medical device may be configured to both detect the delivery of the shock in a sensed electrical signal and, if delivery of the shock is not detected, determine that the shock was delivered based on detection of asystole of the heart. The asystole may be detected based on the sensed electrical signal. In some examples, an implantable medical device is configured to revert from a post-shock pacing mode to a baseline pacing mode by iteratively testing a plurality of decreasing values of pacing pulse magnitude until loss of capture is detected. The implantable medical device may update a baseline value of the pacing pulse magnitude for the baseline mode based on the detection of loss of capture.
US10722714B2	Methods and systems for glucose regulation Various methods and apparatus for treating a condition associated with impaired glucose regulation in a subject comprising in one embodiment, applying a neural conduction block to a target nerve at a blocking site with the neural conduction block selected to at least partially block nerve pulses. In another embodiment, combinations of down-regulating and or up-regulating with or without pharmaceutical agents are used to treat impaired glucose regulation. In other embodiments, up-regulation or down-regulation of various nerves, such as the vagus and its branches, and the splanchnic is used to modify the production of GLP-1 and GIP, thereby controlling glucose levels. In yet further embodiments, combinations of down-regulating and or up-regulating with or without pharmaceutical agents are used to modify the production of GLP-1 and GIP, to treat impaired glucose regulation.
US10722712B2	System for location-dependent therapy delivery A system for spinal cord stimulation, includes a stimulation device having a plurality of electrodes. The stimulation device is configured to deliver spinal cord stimulation via the electrodes according to a set of stimulation parameters. The stimulation device is further configured to store a plurality of different sets of stimulation parameters. The stimulation device is further configured to select one of the stored sets and to deliver spinal cord stimulation according to this selected set, when the stimulation device or a component of the system is located in proximity to an external activator associated with the selected set.
US10722710B2	Secretion clearance and cough assist A device operates for secretion clearance and cough assistance by means of transdermal stimulation of muscle groups including the pectoralis majoris, the serratus anterior, and the abdominal muscles. The various muscle groups may be stimulated in different ways: not just different pulse trains but in addition, different stimulations to accomplish different phases of clearance or cough assistance. In a first phase a vibration action provided by the muscles (for example the pectoralis and serratus) is used to encourage the motion of mucus and other secretions within airways. In a second phase, the abdominal muscles for example might be stimulated differently so as to cause not a vibration but instead a coughing action, especially to detect and assist a natural cough. The invention further teaches a zone stimulator large enough to span and stimulate major muscles or groups of large muscles effectively.
US10722709B2	Method for treating a patient having a pelvic floor dysfunction A method to treat a patient having a pelvic floor dysfunction or overactive bladder disorder by establishing a neurostimulator having a processor and an electrical signal generator to generate a stimulation signal. The processor is set to one or more parameters effective in the treating of the patient's pelvic disorder or dysfunction including overactive bladder disorder when the stimulation signal is applied to a saphenous nerve of the patient. The neurostimulator is configured to provide the stimulation signal to a stimulator in accordance with a stimulation protocol. At least one stimulator is positioned next to a portion of the saphenous nerve of at least one lower limb of a patient. The processor is operationally activated to provide the stimulation signal to the stimulator for treatment of the patient.
US10722705B2	Nerve electrical stimulation device A nerve electrical stimulation device includes an electrical stimulator and a magnetic electrode assembly. The electrical stimulator includes a housing, a circuit board, two first electrical connecting elements and a first magnetic unit. One end of each first electrical connecting element is connected to the circuit board. The magnetic electrode assembly includes a main body, two electrodes, a second magnetic unit and two second electrical connecting elements. The electrodes are disposed on a surface of the main body, and connected to the circuit board. The second magnetic unit is located corresponding to the first magnetic unit. The second electrical connecting elements pass through the main body and connected to the electrodes and the other ends of the first electrical connecting elements, respectively. The magnetic electrode assembly is detachably positioned at one side of the electrical stimulator by a magnetic attraction of the first and second electrical connecting elements.
US10722702B2	Transmodiolar electrode array and a manufacturing method According to an embodiment, an electrode array for a transmodiolar implant is disclosed. The implant includes a substrate, a conductive metal located at a plurality of discrete portions on the substrate; and a single layer of insulation material over the conductive metal and the substrate. The single layer of insulation material includes a plurality of apertures that expose the conductive metal, the exposed conductive metal forming a plurality of electrodes, wherein stiffness of the electrode array is adapted to allow insertion of the electrode array into a modiolus of a subject.
US10722701B2	Nerve stimulation apparatus and biomagnetic field measurement system A nerve stimulation apparatus is provided. The nerve stimulation apparatus detects nerve activities from a body surface and applies stimulation. The nerve stimulation apparatus includes a stimulation apparatus with multiple electrodes which are arranged on skin and a current supply unit which supplies a current to the electrodes, which stimulation apparatus provides the current to a living body percutaneously to stimulate a target nerve; a measurement apparatus which measures activities of muscles governed by the nerve according to the stimulation from the stimulation apparatus; and an information processing apparatus which determines, based on a measurement result of the nerve activities obtained from the measurement apparatus, which electrode is capable of providing the target nerve activities equal to or greater than a desired value.
US10722698B2	Medical connector A soft grip medical connector comprises a housing with an upstream end, a downstream end and a lumen extending through a central portion thereof. A flexible member comprises a valve portion integrally formed with a sleeve portion. The valve portion is positioned within a section of the housing and is configured to control a flow of fluid through the housing lumen. The sleeve is inverted to envelope at least a portion of the outer surface of the housing. In some embodiments the gripping portion is integrally formed with the valve portion. In some embodiments, the connector is also generally configured to create a positive pressure in a catheter lumen upon removal of a syringe or other medical device from the upstream end of the connector. Methods of making a medical fluid connector generally comprise forming a valve member with a sleeve extending there from, and assembling the valve, sleeve and housing.
US10722695B2	Dilation system and method A dilation system and method for accessing a surgical target site to perform surgical procedures. In one version, the dilation system includes a dilation assembly and an actuating mechanism. The dilation assembly comprises plurality of dilator segments. The actuating mechanism is operably associated with the dilator segments so as to cause the dilator segments to move from a collapsed state to an expanded state.
US10722694B2	Apparatus and methods for treating hardened vascular lesions An angioplasty catheter has a catheter body having a balloon or other radially expandable shell at its distal end. A non-axial external structure is carried over the shell and scores a stenosed region in a blood vessel when the balloon is inflated therein. The catheter has an attachment structure disposed between the catheter body and the balloon to accommodate foreshortening and rotation of the external structure as the balloon is expanded. The external structure may be part of a helical cage structure which floats over the balloon.
US10722689B2	Guidewire with integral radiopaque markers Embodiments hereof relate to a guidewire formed from an elongated shaft, at least a portion of the shaft having an outer layer, a plurality of channels formed through the outer layer, and an inner core. The outer layer is formed from a material non susceptible to erosion by an erosion agent and the inner core is formed from a radiopaque material susceptible to erosion by the erosion agent. When exposed to the erosion agent, core material adjacent to the channels is removed to form a pattern of integral radiopaque segments or markers with a plurality of voids therebetween. By controlling the location of channels and the rate of erosion of the core material, the pattern of integral radiopaque segments and voids allow for in situ measurement when viewed under fluoroscopy.
US10722687B2	Segmented embolic system A catheter system utilizing one or more sensors is described. The catheter can be used as part of an embolic coil system, guidewire system, or combined embolic coil/guidewire system where the devices interact with the catheter system. A variable detachment embolic coil system and guidewire system are also described.
US10722685B2	Catheter placement device including guidewire and catheter control elements An insertion tool for inserting a catheter into a patient's body is disclosed. The insertion tool unifies needle insertion, guidewire advancement, and catheter insertion in a single device. In one embodiment, the insertion tool comprises a housing in which at least a portion of the catheter is initially disposed, a hollow needle distally extending from the housing with at least a portion of the catheter pre-disposed over the needle, and a guidewire pre-disposed within the needle. A guidewire advancement assembly is also included for selectively advancing the guidewire distally past a distal end of the needle in preparation for distal advancement of the catheter. In one embodiment a catheter advancement assembly is also included for selectively advancing the catheter into the patient. Each advancement assembly can include a slide or other actuator that enables a user to selectively advance the desired component. Guidewire and catheter locking systems are also disclosed.
US10722684B2	Leadless delivery catheter with conductive pathway Catheter and implantable leadless pacing devices, systems, and methods utilizing catheters and implantable leadless pacing devices are disclosed. An example catheter system may include a holding structure extending distally from a tubular member. An implantable device, such as a leadless pacing device, may be located within a cavity of the holding structure. The holding structure may include one or more electrical ports adjacent the proximal end of the holding structure and adjacent or proximal of the proximal end of the implantable device. The electrical ports may provide a conductive pathway extending through the distal structure to allow electrical signals to pass through the distal structure to and/or from the implantable device.
US10722683B2	Microcatheter with distal tip portion and proximal solution lumen There is provided a microcatheter having a proximal solution lumen and a distal tip portion with a guidewire lumen. The microcatheter and methods of use thereof allows for introduction of solution into a vessel while manipulating the guidewire and/or the microcatheter itself. The solution may be a contrast solution, for viewing of the vessel, a therapeutic or diagnostic solution, or any other type of solution.
US10722671B2	Method and apparatus for determining optimal endotracheal tube size A method and apparatus for determining the optimal endotracheal tube size for the intubation of a patient based upon both optimal tube length and optimal tube diameter which are determined by using either direct or indirect measurement devices or techniques to measure the patient's glottis aperture and tracheal length. The apparatus may include a maneuverable arm, a fiber optic video guidance system and an introducer guide to maneuver an end of the apparatus around obstructions in a patient who has a difficult airway to facilitate insertion of either an optimally sized endotracheal tube or a standard endotracheal tube into the patient's airway.
US10722656B2	Piston rod drive for an injection device The invention relates to a piston rod drive arrangement for an injection device used for self-administration of a plurality of individually set doses. The drive arrangement is made from a first element (10) mating the non-circular cross-section (3) of a piston rod (1) and a second element (20) having an inner thread (21) mating the outer thread of the piston rod. Whenever the first element (10) and the second element (20) are rotated in relation to each other the piston rod (1) is moved in an axial direction. In order to minimise the play in the threaded connection a resilient element (23) is proved to apply a force to the piston rod (1) in a longitudinal direction.
US10722651B2	Method for producing a sterilized subcutaneous access device and a sterilized subcutaneous access device The application relates to a method for producing a sterilized subcutaneous access device, the method comprising: producing a device carrier unit, comprising providing a carrier, producing a subcutaneous access part on the carrier, the subcutaneous access part being provided with at least one of a sensor device for detecting an analyte present in a bodily fluid and an infusion device for infusion of a substance, and producing an electronic assembly on the carrier, the producing comprising printing a battery on a carrier material, and sterilizing the device carrier unit by radiation sterilization, the sterilizing comprising exposing the printed battery to the radiation applied for sterilization. Furthermore, the application relates to a sterilized subcutaneous access device.
US10722644B2	Instruments and methods for loading cells into implantable devices Embodiments herein describe tools, instruments and methods for aseptic loading, dispensing and/or delivering cells into an implantable device and aseptically and selectively sealing a device inside a sterile package as well as and storing and preparing for shipment the cell-filled device.
US10722643B2	Patch-sized fluid delivery systems and methods A patch-sized fluid delivery device may include a reusable portion and a disposable portion. The disposable portion may include components that come into contact with the fluid, while the reusable portion may include only components that do not come into contact with the fluid. Redundant systems, such as redundant controllers, power sources, motor actuators, and alarms, may be provided. Alternatively or additionally, certain components can be multi-functional, such a microphones and loudspeakers that may be used for both acoustic volume sensing and for other functions and a coil that may be used as both an inductive coupler for a battery recharger and an antenna for a wireless transceiver. Various types of network interfaces may be provided in order to allow for remote control and monitoring of the device.
US10722642B2	Integrated intravenous (IV) clamp and power supply An intravenous (IV) pole assembly includes a non-conductive support element, distribution rails respectively disposed along a length of the non-conductive support element and a clamping element. The distribution rails are respectively configured for power distribution along the length of the non-conductive support element. The clamping element includes a hinged clamp, which is attachable to the non-conductive support element at an attachment point defined along the length of the non-conductive support element, and a connector by which power is selectively transmittable from the distribution rails to a powered device supportable on the hinged clamp.
US10722640B2	Devices, systems, and methods of packaging for a pre-filled drug delivery device A system for sterilizing a drug delivery device includes a drug delivery device having a first self-healing seal configured to seal a fluid reservoir disposed within the drug delivery device. A sealable container is configured to receive the drug delivery device therein. The sealable container has a base portion and a cover portion. The cover portion has a second self-healing seal positioned to align with the first self-healing seal when the drug delivery device is disposed within the sealable container. A fill port includes a fill path, the fill path being configured to pass through the first and second self-healing seals to fluidly couple the fill port to the reservoir of the drug delivery device. Other systems, methods, and devices of sterilization are also disclosed.
US10722637B2	Cartridge and method for increasing myocardial function The present invention relates to a cytopheretic cartridge for use in treating and/or preventing inflammatory conditions that affect myocardial function and to related methods. The cartridge can be used in treating a subject with myocardial dysfunction, such as a subject with chronic heart failure and/or acute decompensated heart failure.
US10722636B2	Hemodialysis system having a flow path with a controlled compliant volume Systems and methods for the performance of kidney replacement therapy having or using a dialyzer, control components, sorbent cartridge and fluid reservoirs configured to be of a weight and size suitable to be worn or carried by an individual requiring treatment are disclosed. The system for performing kidney replacement therapy has a controlled compliance dialysis circuit, where a control pump controls the bi-directional movement of fluid across a dialysis membrane. The dialysis circuit and an extracorporeal circuit for circulating blood are in fluid communication through the dialysis membrane. The flux of fluid moving between the extracorporeal circuit and the dialysis circuit is modified by the rate at which the control pump is operating such that a rate of ultrafiltration and convective clearance can be controlled. The system provides for the monitoring of an inlet and outlet conductivity of the sorbent cartridge to provide a facility to quantify or monitor the removal of urea by the sorbent cartridge.
US10722635B2	Modular medical fluid management assemblies and associated machines and methods Medical fluid management assembly includes: a pneumatic manifold including multiple plates forming pneumatic passageways, a pneumatic valve chamber and a pneumatic pump chamber, the valve chamber in pneumatic communication with at least one passageway, the pump chamber in pneumatic communication with at least one passageway; and a fluid manifold including multiple fluid pathways, a fluid valve chamber in selective fluid communication with a fluid pump chamber and at least one fluid pathway, wherein (a) the pneumatic valve chamber and the fluid valve chamber are mated together to compress a membrane and (b) the pneumatic pump chamber and the fluid pump chamber are mated together to compress a membrane, wherein at least one of the pneumatic valve chamber or the pneumatic pump chamber extends from the at least one plate, or the fluid valve chamber or the fluid pump chamber extends from the fluid manifold to aid in compressing the membranes.
US10722634B2	Dialysis device A dialysis device comprising a prescriber interface and a programming means configured to allow, via the prescriber interface, input of a set of therapeutic objectives and a treatment plan and a re-evaluation means configured to, as a function of the therapeutic objectives and the treatment plan, suggest at least one treatment option comprising a set of settings of a treatment session to achieve said set of therapeutic objectives.
US10722632B2	Blood pump controllers and methods of use for improved energy efficiency Methods, systems, and devices for a mechanical circulatory support system are disclosed herein. An implantable power supply can be part of a mechanical circulatory support system. The implantable power supply can include one or several energy storage components, a power source, a voltage converter, and an output bus. Power can be provided to the voltage converter from one or both of the power source and the first energy storage component. The voltage converter can convert the voltage of the power from a first voltage to a second voltage and can power the output bus.
US10722630B2	Strain gauge for flow estimation A pressure differential across a blood pump and/or a flow rate of blood pumped by the blood pump is estimated based at least in part on impeller thrust load. A blood pump for a circulation assist system includes a housing forming a blood flow channel, an impeller, one or more support members coupled to the housing, a sensor, and a controller operatively coupled with the sensor. At least one of the one or more support members react a thrust load applied to the impeller by blood impelled through the blood flow channel by the impeller. The sensor generates output indicative of the magnitude of the thrust load. The controller is configured to process the sensor output to estimate at least one of a pressure differential across the blood pump and a flow rate of blood pumped by the blood pump.
US10722628B2	Device for cardiocirculatory assistance A device for cardiocirculatory assistance constituting a pump for a blood flow includes a body, a pair of covers, and a pair of membranes. The device is provided with a circuit for the passage of a gas or gaseous fluid alternatively under pressure and depressurization so that a reciprocating pumping motion of the membranes is established.
US10722626B2	Redundant-impeller artificial heart An artificial heart for use in a human recipient includes a housing within which a quartet of turbine pump segments are operative. The quartet of turbine pump segments is configured to provide a pair of redundant input and output turbine pump segment pairs each input and output pair being coupled by a curved passage providing a redundancy which, in turn, enhances the safety factor provided by the artificial heart. Each turbine pump segment includes an impeller forwarded for rotation and having a plurality of impeller blades together with a static deswirler positioned within the impeller output flow to reduce the swirling turbulence of the blood flow induced by the rotating impeller.
US10722622B2	Drainage system and vacuum pump for intrauterine vacuum therapy A device for intrauterine vacuum therapy includes a pear-shaped fluid-collecting element and a fluid-communicating element. The fluid-collecting element defines an inlet opening at the proximal end and a tubular cavity for receiving a removable guide-rod during transvaginal insertion into a uterine cavity. The fluid-communicating element has a perforated distal end fixed within the fluid-collecting element outside the tubular cavity and has a proximal end adapted for connection to a vacuum-generating system. A method of treating an intrauterine wound or infection includes transvaginally inserting a drain into a uterine cavity and applying a negative pressure to the drain such that the uterus collapses and the inner wall is aspirated against the drain.
US10722618B2	Apparatus for controlling vacuum during ocular surgery A method and system assist a physician in controlling pressure in a line during a surgery. The method includes filtering a vacuum signal such that portions of the vacuum signal having a frequency greater than a threshold frequency (e.g., ten Hz) are not passed. Thus a filtered vacuum signal is provided. The method also includes providing a control signal to a vacuum source. The control signal is selected from the vacuum signal and the filtered vacuum signal. The vacuum source provides a vacuum having a level based on the control signal.
US10722614B2	Decellularized hyaline cartilage powder for tissue scaffolds The present invention is related to compositions comprising decellularized cartilage tissue powder in the forms of paste, putty, hydrogel, and scaffolds, methods of making compositions, and methods of using these compositions for treating osteochondral defects and full- or partial-thickness cartilage defects.
US10722613B2	Method of preparing calcification-resistant bioprosthetic tissue Methods of preparing calcification-resistant bioprosthetic tissue include providing fresh biological tissue, cross-linking the tissue, treating the cross-linked tissue with an alcohol for a time sufficient to allow the alcohol to be diffused into the tissue, and treating the alcohol-treated fixed tissue with a polyol for a time sufficient to allow fluid in the tissue to be replaced by the polyol. The methods may include sterilizing the cross-linked tissue in a solution including propylene oxide or peracetic acid either before or after the alcohol treatment step; or drying the alcohol/polyol-treated, cross-linked tissue, sterilizing the dried tissue by exposure to ethylene oxide or peracetic acid, and storing the sterilized tissue in a dry, ambient environment. The treated tissue may be a tissue component for a bioprosthetic valve, a valve assembly for a bioprosthetic valve or a fully assembled bioprosthetic valve incorporating the tissue.
US10722612B2	Soft hydrophobic acrylic materials Soft hydrophobic acrylic materials with improved resistance to fluid diffusion and suitable mechanical properties that allow deformation upon application of force are disclosed. The acrylic materials are particularly suitable for use in fluid-based accommodating intraocular lenses and comprises combination of a perfluoro-substituted alkyl (meth)acrylate and an alkyl (meth)acrylate, and a cross-linking agent.
US10722611B2	Adhesive compositions and related methods Adhesive compositions and patches, and associated systems, kits, and methods, are generally described. Certain of the adhesive compositions and patches can be used to treat tissues (e.g., in hemostatic or other tissue treatment applications), according to certain embodiments.
US10722608B2	Systemic and topical application of platelet microparticles to treat bleeding in trauma patients The present disclosure is directed to blood dotting compositions comprising platelet microparticles, method of using said compositions, and methods of preparing the same.
US10722601B2	Gadolinium chelate compounds for use in magnetic resonance imaging A compound having the formula of tetragadolinium [4,10-bis(carboxylatomethyl)-7-{-3,6,12,15-tetraoxo-16-[4,7,10-tris(carboxylatomethyl)-1,4,7,10-tetraazacyclododecan-1-yl]-9,9-bis({[{2-[4,7,10-tris(carboxylatomethyl)-1,4,7,10-tetraazacyclododecan-1-yl]propanoyl} amino)acetyl]amino}methyl)-4,7,11,14-tetraazaheptadecan-2-yl}-1,4,7,10-tetraazacyclo dodecan-1-yl]acetate wherein the stereochemistry at the chiral carbon of the four alanine substituents is selected from the group consisting of RRRR, SSSS, RSSS, RRSS, and RRRS stereoisomers, and racemic and diastereomeric mixtures of any thereof, or a tautomer, a hydrate, a solvate, or a salt thereof, or a mixture of same is described. The compounds may be used as an MRI contrast imaging agent.
US10722599B2	Lipid assemblies and uses thereof and some pH and electrostatic modulating lipids to be used in said assemblies Provided are modified lipid compounds and their use in the formation of lipid assemblies. Also provided are lipid assemblies including (a) an amphoteric lipid including in covalent association with (i) one or more acyl chains; (ii) one or more weak base moiety; (iii) one or more weak acid moiety; the lipid assembly also including (b) one or more additional lipids, at least one of which being a zwitterionic lipid. In some embodiments, the amphoteric lipid is a compound including (a) a tri-functional moiety; (b) two non-phosphate lipid chains associated with two of the functional moieties of said tri-functional moiety; (c) optionally a spacer moiety associated with the third of the functional moieties of said tri-functional moiety; and (d) a polyalkylamine optionally including a short peptide with one to several carboxylic acid residues. Further provided are the uses of the lipid assembly, inter alia, for transfection or cancer treatment.
US10722598B2	Adeno-associated virus (AAV) clades, sequences, vectors containing same, and uses therefor Sequences of novel adeno-associated virus capsids and vectors and host cells containing these sequences are provided. Also described are methods of using such host cells and vectors in production of rAAV particles. AAV-mediated delivery of therapeutic and immunogenic genes using the vectors of the invention is also provided.
US10722594B2	Pyrrolobenzodiazepine-anti-CD22 antibody conjugates Conjugates of an isolated humanized, anti-CD22 antibody with PBD dimers.
US10722592B2	CD48 antibodies and conjugates thereof The invention provides murine, chimeric, and humanized antibodies that specifically bind to CD48 and conjugates thereof.
US10722589B2	FGFR3 binding molecules The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X6) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.
US10722587B2	Composition for intracellular delivery containing adenovirus protein VI-derived peptide and anticancer pharmaceutical composition containing same The present invention relates to a composition for intracellular delivery containing an adenovirus protein VI-derived peptide and an anti-cancer pharmaceutical composition containing the same. According to the present invention, the use of the peptide or peptide-polymer composite of the present invention improves intracellular delivery efficiency of a nucleic acid, a peptide, a poly-peptide, an antibody, a chemical material, or a virus. Therefore, the peptide or peptide-polymer composite of the present invention can be favorably used as an intracellular delivery system for various therapeutics.
US10722584B2	Increasing the bioavailability of flavan-3-ols by polyphenols The present invention relates generally to the field of flavan-3-ols. In particular, the present invention provides a way to increase the bioavailability of flavan-3-ols. Embodiments of the present invention relate to the use of at least one polyphenolic compound in a composition comprising at least one flavan-3-ol for increasing the bioavailability of said flavan-3-ol, wherein the at least one polyphenolic compound is selected from a group consisting of flavonols, flavones, isoflavones, flavanones, or combinations thereof.
US10722580B2	Compositions and methods for treatment and prevention of uropathogenic E. coli infection Methods and antibody compositions that displace mannose from the binding pocket of fimbrial adhesin FimH of enterobacteria, including uropathogenic E. coli, Klebsiella oxytoca, or Klebsiella pneumoniae, can be used to disrupt or prevent the attachment of a single layer of bacteria to a mannose-coated surface, or to disrupt or prevent the formation of a multilayer biofilm. The antibody compositions of the invention can thus be used in methods to inhibit, prevent, or reverse the colonization of a surface with enterobacteria that express the bacterial Type 1 fimbrial adhesin FimH, to inhibit or prevent infection of a cell by enterobacteria that express the bacterial Type 1 fimbrial adhesin FimH, such as, for example, uropathogenic E. coli, to treat a bacterial infection in subject in need thereof and to treat or prevent inflammatory bowel disease (IBD), among other uses.
US10722579B2	Stable aqueous formulations of adalimumab The invention provides aqueous pharmaceutical adalimumab compositions suitable for long-term storage of adalimumab, methods of manufacture of these compositions, methods of administration, and kits containing same.
US10722578B2	Methods and compositions for treating neuroblastoma Methods and compositions for treating neuroblastoma are disclosed.
US10722577B2	Methods for treating GI syndrome and graft versus host disease It has been discovered that administering therapeutically effective amounts of an antibiotic that kills Gram-negative bacteria, together with an anti-ceramide antibody or anti-ceramide mimetic, treats and prevents an array of diseases mediated by cytolytic T lymphocyte (CTL)-induced killing and/or by damage to endothelial microvasculature, including Radiation GI syndrome, GvHD disease, inflammatory diseases and autoimmune diseases.
US10722571B2	Rabies virus G protein epitope, and rabies virus neutralising binding molecule that binds specifically thereto This invention relates to a rabies virus G protein epitope and a rabies-virus-neutralizing binding molecule that binds specifically thereto, wherein different epitope sites of rabies virus G protein are identified and binding molecules that bind thereto and a cocktail thereof can be found to retain neutralizing activity against various rabies viruses.
US10722570B2	Dried influenza vaccine preparation and method for producing dried influenza vaccine preparation The present invention provides a dried influenza vaccine preparation in which the activity of an influenza vaccine can be stably maintained even if the preparation is stored without strict temperature control and which can be stably supplied. The present invention also provides a method for producing the dried influenza vaccine preparation. Provided is a dried influenza vaccine preparation including: an influenza vaccine antigen; a disaccharide; and an amino acid.
US10722569B2	Bacterial biofilm matrix as a platform for protein delivery Some aspects of this disclosure provide engineered exopolysaccharide-associated proteins, engineered bacteria expressing such proteins, and engineered biofilms comprising such proteins. Some aspects of this disclosure provide methods for engineering exopolysaccharide-associated proteins, and for the generation of engineered bacteria and biofilms expressing or comprising such proteins. Some aspects of this disclosure provide compositions and methods useful for the generation of vaccines and the vaccination of subjects, for delivering molecules of interest to a target site, for example, a surface, for purification of molecules of interest, for example, from bioreactors comprising engineered bacteria as provided herein, and for bioremediation applications, such as the cleanup of environmental pollutants.
US10722567B2	Compositions and methods for the treatment or prevention of tuberculosis Disclosed are yeast-based immunotherapeutic compositions and fusion proteins for the treatment and/or prevention of TB infection and symptoms thereof, as well as methods of using the yeast-based immunotherapeutic compositions and fusion proteins for the prophylactic and/or therapeutic treatment of TB and/or symptoms thereof.
US10722561B2	Aquaporin 2 protects cattle from ticks and tick-borne parasites A novel method of using an aquaporin protein from Rhipicephalus microplus (RmAQP2), fragments of RmAQP2, and/or the cDNA encoding RmAQP2 and/or the fragments are described. Immunogenic composition containing recombinant RmAQP2 and/or fragments of RmAQP2 are produced and administered to an ungulate which generates an immune response to RmAQP2. After feeding female ticks on the ungulate injected with RmAQP2 and/or fragments of RmAQP2, the female ticks have lower reproductive viability because of a reduced egg mass, reduced hatching percentage, and reduced survival of larvae. Thus, administering RmAQP2 and/or RmAQP2 fragments to an ungulate can reduce the incidence of R. microplus and also reduce the incidence of tick-borne pathogens in ungulates because of the lower number of R. microplus.
US10722560B2	Compositions for remodeling extracellular matrix and methods of use thereof The present invention relates to a method for increasing the embryo implantation rate in a mammalian uterus, by administering to the uterus of a mammal an effective amount of an extracellular matrix remodeling enzyme, as well as to a product comprising an extracellular remodeling enzyme.
US10722557B2	Treatment of ischemia reperfusion injury using alpha-2 macroglobulin Methods of preventing and/or treating reperfusion injury are provided. The methods involve administering alpha-2-macroglobulin (A2MG) to a subject with ischemia in one or more tissues or organs, in order to prevent or decrease reperfusion injury when blood flow is restored to the tissues or organs (reperfusion). In some aspects, the patient who is treated has had a heart attack (e.g. acute myocardial infarction, AMI) and the ischemic tissue that is protected from reperfusion injury is heart tissue.
US10722555B2	Anti-angiogenic treatment of endothelial tissue with a combination of antagonists The teachings provided herein generally relate to a combination therapy and are directed to pharmaceutical compositions and methods for administering a combination of an α5β1 antagonist with an α2β1 antagonist to a subject. The methods are for use in inhibiting, preventing, or reversing angiogenesis, as well as in treating cancer. In some embodiments, the compositions and methods include a combined administration of VLO4 and VP12 (ECL12).
US10722552B1	Treatment of autism using botulinum toxins A method of treating ASD (autism) in a patient in need thereof comprises administering a botulinum toxin to the patient. The botulinum toxin may be administered by subcutaneous/intradermal injection. The subcutaneous/intradermal injection may be administered to and/or around the vicinity of a trigeminal nerve, a cervical nerve, a thoracic nerve, a lumbar nerve, and a sacral nerve of the patient. In infants or toddlers—from about 1 to 5 year olds, it is used to prevent or minimize damage to the developing brain; in older children and adult Autism Spectrum Disorder (ASD) patients, it will be used to reduce or eliminate their symptoms.
US10722548B2	Method of preparing lyophilizate of Taheebo alcohol extract The present invention relates to a method of preparing a lyophilizate of a Taheebo alcohol extract, including: (a) extracting Taheebo with an alcohol and concentrating an extract; and (b) lyophilizing the alcohol-extracted and concentrated Taheebo, and a composition for the treatment, prevention or amelioration of an inflammatory disease including a lyophilizate of a Taheebo alcohol extract prepared therefrom.
US10722543B2	Methods for inhibiting tumor growth using anaerobe microorganisms Methods of inhibiting or reducing tumor metabolism and growth are disclosed. A composition containing oxygen scavenging membrane fragments and anaerobe bacteria is injected into a tumor to interfere with tumor growth and metabolism, leading to tumor necrosis. The composition may also contain a cryoprotectant, which permits the composition to be stored at sub-zero temperatures without freezing.
US10722542B2	Non-winterized, standardized marine source oil products and methods of making thereof Disclosed is a liquid medicament/supplement composition including a non-winterized marine source oil (e.g., oil derived from fish, krill, and/or squid), a food grade or pharmaceutically acceptable form of vitamin D3 or a derivative thereof admixed in the non-winterized marine source oil, a food grade or pharmaceutically acceptable form of vitamin A or a derivative thereof admixed in the non-winterized marine source oil, optionally a food grade or pharmaceutically acceptable form of CoQ10 or a derivative thereof admixed in the non-winterized marine source oil, a food grade or pharmaceutically acceptable form of concentrated eicosapentaenoic acid and docosahexaenoic acid or ethyl ester, glyceride ester or salt of the acid and polyphenol rich vegetable oil admixed in the non-winterized marine source oil, and optionally a food grade or pharmaceutically acceptable form of melatonin or a derivative thereof admixed in the non-winterized marine source oil. The liquid medicament/supplement composition preferably has an oxidation amount measured as totox of less than 5, and the liquid medicament/supplement composition preferably has an overall eicosapentaenoic acid to docosahexaenoic acid ratio (DHA:EPA) ranging from 2:1 to 1:2 at a concentration ranging from 15 to 35 wt % of total liquid weight calculated as weight % of the corresponding free acid.
US10722539B2	Cadaveric derived wound treatment and method of use Wound treatment compositions obtained from cadaveric tissues are provided. Methods of processing such tissues to form wound treatment compositions are provided. Methods of treating a wound are also provided.
US10722533B2	Nutritional supplement for growth enhancement Provided are nutritional supplements designed for enhancing the growth, particularly the linear growth, of pre-pubertal children with a stature measure short compared to the norm. The nutritional composition includes an energy source, arginine and a combination of micronutrients.
US10722532B2	Polymer-conjugated METAP2 inhibitors, and therapeutic methods of use thereof One aspect of the invention provides polymer conjugated MetAP2 inhibitors. While not being bound by any particular theory, it is believed that coupling the MetAP2 inhibitory core via the linkers described herein provides compounds with superior efficacy to the parent small molecules and superior pharmacokinetic profiles. In one aspect of the invention, the polymer conjugated MetAP2 inhibitors are useful in methods of treating disease, comprising administering to a subject in need thereof a therapeutically effective amount of a polymer conjugated MetAP2 inhibitor.
US10722531B2	OPRT expression and cancer treatment outcome Improved methods for treating cancer are provided herein by determining if a cancer patient, particularly a colon cancer patient or a gastric cancer patient, will clinically respond in a favorable manner to a therapeutic strategy comprising the FOLFOX regimen (fluorouracil, leucovorin, and oxaliplatin) or a combination of capecitabine and cisplatin. Diagnostic methods for measuring the OPRT, TYMP, and/or UCK2 proteins in a tissue sample, such as a tumor sample, from the patient are provided.
US10722528B2	Compositions and methods for inhibiting metastasis Calprotectin inhibitors and derivatives thereof, and methods of using them for inhibiting or reducing metastatis and treating cancer are provided. The pharmaceutical formulations prepared from the compounds can be used in the treatment of cancer either as a single agent or in combination with at least one other cancer therapeutic, chemotherapeutic or anti-cancer agent.
US10722527B2	Abiraterone acetate lipid formulations Abiraterone acetate lipid formulations.
US10722525B2	Targeted therapeutics The present invention provides pharmacological compounds including an effector moiety conjugated to a binding moiety that directs the effector moiety to a biological target of interest. Likewise, the present invention provides compositions, kits, and methods (e.g., therapeutic, diagnostic, and imaging) including the compounds. The compounds can be described as a protein interacting binding moiety-drug conjugate (SDC-TRAP) compounds, which include a protein interacting binding moiety and an effector moiety. For example, in certain embodiments directed to treating cancer, the SDC-TRAP can include an Hsp90 inhibitor conjugated to a cytotoxic agent as the effector moiety.
US10722524B2	Compositions comprising hydroxytyrosol and boswellic acid Compositions are described including a synergistic combination of hydroxytyrosol and 3-O-acetyl-11-keto-β-boswellic acid. The hydroxytyrosol may be sourced from an olive extract and the 3-O-acetyl-11-keto-β-boswellic acid may be sourced from a Boswellia serrata extract. The compositions may be formulated for oral administration to a mammalian or an avian subject. Methods for treating, repairing, or reducing damage to connective tissue caused by one or more inflammatory mediators and for reducing levels of one or more inflammatory mediators in connective tissue are provided, the methods comprising orally administering the compositions to a subject in need thereof.
US10722523B2	Chemoimmunotherapy for epithelial cancer The invention provides a method for treating cancer in a subject in need thereof, wherein said subject comprises cancer tissue that ‘contains epithelial cancer cells and immunosuppressive 8 cells, and wherein said method comprises administering to said subject a therapeutically effective amount of a) one or more first composition that pauses—immunogenic eel’ death and/or of said epithelial cancer cells, and b) one or more second composition that reduces one or both of the number and function of said immunosuppressive B cells in said cancer.
US10722522B2	Dosing regimen for sedation with CNS 7056 (remimazolam) The invention relates to a dosing regimen for sedation with the fast-acting benzodiazepine CNS 7056 in combination with an opioid, in particular fentanyl, whereas CNS 7056 is given in a dose of 2 to 20 mg, preferably between 4 and 9 mg and most preferably between 5 and 8 mg.
US10722521B2	Beta-lactamase inhibitors and uses thereof β-Lactamase inhibiting compounds, therapeutic methods of using the β-lactamase inhibiting compounds, particularly in combination with β-lactam antibiotics and pharmaceutical compositions thereof are disclosed. The β-lactamase inhibiting compounds are suitable for oral administration.
US10722520B2	Heterocyclic compounds and their use in preventing or treating bacterial infections A compound of formula (I) or a racemate, an enantiomer, a diastereoisomer, a geometric isomer or a pharmaceutically acceptable salt thereof, and its use as antibacterial agent.
US10722518B2	Oxazine derivative for use in the treatment or prevention of cerebral amyloid angiopathy The present invention relates to an oxazine derivative BACE-1 inhibitor and pharmaceutical compositions comprising such oxazine derivative for use in the treatment or prevention of cerebral amyloid angiopathy and, in particular, wherein the patient carries one or two copies of the ApoE4 allele.
US10722509B2	Predicting optimal chemotherapy for CRC Methods are provided herein for identifying whether a cancer patient, for example a colorectal cancer patient, will be responsive to treatment with a therapeutic strategy comprising administration of the FOLFOX regimen (5-fluorouracil, leucovorin, and oxaliplatin). Specified TYMP and UCK2 fragment peptides are precisely detected and quantitated by SRM-mass spectrometry directly in tumor cells, for example colorectal cancer tumor cells, that are collected from tumor tissue obtained from a cancer patient and compared to reference levels in order to determine if the cancer patients will positively respond to treatment with the combination treatment of FOLFOX (5-fluorouracil, leucovorin, and oxaliplatin).
US10722508B2	Liposomes useful for drug delivery The present invention provides liposome compositions containing substituted ammonium and/or polyanion, and optionally with a desired therapeutic or imaging entity. The present invention also provide methods of making the liposome compositions provided by the present invention.
US10722506B2	Method of treating multiple sclerosis In one aspect, a method of treating a disorder associated with chronic inflammation includes administering to an individual in need thereof a therapeutically effective amount of isomyosmine or a pharmaceutically acceptable salt thereof. In some aspects, the disorder is a cancer, an autoimmune disorder, hypertension, or autism. In other aspects, isomyosmine is administered to treat viral infections or disorders associated with elevated levels of hydrogen peroxide and/or other Reactive Oxygen Species (ROS).
US10722503B2	Glitazones for topical application Glitazone compounds, such as pioglitazone, are useful for topical treatment of dermatologic conditions, such as keratosis pilaris, that are associated with a decrease in number or function of sebocytes.
US10722495B2	Cyanoindazole compounds and uses thereof Disclosed are compounds of Formula (I), methods of using the compounds for inhibiting HPK1 activity and pharmaceutical compositions comprising such compounds. The compounds are useful in treating, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer.
US10722493B2	Methods for treating fibroproliferative disorders in a mammal Methods of treating fibroproliferative disorders mediated by β-catenin in mammals, including aggressive fibromatoses, also called desmoid tumour.
US10722492B2	Andrographolide treats progressive forms of multiple sclerosis Andrographolide 240 mg/day orally is the first treatment shown to significantly benefit progressive forms of Multiple Sclerosis in human patients.
US10722485B2	Compositions and methods for lowering triglycerides without raising LDL-C levels in a subject on concomitant statin therapy In various embodiments, the present invention provides compositions and methods for treating and/or preventing cardiovascular-related diseases in subject in need thereof.
US10722477B2	Cooling adjunct for medications to treat disorders in the nasal cavity The present discovery pertains generally to the field of therapeutic compounds. More specifically the present discovery pertains to certain di-alkyl-phosphinoyl-alkanes as described herein, DIPA-1-8 and DIPA-1-9, and 2-6 and 2-7 that are collectively referred to herein as “DAPA compounds”, that are useful in the treatment of disorders (e.g., diseases) including: sensory discomfort (e.g., caused by inflammation, irritation, itch, or pain) in the nasal cavity. The applicant has found that localized delivery of DAPA compounds in combination with an intranasal steroid or an intranasal antihistamine immediately relieves nasal discomfort and enhances patient adherence to the use of the nasal medications.
US10722470B2	Pharmaceutical composition comprising an adenoviral vector The present invention relates to the formulation of Adenoviral vectors in an aqueous mixture or freeze dried composition in the presence of amorphous sugar and low salt concentration, its formulation as well as a method for obtaining the dried composition.
US10722466B2	Liposomal formulation for use in the treatment of cancer The invention relates to a pharmaceutical liposomal composition comprising 2-{[5-{3-chloro-2-methyl-4-[2-(4-methylpiperazin-1-yl)ethoxy]phenyl}-6-(4-fluorophenyl)thieno [2,3-d]pyrimidin-4-yl]oxy}-3-(2-{[2-(2-methoxyphenyl)pyrimidin-4-yl]methoxy}phenyl) propanoic acid, referred to herein as ‘Compound A’, or a pharmaceutically acceptable salt thereof. More specifically the invention relates to a liposomal vehicle, an organic concentrate composition comprising Compound A, and a pharmaceutical composition for parenteral administration comprising liposomes and Compound A. Furthermore, the invention relates to the use of such compositions for the treatment of cancer. ‘Compound A’ as used herein includes all enantiomers, diastereoisomers, and atropisomers thereof, or mixtures thereof, and also optionally includes the pharmaceutically acceptable salts thereof.
US10722462B2	Discontinuous reverse micellar composition in cubic FD3M phase for sustained release of therapeutic drugs The present invention discloses reverse/inverse micellar discontinuous cubic phase (Fd3m phase) composition for controlled release of therapeutic drugs or biologically active component and to the process for preparation thereof.
US10722460B2	Pharmaceutical compositions of IL-2 The invention relates to a liquid pharmaceutical composition of Il-2 and its use in the treatment of auto-immune and inflammatory disorders. Methods for preparing said composition and delivery devices filled with said composition are also described.
US10722458B2	Amphipathic lipid-based sustained release compositions Chewable sustained release compositions and their methods of production are provided. The sustained release compositions contain amphipathic lipids and matrix-forming polymers, which are used to encapsulate various drugs and active ingredients. The chewable sustained release compositions can maintain their sustained release properties even after being fragmented into a plurality of pieces.
US10722455B1	Succinylcholine prefilled syringe, compositions and methods Pre-filled syringes, pharmaceutical compositions, and kits and methods relating to same allow for emergency administration of one or more drugs from prefilled glass syringes to a patient via a needleless connector. In preferred embodiments, the prefilled glass syringe has a drug volume of at least 5 mL, has a Luer-lock, and has a syringe tip with an internal channel that has a diameter of about 1.7 mm. Such syringes advantageously allow storage of emergency drugs without leaching of plastic materials and degradation, and substantially improve the safety profile where the syringe is attached to an IV line via a needleless connector.
US10722446B2	Aqueous oral care compositions Described herein are aqueous oral care compositions comprising (a) an effective amount of a basic amino acid in free or orally acceptable salt form; and (b) a polymer system comprising (i) a cellulosic polymer, (ii) a gum polymer, and (iii) a polyacrylate polymer or co-polymer; and methods of making and using the same.
US10722445B2	Biphasic compositions for tissue augmentation Methods and compositions for use in tissue volume replacement are provided. The present invention comprises compositions comprising a combination of materials, comprising preferably a solid polymer particle phase and a gel phase, and also comprises single phase compositions. More particularly, preferred embodiments comprise a solid polymer particle phase made of materials comprising Gore-Tex (micronized e-PTFE), PDS II (polydioxanone, a monofilament), NUROLON (a long chain aliphatic polymer Nylon 6 or Nylon 6,6) ETHILON (a long chain aliphatic polymer Nylon 6 and Nylon 6,6), PROLENE (Polypropylene, isotactic crystalline stereoisomer of polypropylene, a synthetic linear polyolefin.), VICRYL (copolymer made from 90% glycolide and 10% L-lactide), silk, MONACRYL (poly ϵ-caprolactone.), polylactide, polyglycolide, poly lactide-co-glycolide, and BIOPOL (polyhydroxyvalerate), MEDPOR (biocompatible (micronized) polyethylene), BIOGLASS (bioactive glass particulate), NOVABONE and NOVABONE-CM, and the gel phase comprises polyvinylpyrrolidone (PVP). Preferred single phase compositions comprise PVP. Methods of the present invention comprising injection of such compositions for tissue augmentation.
US10722444B2	Stable hydrogel compositions including additives The present specification generally relates to an injectable dermal filler composition that includes crosslinked hyaluronic acid-based polymer and an antioxidant.
US10722443B2	Moisturizing compositions and uses thereof Embodiments herein are directed to moisturizing compositions comprising interpenetrating polymer networks, methods of making moisturizing compositions and methods of using moisturizing compositions.
US10722441B2	Noreugenin glycoside derivatives A use of noreugenin glycoside derivatives of formulas I, II and III as a self-tanning substance or to increase the synthesis of melanin, improve melanin transport and/or improve the distribution of melanin in suprabasal layers, preparations containing noreugenin glycoside derivatives of formulas I, II and III, and noreugenin glycoside derivatives of formulas I, II and III.
US10722439B2	Hair care products Hair treatment agents containing a mixture of special linear alkanes, an amidoamine and/or a cationized amidoamine, and at least one cationic surfactant (esterquat and/or quaternary ammonium compound) are provided. In one example, the hair treatment agents are suitable for the care of hair, in particular to improve the wet and dry combability, the disentanglement, the hold, and the gloss of hair.
US10722437B2	Cosmetic agents with “improved protection against body odor” The present disclosure relates to cosmetic agents which, in addition to an antiperspirant compound and/or a deodorant active ingredient, contain a combination of special cyclical alcohols and specific menthyl compounds. These agents have a high and long-lasting deodorizing effect. The present disclosure also concerns a cosmetic product containing the cosmetic agent as contemplated herein, as well as at least one propellant. Moreover, the present disclosure relates to the use of agents as contemplated herein for treating body odor, as well as the use of a combination of cyclical alcohol and menthyl compound to increase the odor-inhibiting effect of cosmetic agents.
US10722432B2	Syringe plunger with hinged flange A plunger for movably mounting within a cavity or barrel of a syringe. The plunger includes a contact face having a flange movably mounted thereto, wherein the flange is movable between an open configuration wherein an opening is formed between the flange and a portion of the plunger, the opening configured for engagement with an IV hook or other engagement member, and a closed configuration wherein the upper surfaces of the contact face and the flange are generally planar with one another.
US10722430B1	System and method for the tracking, dispensing, and administering of a medicament in a programmable encapsulation A system comprising one or more of a programmable encapsulation for containing and regulating the release of a medicament, an encapsulating device used by a manufacturer which encloses the medicament within a programmable encapsulation, a programming device used by a pharmacy or dispensary which programs the encapsulation with an intended patient's health data and prescription data, a consumer encapsulation storage device configured to store one or more programmable encapsulations for one or more of a patient, authenticate the identity of a patient, and dispense medicaments to the patient in accordance with the patient's prescription, and a portable reader configured to scan a programmable encapsulation and display the details of the medicament and instructions for its consumption.
US10722425B2	Systems and methods for effective reuse of a self-contained portable positionable oscillating motor array In some embodiments, a method may include inhibiting contamination of a medical device. The method may include positioning a first shield on a torso of a subject. The first shield may inhibit transmission of solid and fluid contaminants. The method may include positioning a wearable harness of a medical device on a torso of a first subject. The method may include positioning a second shield on a torso of a subject such that the wearable harness is positioned between the first shield and the second shield. The second shield may inhibit transmission of solid and fluid contaminants. The method may include applying an oscillation force to at least one of the treatment areas using at least some of a plurality of engines coupled to the wearable harness. The method may include mobilizing at least some secretions in an airway within the subject substantially adjacent to the treatment areas.
US10722413B2	Surgical frame including torso-sling and method for use thereof A torso-sling is provided to support at least a portion of the body of a patient on a surgical frame. The torso-sling is used in supporting at least a portion of the patient's torso. The torso-sling is supported relative to the surgical frame using a support bracket that can be attached to a chest support plate of the surgical frame. The torso-sling includes a frame portion, at least a first support strap, and at least a second support strap. The frame portion defines an access area, and the frame portion includes a first side portion, a second side portion, and a transition portion joining the first and second side portions together. The first side portion is configured for positioning adjacent a first lateral side on the posterior side of the patient, the second side portion is configured for positioning adjacent a second lateral side on the posterior side of the patient, and the transition portion is configured for positioning adjacent the neck and shoulders on the posterior side of the patient. The first support strap extends from the support bracket to the first side portion, the first support strap, when the patient is supported by the surgical frame and the torso-sling supports portions of the torso of the patient, extending in part adjacent portions of the first lateral side of the torso of the patient. The second support strap extends from the support bracket to the second side portion, the second support strap, when the patient is supported by the surgical frame and the torso-sling supports the portions of the torso of the patient, extending in part adjacent and contacting portions the second lateral side of the torso and the anterior torso of the patient.
US10722410B2	Assistance chair assembly An assistance chair assembly includes a base and a chair is positioned on the base. Two upright boards are perpendicularly connected to the top of the base, and two extension portions extend from the rear end of the base. The chair includes two front legs and two rear legs. The front legs each have a curve slots which allows the chair to be is pivotable about the bolts extending through the rear legs of the chair. The weight center of the chair is not moved beyond the two extensions portions of the base when the chair is pivoted toward the two extensions portions.
US10722409B2	Wheelchair A conveyance to carry humans, such as a wheelchair, is described having levers on each side of the wheelchair that are manually moved forward and backward to propel the conveyance. The user is able to shift into forward, reverse or neutral, brake, and change mechanical advantage (gear ratio), all this without removing the user's hands from the drive levers.
US10722408B2	Wearable article having graphics The present disclosure is related to a wearable article continuous in a longitudinal direction and a transverse direction comprising a main body comprising an outer cover layer at the most garment-facing side and a backsheet attached to the skin-facing surface of the outer cover layer, wherein the main body has a front waist panel, a back waist panel and a crotch panel between the front waist panel and the back waist panel, and wherein the longitudinal length of the outer cover layer is longer than the longitudinal length of the crotch panel and shorter than the longitudinal length of the backsheet; a ring-like belt comprising a front belt and a back belt, wherein each of the front belt and the back belt comprises an inner sheet, an outer sheet and a plurality of elastic strands sandwiched therebetween; a front waist graphic region disposed on the front waist panel where the outer cover layer is absent, and a back waist graphic region disposed on the back waist panel where the outer cover layer is absent, wherein at least one of the front waist graphic region and the back waist graphic region comprises a waist graphic printed on the main body; a transitional region disposed on the front waist panel and the back waist panel where the outer cover layer exists; and a first belt graphic disposed on one or both of the front and back belts, the first belt graphic not being provided by the main body.
US10722407B2	Absorbent article with partial laminate waist elastic member An absorbent article (10) can include a waist elastic member (50, 150, 250). In one embodiment, the waist elastic member (50, 150, 250) can include a first longitudinal zone (92), a second longitudinal zone (94), and a middle longitudinal zone (93). The first longitudinal zone (92) can include a first elastic member (76) disposed between two layers of material, the second longitudinal zone (94) can include a second elastic member (78) disposed between two layers of material, and the middle longitudinal zone (93) can include less layers of materials than each of the first longitudinal zone (92) and the second longitudinal zone (94).
US10722396B2	Apparatus and methods for ocular injection An apparatus includes a housing coupled to a medicament container, which is coupled to a needle. An injection assembly is disposed within the housing and includes an energy storage member and an actuation rod. A distal end portion of the actuation rod is disposed within the medicament container. The energy storage member can produce a force on a proximal end portion of the actuation rod sufficient to move the distal end portion of the actuation rod within the medicament container. This can convey at least a portion of a substance from the medicament container via the needle when a distal tip of the needle is disposed within a first region of a target location. The force is insufficient to move the distal end portion of the actuation rod within the medicament container when the distal tip of the needle is disposed within a second region of the target location.
US10722393B2	Hand orthoses Hand orthotics are provided for protecting and/or supporting phalanges, metacarpals and/or ligaments of the hand providing thin, lightweight, moldable devices that form to the digits of and to the hand to provide shock absorption and limited range of motion in flexion and extension movements of the digits of the hand, but mitigate or prevent hyperextension. Each orthotic has several plates of thermal plastic, pre-molded carbon fiber or the like that are generally, if not entirely, inflexible and interlinked through limited range of motion hinges, overlapping, and/or abutting plates that accommodate stability and protection. The plates are contained within, on top, underneath, or permutations of these, a form fitting material (e.g. neoprene or vinyl) to maintain a tight fit to the hand, digits and wrist. A thumb plate is hinged to an upper or lower hand plate of the device and includes a loop for receiving the thumb.
US10722387B2	Stent graft with fixing elements and insertion system The present invention relates to a stent graft and to an insertion system for the stent graft according to the invention. The stent graft comprises a stent graft portion with a self-expanding stent having successive rings of meandering supports and a first prosthesis material secured on the rings. On at least one of its rings, the stent graft portion has two loop-shaped fixing elements which are attached via a common fixing area and which are attached to the supports of the rings in such a way that, due to the fact that they are guided in opposite directions around the hollow cylindrical body, the latter is compressible. Furthermore, the insertion system according to the invention also has a pin element with which the loop-shaped fixing elements can be threaded on.
US10722382B2	Ball and cup impactors for implanting a hip prosthesis New surgical instruments and methods used to implant elements of a reverse hip prosthesis in a patient are described. The instruments are impactors which are struck with a hammer at their proximal ends after the instrument has been used to position the implant element in the patient. An acetabular cup impactor has inclination and anteversion rods which are used to position the acetabular cup optimally in the acetabulum. An acetabular ball impactor affixes the acetabular ball in the acetabular cup by means of a Morse taper. And a femoral cup impactor affixes the femoral cup in the femoral stem by means of a Morse taper.
US10722381B2	Surgical trays, instruments and methods for removing components of a hip replacement prosthesis Surgical trays and tools for use in hip revision surgery wherein the implanted prosthesis is a reverse prosthesis comprising an acetabular ball and a femoral cup. A set of trays is provided having tools for i) separating a femoral cup from an acetabular ball, ii) separating a femoral cup from a femoral implant and iii) separating an acetabular ball from an acetabular cup. A tool for removing an acetabular cup from an acetabulum is also described. A surgical method is also provided wherein the acetabular ball and femoral cup are separated first followed by, in any order, separating the femoral cup from the femoral implant and separating the acetabular ball from the acetabular cup.
US10722378B2	Surgical implant including a body portion and at least one attached tier A surgical implant includes a body portion, a first tier, and a second tier. The first tier is attached to an upper surface of the body portion, and the second tier is attached to a lower surface of the body portion. Each of the upper surface and the lower surface of the body portion includes channels formed therein. The first tier includes a first layer including a plurality of first slats and a second layer including a plurality of second slats, where the plurality of first slats and the plurality of second slats intersect one another to form openings therebetween. The second tier includes a third layer including a plurality of third slats and a fourth layer including a plurality of fourth slats, where the plurality of third slats and the plurality of fourth slats intersect one another to form openings therebetween. When the first tier and the second tier are attached to the body portion, a passageway is formed through the openings formed in the first tier to the channels in the upper surface of the body portion, and a passageway is formed through the openings formed in the second tier to the channels in the lower surface of the body portion.
US10722377B2	Expandable fusion device and method of installation thereof The present invention provides an expandable fusion device capable of being installed inside an intervertebral disc space to maintain normal disc spacing and restore spinal stability, thereby facilitating an intervertebral fusion. In an exemplary embodiment, the present invention provides an intervertebral implant. The intervertebral implant may be configured to transition from a collapsed configuration having a first height and a first width to an expanded configuration having a second height and a second width.
US10722373B2	Implants, systems and methods of using the same Implants, device, systems and methods for replacing an articulation surface in a joint, for example, shoulder prostheses with stemless humeral components or stemmed humeral components. Methods for using the shoulder prostheses with stemless humeral components or stemmed humeral components are also disclosed.
US10722371B2	Coupling device for connecting prosthesis components by a self-locking press fit A coupling device is for connecting prosthesis components by a self-locking press fit on an end, formed as a cone, of a first prosthesis component that is inserted in bone tissue. The coupling device has an outer coupling body with a socket having a conically tapering inner wall, and an expansion sleeve having a lateral surface forming a male taper and an operative forming a female tape. The expansion sleeve is mounted in the socket so as to be rotatable about the longitudinal axis thereof, and receives the cone. The expansion sleeve is expandable radially outwardly to form the self-locking press fit, such that the expansion sleeve widens radially when the cone is inserted into the expansion sleeve. As a result, the self-locking press fit between the cone of the first prosthesis component and the coupling device is established.
US10722370B2	Customized bendable osteochondral allografts A customized allograft that is bendable and suitable for allo-grafting of an articular joint, including the thumb.
US10722366B2	Method of surgically providing a person with a neopenis A method of surgically providing a person with a neopenis is described and includes forming a neophallus from an inverted vagina of the person.
US10722364B2	Prosthetic valve for treating diseases causing reflux affecting the lower limbs The present invention relates to a monocusp prosthetic valve comprising a flap made of biocompatible material, and a stent made of biocompatible or bio-absorbable material, said stent having meshes defining holes with profile represented by any closed curve or polygonal shape, wherein in said prosthetic valve the flap is sewn on said stent by means of pairs of suture points that are longitudinally extended along opposite surfaces of said flap.
US10722363B2	Methods, devices, and systems for percutaneously anchoring annuloplasty rings Apparatus, systems, and methods are provided for percutaneous transcatheter delivery and fixation of annuloplasty rings to heart valves. An annuloplasty ring includes an outer tube, an inner body member, and an anchor deployment system. The outer tube includes a plurality of windows and has an axis along its length. The internal body member includes a plurality of anchors formed perpendicular to the axis. The anchor deployment system selectively rotates the internal body member with respect to the axis of the outer tube. The rotation deploys the plurality of anchors through the plurality of windows.
US10722361B2	Heart valve prosthesis A heart valve prosthesis is proposed, including a housing, at least one leaflet installed within the housing, at least one sensor and/or valve performance monitoring device. The sensor and/or monitoring device is built into the housing and/or leaflet. In an embodiment, the housing and/or leaflet has an oscillating circuit including an inductor coil connected to the sensor and/or monitoring device. One such coil can be built into the housing, and another coil can be built into the leaflet. In another embodiment, one coil can be built into a first leaflet, and another coil can be built into a second leaflet, wherein the sensor and/or monitoring device determines a degree of opening/closing the leaflets by measuring inductive interconnection between the coils, and operation timing characteristics of the valve. In an embodiment, the valve may include an emission sensor disposed within the leaflet and/or housing capable of detecting the valve's open/closed positions.
US10722359B2	Heart valve docking devices and systems Docking devices for docking a prosthetic valve at a native valve of a heart can include a coiled docking anchor and a retrieval suture. The docking device and retrieval suture can be configured for improved retention and retrieval of the docking device after deployment. The docking devices can have an end portion with a central axis. The retrieval suture can be connected to the end portion such that a line of force applied by applying tension to the retrieval suture is substantially aligned with the central axis.
US10722350B2	Leaflet in configuration for function in various shapes and sizes A prosthetic heart valve includes a collapsible and expandable stent having a proximal end, a distal end, an annulus section adjacent the proximal end and an aortic section adjacent the distal end. The heart valve further includes a plurality of commissure features disposed on the stent, and a collapsible and expandable valve assembly, the valve assembly including a plurality of leaflets connected to the plurality of commissure features, each of the plurality of leaflets having a free edge and being configured to have a tension line aligned near the free edge to prevent backflow.
US10722343B2	Fixation member with separate eyelet and methods of use thereof In one embodiment of the present disclosure, an implant system for securing tissue to bone, including a first fixation member releasably engaged to a first inserter, the first fixation member having a throughbore adapted to accept a filament therethrough and a cannulation extending from a proximal end of the first fixation member to a distal end of the first fixation member, the first inserter positioned through the cannulation and having a distal tip extending distally beyond the distal end of the first fixation member, and a second fixation member releasably engaged to a second inserter different from the first inserter, the second fixation member having a size capable of being positioned within the bonehole.

1 2 3 4 5 6 7 8 9 10