Document | Document Title |
---|---|
US09238403B2 |
Radiator bushing
A radiator bushing mounted in a vehicle body to support a load of a radiator includes a mounting portion having an outer side fixed to the vehicle body, a center core at a center with a center hole, and a support portion having an inner side and an outer side. The support portion includes a first support portion and a second support portion with an inclined angle α of the first support portion and an inclined angle β of the second support portion are determined to be different.The support portion has a two-stage structure in which inclined angles are different, and a direction ratio of a Z axis direction to an X axis direction and a Y axis direction may be easily adjusted. |
US09238399B2 |
Slide structure for power slide door and cable assembly method for slide door center
A slide structure that slides a door of a vehicle, including a roller hinge attached to the door; a guide roller that rolls within a rail of the door; a cable end that transmits a sliding force to the roller hinge to slide the door; and a guide roller pin that attaches the guide roller and the cable end to the roller hinge. |
US09238398B2 |
Refrigeration systems and methods for connection with a vehicle's liquid cooling system
An exemplary refrigeration system for cooling food or beverages may use a liquid cooling system of a vehicle. The refrigeration system may include a compartment in which the food or beverages may be placed and removed, a chilled liquid coolant system having a connection through which liquid coolant is received from the liquid cooling system of the vehicle, and a heat exchanger operationally coupled with the chilled liquid coolant system and the compartment to transfer heat from the compartment into the liquid coolant. The refrigeration system may also include a second chilled coolant system through which a second coolant flows and a second heat exchanger operationally coupled with the second chilled coolant system and the compartment to transfer heat from the compartment. The chilled liquid coolant system and the second chilled coolant system may operate together as a cascade cooling system. |
US09238397B2 |
Motor vehicle air conditioning arrangement
A motor vehicle air conditioning arrangement having a heater (H) and an evaporator (V) which are arranged in an air guiding housing (2). Each of the heater and evaporator have a plane that is traversed perpendicularly by air and have an inclined position such that the planes are each arranged at an angle of less than 40° with respect to the horizontal plane (E). |
US09238395B2 |
Rear wheel suspension, and a motor vehicle
A rear wheel suspension including first and second suspension devices carrying a right and left, respectively, rear wheel rotating in a wheel plane forming a toe angle with respect to a longitudinal axis and a camber angle with respect to a vertical axis. A transversal beam connects the first and the second suspension device. Each suspension device includes a wheel spindle housing, defining a wheel center, and a leading link and a trailing link connected to the vehicle body. The transversal beam permits bending for vertical loads to provide the suspension devices a deflection to adjust the toe and camber angles such that the changes of the camber angles when the wheel planes converge towards an upper point above the wheel center connect to a controlled adjustment of the toe angles such that the wheel planes converge directionally towards a rear point located rearwards of the wheel center. |
US09238394B2 |
Subframe for a motor vehicle
A subframe for a motor vehicle for pivotally connecting wheel suspension elements and for supporting a stabilizer which extends in a transverse direction of the motor vehicle, said subframe includes lateral longitudinal members extending in a longitudinal direction of the motor vehicle and at least one cross member connecting the longitudinal members in a transverse direction of the vehicle, the at least one cross member being constructed as a hollow profile part having a hollow profile forming a stabilizer groove, the at least one cross member having a longitudinal through passage for a cardan shaft which is drivable by a rear axle differential carried by the subframe, the through passage being vertically offset relative to the stabilizer groove. The stabilizer connects the longitudinal members in the transverse direction of the motor vehicle, and extends at least in part in the stabilizer groove between the longitudinal members. |
US09238382B2 |
Greetings card and a blank for forming it
The present invention relates to greetings cards generally and to Christmas cards and novelty cards in particular. Greetings cards, usually packaged with an envelope, come in a variety of styles. There are both mass-produced as well as handmade versions that are distributed by hundreds of companies large and small. There is a belief that greetings cards are becoming bland; the sending of Christmas cards is often seen as a chore. Equally, there is an increasing number of cards which are sent to surprise the recipients, or joke cards, which may be sent to communicate emotions to a recipient. The present invention seeks to provide a solution to the problems addressed above. The present invention seeks to provide a novelty card which is simple to manufacture and can provide a novelty noise to be created when first used. |
US09238381B2 |
Sheet bundle binding processing apparatus and image forming system having the same
The purpose of the present invention is to provide a sheet bundle binding processing apparatus capable of performing a binding process on a sheet bundle set at a manual setting portion and a sheet bundle set on a processing tray, respectively, with a simple structure at low cost. The present invention comprises a sheet bundle binding processing apparatus including an external casing, a manual setting portion which is integrally formed with the external casing and to which a sheet bundle is inserted, a binding device which performs a staple-binding process on the sheet bundle inserted to the manual setting portion as being movable between a binding position where the sheet bundle of the manual setting portion is bound and a staple replenishment position where staples are replenished, and an open-close cover which is arranged at the external casing at a position being different from the manual setting portion. |
US09238380B2 |
Serial inkjet printer
A serial inkjet printer includes a recording head having a plurality of nozzles between which a pitch is X inches, a carriage, a first roller pair, and a second roller pair. The first roller pair is configured to move a medium at an upstream side of a conveyance direction of the medium relative to the recording head, and includes a drive roller with a hollow structure and a driven roller. A circumferential length Y of the drive roller is 2 to 4 inches. When a length along the conveyance direction of a row formed by the nozzles is Z inches, Y is greater than Z. While repeating scanning of the recording head and conveying of the medium, recording is performed in band units at a printing speed of 20 to 30 ipm, and stop error precision of the medium during conveyance is X/2 inches or less. |
US09238379B2 |
Media conveyance device, printer, and control method of a printer
A printer takes up slack in media while suppressing excessive rewinding, and can check the movement of a movable member that moves following change in tension on the media. The printer drives the supply motor in a first operating mode in a slack removal operation that rewinds the recording paper (media) onto a paper roll 2, and stops driving the supply motor when the tension lever (movable member) moves from a slack-side first position toward a second position. In the movement checking operation, the supply motor is driven in a second operating mode with greater output than the first operating mode, rewinds the recording paper on the paper roll, and sets the tension lever to the second position. |
US09238378B2 |
System and method for printing on a flexible body
A printing system includes carriage assemblies, a preparation station, a printing station, and a selection station. The carriage assemblies receive flexible bodies and are coupled to a conveyance assembly that moves the carriage assemblies along a direction of travel. The preparation station receives the flexible bodies from the loading station and manipulates the flexible bodies to at least partially flatten printing surfaces of the flexible bodies. The printing station prints images on the flexible bodies. The selection station examines the images on the flexible bodies and selects one or more of the flexible bodies based on the images. The selection station also individually grips and removes selected flexible bodies from the carriage assemblies and conveys the selected flexible bodies to a first collection location while the other flexible bodies remain on the carriage assemblies and are conveyed to a different, second collection location. |
US09238375B2 |
Tape drive and method of operation
A method of operating a tape drive which includes a pair of tape spool supports, upon one of which a supply spool is mountable and upon a second one of which a take up spool is mountable, each tape spool support being driveable by a respective motor to transfer tape between the spools, the tape drive further including a controller to control each of the motors, wherein the method includes reducing tension in tape extending between the two spools during a period when the tape is substantially stationary. |
US09238373B2 |
Fluid ejection device
A fluid ejection device includes a fluid storing unit and a fluid outlet. A fluid pressing unit presses the fluid storing unit and causes fluid to flow from the fluid outlet. A connection pipe has an end that is connected to the fluid outlet. A fluid ejection unit ejects the fluid, which is received from a fluid intake port to which the other end of the connection pipe is connected, in a pulse-like manner according to a drive signal generated by a fluid-ejecting control unit. An ejecting-instruction input unit receives a fluid ejecting instruction. If the pressure in the fluid storing unit is equal to or higher than an upper limit value in a range determined with reference to a target pressure value, the drive signal is not generated. When the pressure in the fluid storing unit is lower than the upper limit value, the drive signal is generated. |
US09238370B2 |
Liquid accommodating container
A liquid accommodating container in which a fiber member and a liquid are accommodated has a fiber ratio of the fiber member is 5% or more to 30% or less, a fiber diameter of the fiber member is 10 μm or more to 50 μm or less, a volume average particle diameter (D50) of a pigment included in the liquid satisfies a condition of 50 nm |
US09238367B2 |
Droplet discharging head and image forming apparatus
A droplet discharging head includes a passage substrate in which individual liquid chambers are formed; a plurality of piezoelectric elements formed on the passage substrate; a plurality of wirings for connecting electrodes of the plurality of piezoelectric elements and drive circuit connecting portions for being connected to a drive circuit, respectively, formed on the passage substrate; and a support substrate, formed on the passage substrate, provided with a concave portion for housing the plurality of piezoelectric elements at a surface facing the passage substrate, the support substrate being provided with an opening portion above the drive circuit connecting portions, wherein the support substrate is adhered to the passage substrate at a support substrate adhering region of the passage substrate including area where the wirings are formed, and wherein a wiring space between each adjacent wirings is formed to have a crank portion at the support substrate adhering region. |
US09238366B2 |
Piezoelectric actuator, liquid ejecting head, and method of manufacturing piezoelectric actuator
Provided is piezoelectric actuator includes; a vibrating plate; a first electrode provided on the vibrating plate; a first seed layer provided on the first electrode; a second seed layer provided on the vibrating plate at least at a position adjacent to the first electrode; a first piezoelectric layer provided on the first seed layer, the first piezoelectric layer and has a perovskite structure; a second piezoelectric layer that is provided to cover the first piezoelectric layer and the second seed layer; and a second electrode that is provided on the second piezoelectric layer. The first piezoelectric layer and the second piezoelectric layer are preferentially oriented to a (100) face. |
US09238365B1 |
Flex circuit board with topographical structures to facilitate fluid flow through the layer
A flex circuit board provides islands of electrically isolated material surrounding openings in the flex circuit board to preserve fluid integrity of passageways passing through an electrically insulating layer of the flex circuit board. The electrically isolated islands surround exits of the passageways through the electrically insulating material and extend the passageways through an electrically conductive layer of the flex circuit board. Consequently, fluid passing through the passageways and electrically isolated islands in the flex circuit board is not subjected to electrical current. |
US09238364B2 |
Liquid jetting apparatus and piezoelectric actuator
There is provided a liquid jetting apparatus, including: a channel structure in which a liquid channel including a nozzle and a pressure chamber communicating with the nozzle is formed; a piezoelectric element including a piezoelectric body and an electrode; a driving device; and a cover member joined to the surface of the channel structure. A first wiring section connected to the electrode is formed on the surface of the channel structure, and the cover member includes a cover body section and a wiring connection section. A second wiring section is formed in the cover member. The wiring connection section is joined to the surface of the channel structure in a state that the second wiring section is electrically conductive with the first wiring section. A thickness, of the wiring connection section is thinner than a thickness of the cover body section. |
US09238362B2 |
Inkjet printing apparatus
When one of first to third power supply circuits breaks down, a change-over switch performs switching of electrical connection such that drive voltage is allowed to be supplied from normal one of the first to third power supply circuits also to one of the inkjet heads connected to the breakdown power supply circuit. Consequently, the power supply circuits are partially sharable with a plurality of inkjet heads, causing no necessity of stopping the apparatus for replacing one breakdown power supply circuit. As a result, suppression in decrease of throughput of the apparatus is obtainable. |
US09238358B1 |
Multicolor offset printing press
A multicolor offset printing press includes a first blanket cylinder, at least four plate cylinders, a collecting plate cylinder, a collecting blanket cylinder, at least two partial plate cylinders, and a plurality of ink devices. The first blanket cylinder performs printing on a transported target printing product. The four plate cylinders are in contact with the first blanket cylinder. The collecting plate cylinder is in contact with the first blanket cylinder on the downstream side in the rotational direction of the first blanket cylinder with respect to a last plate cylinder positioned on the most downstream side in the rotational direction of the first blanket cylinder among the four plate cylinders, and on the upstream side in the rotational direction of the first blanket cylinder with respect to a printing portion at which the first blanket cylinder performs printing on the target printing product. The collecting blanket cylinder is in contact with the collecting plate cylinder and transfers ink to the collecting plate cylinder. The two partial plate cylinders are in contact with the collecting blanket cylinder. The plurality of ink devices supply inks to the four plate cylinders and the two partial plate cylinders, respectively. |
US09238354B2 |
Intermediate film for laminated glass, multilayer intermediate film for laminated glass, and laminated glass
An interlayer film for a laminated glass includes a thermoplastic resin and a plasticizer. The ratio of a high molecular weight component with an absolute molecular weight of 1000000 or more in the thermoplastic resin is 7.4% or higher, or the ratio of a high molecular weight component with a polystyrene-equivalent molecular weight of 1000000 or more in the thermoplastic resin is 9% or higher. A first multilayer interlayer for a laminated glass includes an interlayer film for a laminated glass and an interlayer film for a laminated glass that contains it thermoplastic resin and a plasticizer, and is laminated on one face of the interlayer film for a laminated glass. |
US09238349B2 |
Thin diamond film bonding providing low vapor pressure at high temperature
This disclosure concerns bonding a thin film of diamond to a second thick diamond substrate in a way that does not cause the exposed (un-bonded) diamond surface to become contaminated by the bonding process or when the bonded diamond is held at high temperature for many hours in vacuum. |
US09238347B2 |
Structural member formed from a solid lineal profile
A structural member that contains a solid lineal profile (516, 600, 700) that is formed from a plurality of consolidated ribbons (12). Each of the ribbons includes unidirectionally aligned continuous fibers embedded within a thermoplastic polymer matrix. The continuous fiber ribbons (12) are laminated together during pultrusion to form an integral solid profile (516, 600, 700) having very high tensile strength properties. |
US09238346B2 |
Microfluidic device, composition and method of forming
A composition made of at least 60 wt. % of a thermoplastic elastomer resin and additives that are solid at least from 0-50° C., that has a Shore A hardness that is less than about 50 bears a patterned surface, the pattern comprising at least one microfluidic channel having a cross-sectional dimension smaller than 100 microns is a substrate for forming a microfluidic device. The chief advantages of such compositions are: its ability to bond in a sealing manner to smooth surfaces of many different compositions, its ease of manufacture and microstructure patterning, and its general impermeability to liquids. |
US09238340B2 |
Processes for the production of electro-optic displays
Electrical connection between the backplane and the front electrode of an electro-optic display is provided by forming a front plane laminate (100) comprising, in order, a light-transmissive electrically-conductive layer (104), a layer of electro-optic material (106), and a layer of lamination adhesive (108); forming an aperture (114) through all three layers of the front plane laminate (100); and introducing a flowable, electrically-conductive material (118) into the aperture (114), the flowable, electrically-conductive material being in electrical contact with the light-transmissive electrically-conductive layer (104) and extending through the adhesive layer (108). |
US09238339B2 |
Hybrid fastener and method of making the same
A hybrid fastener comprises a composite body having a tip, and a metal sleeve surrounding and locked to the tip. |
US09238338B2 |
Method of fabricating composite laminate structures allowing ply slippage during forming
A composite structure having a contoured cross section is fabricated by assembling a flat ply stack and forming the stack. The full plies in the stack are tacked through their entire thickness and the partial plies are tacked to individual ones of the full plies in a manner that enables the plies to slip in relation to each other, preventing wrinkling and distortion of the plies during forming. |
US09238335B2 |
Mandrel for autoclave curing applications
A mandrel used to cure a composite part layup has an elastic body and at least one internal open space therein. The internal open space is configured to allow substantially uniform thermal expansion of the body during curing. |
US09238334B2 |
Composite layer forming system
A method and apparatus for forming a stack of composite layers into a desired shape is present. The stack of composite layers may be positioned on a tool and a number of compressible supports such that the stack of composite layers may be substantially flat on the tool and the stack of composite layers may be substantially flat on the number of compressible supports. A flexible sheet may be placed on top of the stack of composite layers. A vacuum load may be applied on the stack of composite layers on the tool and the number of compressible supports using the flexible sheet such that consolidation of the stack of composite layers occurs to form a desired shape on the tool and the number of compressible supports compress during forming of the desired shape. |
US09238330B2 |
Three-dimensional surface texturing
An additive three-dimensional fabrication process is improved by controlling deposition rate to obtain surface textures or other surface features below the nominal processing resolution of fabrication hardware. Sub-resolution information may be obtained, for example, from express metadata (such as for surface texture), or by interpolating data from a source digital model. |
US09238324B2 |
Biaxially oriented polylactic acid film with reduced noise level
Described are biaxially oriented polylactic acid (BOPLA) films with a novel formulation that exhibits a softer feel and quieter sound, without jeopardizing film making stability. The films can be used, for example, in packaging applications. The films can be metallized, or combined with barrier coatings or layers, for improved gas barrier properties particularly for moisture vapor transmission barrier desired in packaging applications. The films can also be printing films for packaging applications and may be transparent or matte in appearance. The films have characteristics that are beneficial to converting processes, are economical, and maintain bio-compostability similar to typical BOPLA films. |
US09238321B2 |
Molding system having a residue cleaning feature and an adjustable mold shut height
A method is provided of cleaning of a portion of a mold component, the portion of the mold component including a passage configured, in use, to allow passage of fluid and to prevent passage of melt, the method comprising: entering the mold component into a cleaning configuration, whereby a portion of the passage becomes part of a molding surface; performing a molding cycle to fill in at least the portion of the passage with molding material for incorporation and removal of a residue there from. Also provided is a mold having a first mold half and a second mold half, the halves being movable relative to each other. A mold shut height adjustment apparatus can provide for a change in the mold shut height. |
US09238318B2 |
Method for manufacturing a motor
A method for manufacturing a motor includes the following steps of: providing a substrate with an opening and a bushing; disposing the bushing within the opening of the substrate; providing a cushioning material disposed between the substrate and the bushing by injection molding. |
US09238313B2 |
Apparatus, mold and method for producing shaped articles from a UV-curable composition
A mold for molding a UV cured article in an inner volume thereof, the mold including a mold wall surrounding the inner volume, the mold including a UV-transparent polymer and UV radiation deflecting particles immersed in or adhered to a surface of the mold wall. Also provided is an apparatus including the mold and a process for molding a UV cured article. |
US09238308B2 |
Cutting method of honeycomb formed body
A cutting method of a honeycomb formed body is provided. This is a cutting method of a honeycomb formed body in which, while a kneaded material containing a ceramic raw material is extruded to form a honeycomb formed body with a honeycomb shape having partition walls defining and forming a plurality of cells, the extruded honeycomb formed body is cut before drying by a cutting blade vibrated at a frequency of 0.3 kHz or more in a direction perpendicular to a direction in which this honeycomb formed body moves. It is preferably a cutting method of a honeycomb formed body in which the cutting blade is vibrated at a high frequency of 10 kHz or more. |
US09238307B2 |
Fiberboard and methods for making same
Fiberboards and methods for making the same. The fiberboard can include two or more compressed fibers; less than 10 wt % of resin and wax, based on total weight of the fibers; and a coating comprising at least one colorant, wherein the colorant covers at least 70% of the fiberboard surface. |
US09238305B2 |
Switchable plate manufacturing vacuum tool
Systems, methods, and apparatus for a vacuum tool having a switchable plate, such that a common vacuum tool may be adapted with different plates. A switchable plate may form the entirety of the vacuum tool's material contacting surface or a switchable plate may form a portion of the material contacting surface. The vacuum tool is effective for picking and placing one or more manufacturing parts utilizing a vacuum force. |
US09238299B2 |
Support assembly
A support device is provided. The support device includes a support assembly with an elongated first body defining a cantilever mounting and a support surface. |
US09238296B2 |
Multilayer chemical mechanical polishing pad stack with soft and conditionable polishing layer
A multilayer chemical mechanical polishing pad stack is provided containing: a polishing layer; a rigid layer; and, a hot melt adhesive bonding the polishing layer to the rigid layer; wherein the polishing layer exhibits a density of greater than 0.6 g/cm3; a Shore D hardness of 5 to 40; an elongation to break of 100 to 450%; and, a cut rate of 25 to 150 μm/hr; and, wherein the polishing layer has a polishing surface adapted for polishing the substrate. |
US09238291B2 |
Machine for smoothing or polishing slabs of stone materials, such as natural and aggolomerated stone, ceramic and glass
A machine for smoothing or polishing slabs of stone material, such as natural and agglomerated stone, ceramic and glass, comprises a longitudinal bench (12) over which the slabs to be machined move, at least one pair of opposite bridge support structures (20, 22) arranged astride the bench, and at least one beam (24) transversally movable and supported by said bridge structures. At least one vertical-axis and vertically movable mandrel (40) is mounted eccentrically on a mandrel supporting structure (30) which rotates about its vertical axis (Z1) and is supported on said beam (24). The mandrel has, mounted on its bottom end, a device carrying the smoothing or polishing tools and rotating about the axis of rotation of said mandrel. In this way, the tool carrying device performs a movement composed of the rotation about the axis of rotation of the mandrel, a revolving movement about the axis of rotation of the mandrel carrying structure and a translation movement due to the movement of the beam. |
US09238287B2 |
Multi-nozzle machine tool cooling system
Multiple fluid nozzles are mounted in a machine tool such that the cutting tool in the spindle is targeted with liquid or gas cutting fluid from multiple directions, providing better coverage and thereby more effectiveness. This provides more efficient and safer use of a machine tool by automating the aiming of fluids at a desired location. Multiple nozzles at respective multiple physical locations are preferably controlled by a single control unit, so they can be synchronized to maintain a common target point on a cutting tool, even if the nozzles are located asymmetrically or non-uniformly with respect to the spindle axis or target point. Preferably, modular nozzle assemblies can be configured for flexibility in mounting on the machine tool. |
US09238281B2 |
Rebuildable micro-fluidic valve assembly
A multi-position valve assembly including a valve housing, a stator element and a rotor element rotatably mounted about a rotational axis. The valve assembly further includes a pressure adjustment assembly movable between a release position and a stop position, hard stopped relative to the valve housing. The pressure adjustment assembly includes a pressure adjuster device configured to movably cooperate between the rotor element and the valve housing to adjustably generate an axial compression pressure at the rotor-stator interface at a calibrated operating pressure, PC. When the pressure adjustment assembly is oriented in the release position, the axial compression pressure is substantially removed from the rotor-stator interface. In contrast, when the pressure adjustment assembly is oriented in the stop position, the axial compression pressure is substantially reproduced at the calibrated operating pressure, PC. |
US09238279B2 |
Combustible fluid cutting safety system
Embodiments of the present invention provide components and a system for providing a safer environment for using a cutting torch. The system includes a cutting torch and a control box. There is communication from the user to the control box to allow fluids to flow to the torch. The control box includes closed biased valve(s) such that if there is a condition where there is no instruction from the torch to the control box and/or power is lost, the valves will shut, preventing fluid from flowing into the torch. |
US09238278B2 |
Solder transfer substrate, manufacturing method of solder transfer substrate, and solder transfer method
A solder transfer substrate, including: a base layer; an adhesive layer arranged on the base layer; and plural solder powders arranged on the adhesive layer, wherein in the base layer, which is a porous member, a plurality of holes, which allow at least a peeling-off liquid to pass therethrough, are formed from a side thereof on which the adhesive layer is not arranged to a side thereof on which the adhesive layer is arranged. Particularly, the adhesive layer has a characteristic of expanding with the peeling-off liquid infused. |
US09238275B2 |
Brazing method and brazed structure
In this brazing method, which brazes an insulating substrate and a top plate that configure an HV inverter cooler, the insulating substrate is disposed on the top plate with a brazing material layer therebetween, and then, by means of laser irradiation, laser welding is performed at an arbitrary plurality of positions at the joining section between the top plate and the insulating substrate, thus provisionally affixing the insulating substrate to the top plate. Thereafter, by means of heating and melting the brazing material layer, the insulating substrate is brazed onto the top plate with the plurality of laser-welded positions as the brazing start points. After brazing, a power semiconductor is joined onto the insulating substrate corresponding to the center portion of the region surrounded by the plurality of brazing start points. |
US09238267B2 |
Cutting insert and method for production thereof
Cutting insert made of hard metal, cermet or ceramic substrate body with multi-layer coating applied thereto by CVD methods. The coating has a total thickness of 5 to 40 μm and, starting from the substrate surface, has one or more hard material layers, an alpha aluminum oxide (α-Al2O3) layer of a layer thickness of 1 to 20 μm and optionally at least portion-wise over the α-Al2O3 layer one or more further hard material layers as decorative or wear recognition layers. The α-Al2O3 layer has a crystallographic preferential orientation characterized by a texture coefficient TC (0 0 12)≧5 for the (0 0 12) growth direction.The α-Al2O3 layer has an inherent stress in the region of 0 to +300 MPas, and the substrate within a region of 0 to 10 μm from the substrate surface has an inherent stress minimum in the region of −2000 to −400 MPas. |
US09238263B2 |
Thermocompensated spring and method for manufacturing the same
The invention relates to a method of manufacturing a spring for a timepiece, including the following steps: (a) forming a body using first and second metallic materials secured to each other; (b) decreasing the section of the body; and winding the body to form the spring. The invention also relates to the spring obtained via the method. The invention concerns the field of regulating members for timepieces. |
US09238261B2 |
Sheet loading system with first and second transfer feeders
A sheet loading system is provided for consecutively loading sheets onto a multi-step process press machine such that a plurality of workpieces loaded respectively on a plurality of workstations is simultaneously processed by one stroke. The sheet loading system includes a conveyor, a sheet loader, a first sheet transfer feeder, and a second sheet transfer feeder. |
US09238260B2 |
Method and apparatus for creating formed elements used to make wound stents
A method for forming a wave form for a stent includes moving a first forming portion of a first forming member across an axis along which a formable material is provided in a first direction substantially perpendicular to the axis to engage and deform the formable material while engaging the formable material with a first forming portion of the second forming member. The method includes moving the first forming portion of the first forming member and the first forming portion of the second forming member across the axis in a second direction that is substantially opposite the first direction to draw and form the formable material over the first forming portion of the second forming member, disengaging the first forming member from the formable material, and moving the first forming member to position a second forming portion of the first forming member to face the formable material. |
US09238259B2 |
Method and device for winding hot-rolled strip
In a method for winding hot-rolled strip (1), comprising —a decoiler mandrel (4), —at least one first pressing device (7), —at least one second pressing device (8), wherein the hot-rolled strip (1) is pressed from the first pressing device (7) and the second pressing device (8) toward the decoiler mandrel (4), the hot-rolled strip (1) is pushed or pulled away from the decoiler mandrel (4) between the first pressing device (7) and the second pressing device (8), thereby subjecting the hot-rolled strip (1) to a prebending step. The invention further relates to a device for winding hot-rolled strip (1). |
US09238258B2 |
Method for producing double-wall tube with braided wires at its interface
Provided is a method for producing a double-wall tube with braided wires at its interface in which the braided wires are interposed between an outer-wall and inner-wall blank tubes and then a drawing process is applied so as for the braided wires to be brought into close contact with the inner surface of the outer-wall tube and the outer surface of the inner-wall tube, the method comprising: polishing the inner surface of the outer-wall blank tube and the outer surface of the inner-wall blank tube so that a surface roughness thereof satisfies Ra<1.0 μm, followed by interposing the braided wires between the outer-wall and inner-wall blank tubes; performing a sinking drawing process so that the difference of the outer diameter of the resulting double-wall tube relative to a die bore diameter is 0.1 mm to 0.3 mm; and subsequently performing heat treatment. The double-wall tube produced is suitable as a heat-transfer tube. |
US09238253B2 |
Processed DRI material
A processed DRI material having an average surface roughness (Ra) of less than 1.5 μm is disclosed. A method and system for making processed DRI are also disclosed. One embodiment of the method and system may include assembling a rotatable chamber having an internal screen capable of supporting DRI during tumbling, with at least one opening in the chamber to permit fines to exit the chamber during tumbling, and delivering DRI into the chamber to tumble the DRI on the screen to remove fines from the DRI. Another embodiment of the method and system may include assembling a rotatable chamber having a feed end and an exit end, and having a screen therein capable of supporting DRI as the DRI moves through the chamber, and delivering DRI to the chamber and rotating the chamber to tumble the DRI while removing fines. |
US09238251B2 |
Dual-coil geophone accelerometer
An apparatus and a method for detecting vibration are disclosed. The apparatus comprises a housing, a magnetic structure forming a magnetic field in the housing, and a coil structure in the magnetic field, concentric of the magnetic structure. In response to external vibration, the coil structure and the magnetic structure are movable with respect to each other. The coil structure comprises at least two sets of coils overlapped in space, of which a first coil set is for detecting vibration and a second coil set is for applying control in accordance with a control signal. |
US09238250B2 |
Control apparatus for capacitive electromechanical transducer, and method of controlling the capacitive electromechanical transducer
Provided is a control apparatus and control method for a capacitive electromechanical transducer with small decrease in transmission/reception efficiency, and with sets of transmission/reception characteristics with different frequency ranges. The apparatus has cells each including first and second electrodes facing each other via a gap; includes a driving/detecting unit and an external stress applying unit. The driving/detecting unit performs at least one of causing the second electrode to vibrate and transmit elastic waves by generating an AC electrostatic attractive force between the electrodes, and detecting a change of capacity between the electrodes, the change being caused by the second electrode vibrating upon receipt of elastic waves. The external stress applying unit changes the external stress applied to the second electrode. The driving/detecting unit adjusts frequency characteristics by changing a parameter defining the frequency domain used in a transmitting/receiving operation, corresponding to the change of the external stress. |
US09238249B2 |
Ultrasound transmitter
A circuit for driving ultrasound transducers uses a sample-and-hold circuit to sample multiple sample periods of a transducer driving waveform, and uses the samples to modify drive parameters. Use of multiple sample periods enables independent measurement and adjustment of different portions of the transducer driving waveform to ensure mirror symmetry. |
US09238248B2 |
Painting aid for a vehicle door handle
Painting aid 1 for a door handle 2 of a vehicle, having a door handle 2 with a door handle body 3 to be arranged outside of a vehicle door, wherein the door handle body 3 has a support projection 4 for pivotally supporting the door handle body 3 on the vehicle door and an actuating projection 5 for actuating a door lock, and having a cap 6a or 6b to be arranged next to the door handle body 3 on the vehicle door at a fixed position. The painting aid 1 has a cover section 7 enclosing the actuating projection 5 in order to prevent paint from being applied on the actuating projection 5. The painting aid 1 also has a retaining section 8 arranged next to the cover section 7 for retaining the cap 6a or 6b. |
US09238247B1 |
Paint roller assembly
A paint roller assembly facilitates the process of cleaning excess paint from a paint roller cover. The assembly includes a handle having a first end and a second end. A roller frame is coupled to and extends from the first end of the handle. A cage is coupled to a distal end of the roller frame with respect to the handle. The cage is cylindrical and configured for receiving a paint roller cover thereon such that the paint roller cover extends around the cage. The cage extends transversely relative to the handle. A blade is coupled to and extends from the roller frame. The blade has a first surface and a second surface each being planar. The blade is configured for removing paint from the paint roller cover when the paint roller cover is removed from the cage and rubbed against the blade. |
US09238246B2 |
Illuminated handle assembly
An illuminated handle assembly for attaching to a paint roller includes a top handle that is removably coupled to the paint roller. A primary handle is coupled to the top handle so the primary handle is coupled to the paint roller. A plurality of light emitters is each coupled to the primary handle. The plurality of light emitters directs a beam of light toward the paint roller. Each of the plurality of light emitters is operationally independent from one another. An actuator is coupled to the primary handle. The primary actuator is operationally coupled to each of the plurality of light emitters. The actuator selectively actuates the plurality of light emitters. |
US09238239B2 |
Atomizing sterilization of a plurality of cleaning agents
A method for multi-agent fogging. The method includes pressurizing a first agent to a first range of pressure. The method also includes pressurizing a second agent to a second range of pressure. The method also includes pressurizing a gas to a gas range of pressure. The method also includes atomizing at least one of the first and second agents at a nozzle to mix with the pressurized gas. The method also includes applying the atomized mixture to fog a space. |
US09238235B2 |
Cyclone such as for use in a surface cleaning apparatus
A cyclone comprises a cyclone chamber having a first end having a first end wall, a second end having a second end wall, a sidewall, an air inlet at the first end, an air outlet and a first central insert member extending away from a center of the second end wall into the cyclone chamber wherein the first central insert member comprises a central member wall extending away from the second end wall and the central member wall and the second end wall meet at a first juncture that extends at an angle to both the central member wall and the second end wall. |
US09238230B2 |
Vane electrostatic precipitator
The embodiments described herein improve on the present electrostatic precipitator method of using parallel plates to collect particulates by using multiple parallel vanes set at operating parameters described below. By using vanes, the main entrained air is subdivided and directed to flow between vanes that induce resistance to flow allowing charged particles to collect on the vanes. The width of the vane is designed to be wide enough so the air flow rate at the ends of the vanes is less than 1 ft/s, allowing particles discharged from the plates to fall by gravity and in the direction of very low air flow, resulting in extremely low re-entrainment and efficient particle collection. Using vanes also allows for higher operating air velocities resulting in a smaller equipment foot print. |
US09238228B2 |
Cone crusher and processing plant for mineral material
A cone crusher having a frame, an outer blade adapted to be locked to the frame, an inner blade eccentrically and vertically movable relative to the outer blade, and the inner blade and the outer blade define there between a crushing chamber, a main shaft which is stationary relative to the frame, an eccentric bearing-mounted on the main shaft, a support cone on which the inner blade is arranged, and an adjustment shaft by means of which the support cone is vertically movable from below. A hollow space is arranged inside the main shaft, the adjustment shaft is arranged to the hollow space, a load cylinder is arranged to a lower end of the main shaft which load cylinder comprises an adjustment piston acting to a lower end of the adjustment shaft, a pressure medium supply is arranged to a pressure volume under the adjustment piston for moving vertically the adjustment shaft, and a lubricant supply is arranged above the adjustment piston for directing lubricant via the hollow space to targets to be lubricated. The main shaft is fixed stationary to the frame such that the lower end of the main shaft extends outside the frame under the frame and that the lubricant supply is arranged from outside to the outside extending part of the main shaft and through the main shaft to the hollow space. |
US09238227B2 |
Pipette tip handling devices and methods
Discussed herein are methods and devices for storing, handling, loading or dispensing of pipette tips. Some embodiments allow repetitive loading of an array of multiple pipette tips that are stored in a nested configuration. |
US09238226B2 |
Combo-tip rack
The invention relates to a three-part rack for holding re-usable pipette tips. The rack comprises an upper, a lower and an insert rack. The rack is optimized for holding first and second types of pipette tips, and comprises contamination protection. |
US09238224B2 |
Microchip
A flow path groove is formed in the surface of at least one of two resin substrates; the two resin substrates are joined with the surface in which the flow path groove is formed facing inward; a through-hole having a substantially round cross section is formed in either one of the two resin substrates such that the through-hole connects with the flow path groove from the surface opposite the surface where the two resin substrates join; protruding parts, which protrude in the direction of thickness of the resin substrates and are disposed enclosing the through-hole, are formed in the surface on the opposite side; a space, which has a substantially round cross-sectional shape concentric with the through-hole and has depth in the same direction as the direction of thickness of the resin substrates, is formed in the joined surfaces when the protruding parts are projected from the direction substantially perpendicular to the joined surfaces; and the correlation of fc>fa is satisfied when the edges on the base end side of the through-hole are projected onto the joined surfaces from a substantially perpendicular direction, where the diameter on the base end side of the through-hole is fa and the diameter on the end edge side of the space touching the joined surfaces is fc. |
US09238223B2 |
Microfluidic cartridge
The technology described herein generally relates to microfluidic cartridges configured to amplify and detect polynucleotides extracted from multiple biological samples in parallel. The technology includes a microfluidic substrate, comprising: a plurality of sample lanes, wherein each of the plurality of sample lanes comprises a microfluidic network having, in fluid communication with one another: an inlet; a first valve and a second valve; a first channel leading from the inlet, via the first valve, to a reaction chamber; and a second channel leading from the reaction chamber, via the second valve, to a vent. |
US09238220B2 |
Method for forming titanium oxide film on surface of molded product composed of cyclic olefin resin
A method for forming a titanium oxide film that can be formed on a surface of a base material without a heating step. In Step 0, a surface of a molded product (base material) composed of a cyclic olefin-based resin is irradiated with ultraviolet light in an air atmosphere. In Step 1, the base material is immersed in a mixed liquid of an aqueous solution of titanium chloride and a nitrite ion-containing aqueous solution. A titanium oxide film grows by repeating oxidation of a titanium ion. In Step 2, the base material is pulled out from the mixed liquid, and then washed to stop the reaction. The film thickness can be controlled by controlling this immersion time. In Step 3, the base material after washing is dried at room temperature. |
US09238219B2 |
Zeolite, manufacturing method of the same, and catalytic cracking batalyst of paraffin
Provided is a beta-type zeolite which has a high catalytic activity and is not easily deactivated. The beta-type zeolite of the invention has a substantially octahedral shape, has a Si/Al ratio of 5 or more, and is a proton-type zeolite. The Si/Al ratio is preferably 40 or more. This beta-type zeolite is preferably obtained by transforming a raw material beta-type zeolite synthesized without using a structure directing agent into an ammonium-type zeolite through ion exchange, then, exposing the beta-type zeolite to water vapor, and subjecting the exposed beta-type zeolite to an acid treatment. |
US09238214B2 |
Process and apparatus for converting greenhouse gases into synthetic fuels
Embodiments of the present invention are directed to apparatus and methods for converting carbon dioxide and/or methane into higher alkanes and hydrogen gas in a single reaction chamber using a catalyst and microwave radiation. |
US09238206B2 |
Control of emulsions, including multiple emulsions
The present invention generally relates to emulsions, and more particularly, to double and other multiple emulsions. Certain aspects of the present invention are generally directed to the creation of double emulsions and other multiple emulsions at a common junction of microfluidic channels. In some cases, the microfluidic channels at the common junction may have substantially the same hydrophobicity. In one set of embodiments, a device may include a common junction of six or more channels, where a first fluid flows through one channel, a second fluid flows through two channels, and a third or carrying fluid flows through two more channels, such that a double emulsion of a first droplet of the first fluid, contained in a second droplet of the second fluid, contained by the carrying fluid, flows away from the common junction through a sixth channel. |
US09238205B2 |
Mixer and exhaust system
A static mixer for the through-mixing of a flow in a line conducting the flow, more preferably of an exhaust system of a combustion engine with several guide vanes. To create adequate through-mixing at low flow velocity and a through-flow resistance that is not too high at high flow velocity, the guide vanes are produced of a shape memory alloy wherein below a predetermined limit temperature the guide vanes have at least one low-temperature shape and above the limit temperature the guide vanes have at least one high-temperature shape, which differs from the low-temperature shape through a reduced through-flow resistance of the mixer. |
US09238204B2 |
Gas separation composite membrane and gas separating module, gas separation apparatus and gas separation method using the same
A gas separation composite membrane, containing a gas-permeable supporting layer and a gas separating layer containing a crosslinked polyimide resin over the gas-permeable supporting layer, in which the crosslinked polyimide resin has structure in which a polyimide compound is crosslinked through a specific crosslinking chain, the specific crosslinking chain has at least one kind of linking group selected from the group consisting of —NRaC(═O)—, —NRbC(═O)O—, —CH2OCH2—, —CH2SCH2—, —OC(═O)O—, —C(═O)O−N+(Rc)3—, —SO3−N+(Rd)3— and —PO3−N+(Re)3—, and Ra, Rb, Rc, Rd and Re each independently represent a hydrogen atom or a substituent. |
US09238200B2 |
Exhaust purification system of internal combustion engine
A method for purifying exhaust gas of an internal combustion engine including flowing an exhaust gas containing NOx and a concentration of hydrocarbons in an exhaust gas passage that contains an exhaust purification catalyst, wherein the concentration of hydrocarbons is vibrated within a predetermined range of amplitude and period, and a least a portion of the hydrocarbons are reformed by the exhaust purification catalyst; reacting the NOx contained in the exhaust gas and the reformed hydrocarbons to produce a reducing intermediate; and chemically reducing, wherein at the time of engine operation, a demanded produced amount of the reducing intermediate required for chemically reducing the NOx is calculated, and the amplitude and vibration period of the concentration of hydrocarbons flowing into the exhaust purification catalyst are controlled so that an amount of the reducing intermediate produced becomes the demanded produced amount. |
US09238196B2 |
Device and method for eliminating NOx and N2O
Disclosed herein is a device and method for lowering the content of NOX and N2O in gases. The device comprises a container having therein two reaction steps connected in series. The first step removes NOX (DeNOX stage) by reducing NOX with a nitrogen-containing reducing agent. Downstream thereof, the second step removes N2O by catalytic decomposition of N2O to N2 and O2 (DeN2O stage). Each step comprises one or more catalyst beds through which flows gas to be purified. The catalyst bed of the DeNOX stage containing zeolites doped with transition metals, including lanthanides. The at least one catalyst bed of the DeN2O-stage contains one or more catalytically active compounds of elements selected from groups 5 to 11 of the Periodic Table, but not iron-doped zeolites. A device for introducing a nitrogen-containing reducing agent into the stream of the NOX and N2O-containing gas is further disposed upstream of the DeNOX stage. |
US09238193B2 |
Separations with ionic liquid solvents
Disclosed are systems and methods which provide a process stream comprising a gaseous component, capture the gaseous component from the process stream by an ionic liquid solvent of a separator, and recover a captured gaseous component from the ionic liquid solvent in a regenerator. A second gaseous component from the process stream may be captured by the ionic liquid solvent of the separator, and the second gaseous component may be recovered from the ionic liquid solvent in the regenerator. Alternatively, the second gaseous component from the process stream may be uncaptured by the ionic liquid solvent, and the uncaptured second gaseous component may be recovered from a membrane unit. |
US09238191B2 |
CO2 recovery system and CO2 recovery method
A CO2 recovery system includes an absorber 2 and a regenerator 3. The absorber 2 includes a CO2 absorbing section 21 and at least one water-washing section 22. The CO2 absorbing section 21 allows flue gas 101 to come into contact with a basic amine compound absorbent 103 so that the basic amine compound absorbent 103 absorbs CO2 in the flue gas 101. The at least one water-washing section 22 allows the decarbonated flue gas 101A in which the amount of CO2 has been reduced in the CO2 absorbing section 21 to come into contact with wash water 104A and 104B to reduce the amounts of the basic amine compounds entrained in the decarbonated flue gas 101A. The regenerator 3 releases the CO2 from the basic amine compound absorbent 103 containing CO2 absorbed therein. |
US09238190B2 |
Plugged honeycomb structure
A plugged honeycomb structure includes a honeycomb structure section having porous partition walls, a plurality of cells including the cells having different open areas; inflow side plugged portions arranged in inflow side end portions of the predetermined cells; and outflow side plugged portions arranged in outflow side end portions of the remaining cells. Outflow cells which are the cells provided with the inflow side plugged portions and inflow cells which are the cells provided with the outflow side plugged portions are alternately formed, and in a central portion, the open area of each of the inflow cells is larger than the open area of each of the outflow cells. A difference in open area between the outflow cell and the inflow cell in an outer peripheral portion is smaller than a difference in open area between the outflow cell and the inflow cell in the central portion. |
US09238189B2 |
Air cleaner arrangements with internal and external support for cartridge; components; and, methods
An air cleaner assembly and components therefor are provided. Features are described providing for a cantilevered support of a filter cartridge contained therein, and also, in some examples anti-rotational support. Also, a supported housing seal is shown. A filter cartridge arrangement is described and shown. Methods of assembly and use are also described. |
US09238187B2 |
Filter device
A filter device includes a main body portion having a cylinder shape, and the main body portion is inserted along a center axis of the pipe. One end portion of the main body portion structuring a filter device is blocked. At least one portion of a flange portion is provided between both end portions of the cylinder, and the flange portion divides a space inside the pipe in a liquid-tight state by elastically deforming and by being attached firmly to an inner surface of the pipe. A first passing portion of the liquid is provided in a cylinder side portion between the one end portion of the cylinder and the flange portion, and a second passing portion of the liquid is provided on a side close to the other end portion of the cylinder than the flange portion. |
US09238186B2 |
Contaminated water treatment system, method and apparatus
In one aspect the invention provides a fluid treatment apparatus for treating contaminated fluid. The apparatus comprises a container having base member and a peripheral containment wall and defining a total interior volume. The apparatus further comprises at least one container inlet to receive said contaminated fluid, at least one container outlet to discharge water separated from said contaminated fluid, a separation region suitable to receive said contaminated fluid, to allow separation of said contaminated fluids into less dense contaminants, water and denser contaminants, and to store said denser contaminants as a sediment layer on the base member. The apparatus further comprises a water collection region suitable to receive water from the separation region and direct said water to said at least one container outlet, and an oil collection region, suitable to receive less dense contaminants from the separation region. |
US09238181B2 |
Method and system for treatment of waste water
A method and device for reducing the volume of waste water through evaporation including a tank with a combustion pipe and burner unit, wherein water is injected into the combustion pipe, flash evaporated, and gases are projected into the tank to drive evaporative and water treatment functions. |
US09238180B2 |
Modular construction panel
A modular construction panel is provided. The modular construction panel has a panel having a plurality of fasteners disposed within or thereon, each fastener permitting adjoining to a like construction panel for creating a structure. The panels are provided in shapes optimizing modularity when mated to other panels. |
US09238175B2 |
Natural movement in a virtual environment
Some aspects discussed herein may provide for a dynamic and real-time analysis of a virtual environment around a player as the player traverses the virtual environment. The analysis may determine candidate hooks (interaction points) for player movement in the virtual environment, and a best hook may be selected for performing a movement action. The movement action may be selected based on the selected hook, providing fluid and natural movement through the virtual environment. The candidate hooks may be determined based on a plurality of three dimensional ray traces originating from points along a left side and a right side of the player and at a range of heights. Collision points from the ray traces may be analyzed to determine whether they may support movement interaction, and valid points may be used to create the candidate hooks. |
US09238171B2 |
System and method for toy adoption and marketing
Provided are a method and computer system that provide a virtual world. A server of the computer system includes a storage subsystem that stores two or more items of different personalized information about multiple different users, including different user identifications and passwords associated with the user identifications respectively representing the users. The server computer system is programmed to accept login credentials including a user identification and password and validate the login credentials. The server computer system is also programmed to control formation of a first user account and storage of the first user identification and first password. The storage subsystem stores information about registration codes that have not yet been entered. Further, the server computer system is programmed to accept entry of one or more of the registration codes that have not yet been entered and, based on entry of the registration codes, to associate stored information indicative of the one registration code with the first user identification. |
US09238169B1 |
Multi-functional combinatorial game apparatus
A multi-functional combinatorial game apparatus, which includes a base provided with a protruding seat and a recess on the top thereof, and a groove is provided inside the recess. When two adjacent bases are combined together, the inserting groove on the bottom portion of the upper layer base inserts onto the protruding seat or the recess of the lower layer base, thereby enabling a tactile path to be created having undulating ups and downs. In addition, soybeans, sand, small stones, and other tactile objects can be placed inside the grooves on the bases to provide children with different tactile feelings when they are walking and treading on the path. |
US09238165B2 |
Training devices for trajectory-based sports
Methods and apparatus related to improving player performance for trajectory-based sports are described. In particular, sporting devices are described that can be utilized to improve player performance in basketball. The sporting devices can include a camera-based system configured to capture and analyze the trajectory of a shot taken by a player. The camera-based system can be configured to provide feedback that allows a player to optimize the trajectory mechanics associated with shooting a basketball. In one embodiment, the camera-based system can be used in conjunction with a training aid that is attached to a basketball rim. The training aid can be configured to improve the trajectory mechanics of individuals utilizing the modified basketball rim to practice their shooting. |
US09238162B2 |
Golf club with adjustable weight assembly
The invention generally relates to golf clubs with adjustable mass properties. In certain aspects, the invention provides methods and mechanisms for adjusting a club head center of gravity and/or moment of inertia by way of an adjustable weight assembly positionable along the sole of the club head body. When in a first position, the weight assembly provides a lower center of gravity so as to increase launch angle and reduce spin rate, resulting in greater overall distance of ball flight. When in a second position, the weight assembly provides a greater mass moment of inertia, which effectively enlarges the sweet spot and produces a more forgiving club for off-center hits. |
US09238160B2 |
Method of making color golf ball and resulting color golf ball
A method and golf ball incorporating a surface penetrating color composition comprising a colorant (e.g. dyes, tints, color effects, etc.) in a portion (surface or region) of a golf ball component or coating (substrate). The substrate is formed from a homogenous composition having a color C1 which may comprise any color within the spectrum of visible light, or be clear colorless, and alternatively, may also be opaque, translucent, or clear colored, for example. An outer surface of the substrate is treated with or otherwise exposed to a surface penetrating color composition having a C2 that is different than C1 in some respect such as hue, chroma, saturation and/or opacity. The surface penetrating color composition penetrates the golf ball substrate surface to a target depth and becomes embedded within the surface, thereby forming a surface penetrating color composition-treated component or coating having a treated region and an untreated region. |
US09238157B2 |
Fitness apparatus
A fitness apparatus includes a first frame, a second frame, a nose part, a linear elastic element, and a cable. The second frame is pivotally connected to the first frame. The nose part and the second frame are coaxially pivotally connected to the first frame. The linear elastic element has a first end and a second end. The first end is connected to the first frame. The cable has a connecting end and a force-applying end. The connecting end is connected to the second end. The cable is pressed against the nose part, and the force-applying end of the cable drives the second frame. When the second frame pivotally swings against the first frame, the second frame pulls the cable and changes the length of the cable pressed against the nose part, whereby the linear elastic element may be stretched or shortened by the cable. |
US09238155B2 |
Concrete deck tie-off anchor point and system
A ceiling anchor point and anchor point system for a concrete deck. The anchor point includes a receiver box attached to the form used to construct a concrete deck that becomes embedded the concrete deck. The receiver box is a partially enclosed structure with a lower slot opening that communicates with an interior cavity. The receiver box includes flange surfaces that attached to the inside surface of a form used to construct the concrete deck. Extending transversely through the interior cavity is a rod with its opposite ends that extend laterally from the sides of the receiver box and become covered with concrete. Attached to the portion of the rod located inside the interior cavity is an elongated connector plate. The connector plate is assembled on the rod and is configured to rotate around the rod and nests entirely inside the receive box or extend downward through the slot opening. Formed on the lower end of the connector plate is a second hole that connects to a suitable snap hook or clip used by a construction worker when working near a leading edge fall hazard. |
US09238151B2 |
Dynamic/adaptive treatment planning for radiation therapy
A facility for facilitating custom radiation treatment planning is described. During a distinguished radiation treatment session for a patient, the facility collects data indicating positioning of a predefined treatment site of the patient relative to a target treatment location throughout the distinguished radiation treatment session. The facility associates the collected positioning data with data describing one or more other aspects of the distinguished radiation treatment session. The facility provides the associated data to a treatment planning facility to determine a treatment plan for future radiation treatment sessions for the patient. |
US09238150B2 |
Optical tissue interface method and apparatus for stimulating cells
In one example, a system electrically stimulates target cells of a living animal using an elongated structure, a modulation circuit and a light pathway such as provided by an optical fiber arrangement. The elongated structure is for insertion into a narrow passageway in the animal such that an end of the elongated structure is sufficiently near the target cells to deliver stimulation thereto. The modulation circuit is for modulating the target cells while the elongated structure is in the narrow passageway, where the modulation circuit is adapted to deliver viral vectors through the elongated structure for expressing light responsive proteins in the target cells. The light pathway is used for stimulating the target cells by delivering light to the light-responsive proteins in the target cells. |
US09238149B2 |
Prevention and treatment of alzheimer'S disease through electromagnetic field exposure
The invention includes a method of treating and preventing a neurological disorder, such as Alzheimer's Disease, in a subject in need thereof by positioning an electromagnetic field emitting source proximal to the subject and exposing the subject to an electromagnetic field having a predetermined frequency for a predetermined absorption period. Preferably, each individual treatment (comprising exposure to the predetermined frequency for the predetermined absorption period) is continued at a predetermined schedule (preferably daily) for a predetermined treatment period.The predetermined frequency, according to a preferred embodiment, is about 918 MHz with a specific absorption rate (SAR) of about 0.25 W/kg+/−2 dB. The predetermined absorption period of this preferred embodiment is about one hour. The treatment period is long-term, being greater than about 6 months and preferably between about 7 and 9 months. |
US09238148B2 |
Method for increasing buck regulator efficiency using charge recapturing in an implantable cardiac device
A typical power switch in a Buck Regulator requires a pre-driver to ensure rapid transition from its ON to OFF states. In this invention, the shoot through current in the pre-driver and the power switch's gate-charge in a Buck regulator is itself recaptured in the capacitor of the buck regulator. The recapturing of this otherwise wasted shoot-through current and gate charge allows for increased efficiency of the regulator. The recapture may be selectively disabled to accommodate high power operations of the system, if such are used; the recapture may in an alternative mode be always performed. As a result, reduced power consumption can be achieved. |
US09238147B2 |
Cardiac stimulator
An implantable cardiac stimulator includes a cardioversion/defibrillation unit connectable to at least one ventricular sensing electrode and one ventricular defibrillation electrode, and is designed to generate and deliver cardioversion or defibrillation shocks. A ventricular sensing unit having automatic threshold adaptation is connectable to the ventricular sensing electrode, and is designed to process the signals of the sensing electrode and detect a chamber contraction, and if a chamber contraction is detected, to output a ventricular sensing signal. The ventricular sensing unit processes the signals of the sensing electrode with at least two switchable sensing thresholds wherein after every sense, a VF detection window is started at a first lower sensing threshold; once the VF detection window has passed, a T wave blanking window is activated at an upper second sensing threshold; and once the T wave blanking window has passed, sensing at a second lower threshold is started. |
US09238146B2 |
External defibrillator
An external defibrillator includes patient electrodes (20) for obtaining the patient's electrocardiogram (ECG) and for applying a shock to the patient. A microprocessor (24) analyses the patient's ECU using a diagnostic algorithm to detect if the patient's heart is in a shockable rhythm, and shock delivery circuitry (10) is enabled when a shockable rhythm is detected by the diagnostic algorithm. The patient electrodes also allow obtaining a signal (Z) which is a measure of the patient's transthoracic impedance and the microprocessor is responsive to Z to detect conditions likely to cause the diagnostic algorithm to generate a false detection of a shockable rhythm. If such detection is made, the microprocessor prevents detection of a shockable rhythm by the diagnostic algorithm, at least for a period of time. |
US09238145B2 |
Leadless implantable device delivery apparatus
A leadless implantable device delivery apparatus that enables testing of an implantation site before permanent implantation and enables secure attachment at the site while minimizing effects of the implantation procedure. Embodiments include a delivery sheath configured to accommodate a leadless implantable device, the leadless implantable device having an anchor that includes at least one projection configured to physically attach the anchor to tissue, such as heart tissue. In addition, embodiments include an adapter that resides within the delivery sheath and is configured to impart rotational force at the distal end of the adapter that is applied to the proximal end of the adapter to rotate the anchor associated with the implantable device. |
US09238136B2 |
Capture threshold and lead condition analysis
An exemplary method includes performing a capture threshold assessment using a bipolar electrode configuration, deciding if capture occurred for a maximum energy value of the capture threshold assessment and, if capture did not occur, then performing a lead impedance test for the lead associated with the bipolar electrode configuration. Such a test may aim to detect an insulation defect and/or a conductor defect. Other exemplary methods, devices, systems, etc., are also disclosed. |
US09238131B2 |
Ocular iontophoresis device
The invention relates to a device of ocular iontophoresis for delivering active substances, comprising a reservoir having an outer wall and a hollow body at least partly delimited by the outer wall, wherein the hollow body is capable of receiving an electrical conductive medium and active substances contained in the medium and has an outlet defining a surface, so-called “application surface”, intended to received a determine part of an eyeball surface, the application surface being at least partly limited by an outer line concave towards the optical axis of the eyeball, wherein the outer wall extends from the outer line with a global outwardly with respect to the said optical axis. |
US09238125B2 |
Inflation device for balloon sinus dilation
An inflation device useful for inflating a balloon provided with a surgical instrument, such as a balloon sinus dilation instrument. The inflation device includes a syringe, a connector, and mechanical pressure indicator. The syringe includes a plunger slidably disposed within a barrel. The connector is configured to fluidly connect an outlet of the syringe with a surgical instrument balloon in establishing a closed inflation system between the syringe and an interior of the balloon. The pressure indicator is associated with the syringe and is configured to transition from a non-alert state to an alert state when a pressure of the inflation system has reached a predetermined level. In some embodiments, the inflation device is characterized by the absence of a pressure gauge. |
US09238123B2 |
Antimicrobial dressing providing percutaneous device securement and cover
The present invention is related to a polymeric vehicle for delivery of bioactive agents, and preferably, for the delivery of one or more bioactive agents. The invention is also directed to a percutaneous device securing and drug delivery device comprising, as a component thereof, a material which delivers antimicrobial and/or other wound-healing factors at the site of the insertion of the catheter into the body. The device, when applied as described herein, provides complete anti-microbial coverage around the entry point of a percutaneous device and, preferably for a length greater than the diameter of the device. The present invention is also directed to methods for using such devices in combination with percutaneous devices primarily to reduce site infections. |
US09238120B2 |
Methods and apparatus for intravenous tubing
The present invention provides, among other things, a tubing apparatus that allows for better organization of tubes within a system by permanently coupling medical tubes. Generally, this invention comprises a primary tube and a secondary tube, wherein the secondary tube is permanently coupled to the primary tube at least partially along the secondary tube's length. The primary tube comprises at least one coupling port to which one end of the secondary tube fluidly couples. |
US09238110B2 |
Medicated module having a collapsible feature
A system and method for priming a medicated module during attachment of the medicated module to a drug delivery device. The drug delivery device has a drug reservoir holding a first medicament. The medicated module includes an upper retention feature and a lower retention feature, wherein the upper retention feature is axially moveable relative to the lower retention feature. The medicated module also includes an engagement needle and an output needle, wherein the output needle is in fluid communication with the engagement needle. The module also includes a collapsible feature holding a second medicament, wherein the collapsible feature is operably connected to the upper retention feature. During attachment to the drug delivery device, (i) the upper retention feature moves axially relative to the lower retention feature, (ii) the collapsible feature collapses, and (iii) the engagement needle and the output needle are primed with the second medicament. |
US09238106B2 |
Dose setting mechanism for priming a drug delivery device
A method and system for priming a drug delivery device. The drug delivery device includes a forced priming feature that requires the user to move the dose dial sleeve axially to cause the spindle to pre-load a cartridge bung before a first dose can be dialed. |
US09238102B2 |
Low profile actuator and improved method of caregiver controlled administration of therapeutics
A polymer actuator, power supply and method of using the activation are described. |
US09238097B2 |
Method for collecting a desired blood component and performing a photopheresis treatment
An improved method for separating whole blood into components and collecting a desired blood component. The method allows a desired blood component to be subjected to centrifugal forces within a separator for prolonged periods of time, yielding a cleaner cut and higher yield of the desired blood component. Whole blood is drawn from a source and pumped into a separator, the undesired blood components are removed from the separator at rates so as to build up the desired blood component in the separator. The desired blood component is only removed after a predetermined amount of the desired blood component has built up in the separator. It is preferred that the desired blood component be buffy coat and that the method be used to perform photopheresis treatments. In another aspect, the invention is a method of performing a full photopheresis treatment to treat diseases in a reduced time, preferably less than about 70 minutes, and more preferably less than about 45 minutes. |
US09238092B2 |
Method of three-dimensionally culturing chondrocytes
It is intended to provide a method of three-dimensionally culturing normal joint chondrocytes; the production and supply of chondrocytes; and a transplantation material to be used in an injured site in a joint tissue. |
US09238091B2 |
Methods of manufacturing bioactive gels from extracellular matrix material
The present invention is directed to methods of manufacturing bioactive gels from ECM material, i.e., gels which retain bioactivity, and can serve as scaffolds for preclinical and clinical tissue engineering and regenerative medicine approaches to tissue reconstruction. The manufacturing methods take advantage of a new recognition that bioactive gels from ECM material can be created by digesting particularized ECM material in an alkaline environment and neutralizing to provide bioactive gels. |
US09238087B2 |
Absorber and absorbent article
An absorber containing non-wood pulp with the settling velocity in water between 2 and 5 seconds, the mean fiber size of 8 to 25 μm, the apparent bulk density of 0.04 to 0.07 g/cm3, and the absorption for 0.9% physiological saline of at least 20-fold with respect to the pulp mass. The absorber has a thickness change of at least 600%, as the thickness after having absorbed 0.9% physiological saline with respect to the thickness before absorbing 0.9% physiological saline. When addition of 80 mL of 0.9% physiological saline to the absorbent article over a period of 10 seconds is performed three times every 10 minutes and the absorption rate of the absorbent article for each of the three times is evaluated as the time from addition of the 0.9% physiological saline until complete absorption, the absorption rate for each of the three times is not greater than 20 seconds. |
US09238083B2 |
Molecular probe for imaging of pancreatic islets and use of the same
A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ ID NO. 1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2 (1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms. |
US09238082B2 |
Method of bonding gold nanoparticles with diethylenetriamine pentaacetic acid
A bonding method is provided for gold nanoparticles (GNPs). GNPs are bonded with diethylenetriamine pentaacetic acid (DTPA). GNPs have high bio-compatibility and high surface area. Hence, the present invention uses GNPs as carriers for diagnosing and treating cancer. |
US09238079B2 |
Pegylated interleukin-10
Interleukin-10 (IL-10) conjugated via a linker to one or more polyethylene glycol (PEG) molecules at a single amino acid residue of the IL-10, and a method for preparing the same, are provided. The method produces a stable mono-pegylated IL-10, which retains IL-10 activity, where pegylation is selective for the N-terminus on one subunit of IL-10 with little or no formation of monomeric IL-10. The method also provides a substantially homogenous population of mono-PEG-IL-10. |
US09238078B2 |
Modified-release pharmaceutical drug composition
The present invention provides compositions and methods for a modified-release pharmaceutical drug composition having a first charged active agent and a second charged active agent at least partially surrounded by a rate controlling membrane. The first charged active agent and the second charged active agent interact to form a modified release pharmaceutical complex within the rate controlling membrane and the modified release pharmaceutical complex has a release characteristic different from the release characteristic of the first active agent or the second active agent alone. |
US09238075B2 |
Method for bowel preparation
The present invention provides methods for facilitating cleansing of the gastrointestinal tract of a patient prior to a diagnostic, surgical or therapeutic procedure. The methods can improve patient compliance, and thus, efficacy of the preparation. Specifically, the present methods make the gastrointestinal tract preparation composition palatable for the patient to consume. For example, for a patient preparing to undergo colonoscopy, the present methods make the bowel preparation solution taste significantly less salty. |
US09238071B2 |
Hyaluronic acid stabilizer
An embodiment of the present disclosure provides a composition that comprises hyaluronic acid, or its salt or derivative thereof, and an antimicrobial agent, such as zinc citrate, that does not degrade the hyaluronic acid molecule. |
US09238068B2 |
Methods and compositions for wound treatment
The present disclosure relates to methods for identifying proteins or peptide motifs of intracellular, extracellular, or extracellular matrix proteins specifically exposed in wound sites, as well as compositions for treating wounds, and methods for their use. |
US09238054B2 |
Treatment of kidney fibrosis with VIP fragments
The invention relates to compositions comprising vasoactive intestinal peptide (VIP) or fragments thereof, and the use of such compositions in the treatment of kidney disease, in particular kidney fibrosis, and other associated conditions. |
US09238047B1 |
Fluorapatite nano-crystalline coated non-ceramic hydrophilic hydroxylapatite bone grafting compositions and methods for promoting bone regeneration
Bone graft compositions and methods are provided for promoting cellular recruitment bone regeneration. The novel bone graft includes at least one of: fluorapatite nano-crystalline coated non-ceramic hydrophilic hydroxylapatite crystals; and a combination of fluorapatite nano-crystalline coated non-ceramic hydrophilic hydroxylapatite crystals and fluorapatite nano-crystalline coated hydroxylapatite crystal clusters. Methods include treating cells at a bone defect site with the novel bone graft, wherein fluorapatite crystallites from the fluorapatite nano-crystalline coating immediately and continuously release fluorapatite to the cellular environment over the course of treating the cells. The compositions and methods promote cell differentiation, migration, and proliferation. Through the use of compositions and methods provided herein, inhibition of the migration of connective tissue and epithelial cells to bone defect sites is realized for better bone restoration by osteoblast cells. Moreover, inhibition of inflammatory cells and bacteria at the surgical site are realized, further enhancing bone restoration. |
US09238044B2 |
Alkali-free bioactive glass composition
The present invention relates to development of bioactive glass/glass-ceramic composition that are able to promote a fast deposition layer of carbonated hydroxyapatite upon immersion in simulated body fluid (SBF) for time periods as short as one hour. Such composition might include fluorides, and a variety of oxides (or their precursor compounds), such as Na2O—Ag2O—SrO—CaO—MgO—ZnO—P2O5—SiO2—Bi2O3—B2O3—CaF2, be prepared by the melt route or by the sol-gel process, with the specific composition and the preparation route selected according to the intended functionalities, which can present controlled biodegradation rate and bactericidal activity. The powders derived from glass melts purred in cold water (frits) may completely densify by sintering at temperatures up to 800° C. without devitrification, resulting in bioglass compacts with high flexural strength (˜85 MPa). The bioactive glass powders prepared by sol-gel densify at lower temperatures due to their higher specific surface area and reactivity. |
US09238043B2 |
Composition and method to alleviate joint pain using algae based oils
A dietary supplement composition is formulated in a therapeutic amount to treat and alleviate symptoms of joint pain in a patient. The composition includes an algae based oil having glycolipids and phospholipids and Eicosapentaenoic (EPA) fatty acids in combination with astaxanthin and low molecular weight hyaluronic acid or sodium hyaluronate (hyaluronan) and a molecular weight less than 300 kilodaltons (kDa) in an oral dosage form. |
US09238040B2 |
Chemoprevention of colorectal cancer by mesalamine/sulfasalazine
A method for preventing colorectal cancer in a patient possessing human tropomyocin isoform TC22 is disclosed. The method comprises: (a) detecting a serum protein concentration of TC22 in a patient and (b) administering to said patient prior to detecting colorectal cancer in said patient a therapeutically effective amount of a chemotherapeutic composition comprising a chemotherapeutic compound that reduces the level of TC22, wherein the chemotherapeutic compound is selected from the group consisting of sulfasalazine, 5-amino-2-hydroxybenzoic acid, osalazine, and balsalazide. |
US09238039B2 |
Pyrazolo[1,5-A]pyrimidines for antiviral treatment
The invention provides compounds of Formula I or Formula II: or a pharmaceutically acceptable salt or ester, thereof, as described herein. The compounds and compositions thereof are useful for treating Pneumovirinae virus infections. The compounds, compositions, and methods provided are particularly useful for the treatment of Human respiratory syncytial virus infections. |
US09238034B2 |
FN14 antagonists and therapeutic uses thereof
The present disclosure is directed to methods of using fibroblast growth factor-inducible 14 (Fn14) antagonists to modulate activity at a TNF-like weak inducer of apoptosis (TWEAK) binding site on a cysteine-rich domain (CRD) of Fn14. The present disclosure also provides pharmaceutical compositions comprising synergistic combinations Fn14 antagonists and chemotherapeutic agents. |
US09238030B2 |
Methods for treatment of diseases and disorders related to transducin β-like protein 1 (TBL1) activity, including myeloproliferative neoplasia and chronic myeloid leukemia
Methods for treatment of diseases and disorders related to transducin β-like protein 1 (TBL1) activity, including myeloproliferative neoplasia, chronic myeloid leukemia, and acute myeloid leukemia. |
US09238014B2 |
Pharmaceutical composition for treating alcohol dependency
Pharmaceutical composition for treating alcohol dependence in humans comprising two active ingredients: a compound having an antagonistic action on the 5-HT2 serotoninergic receptors selected as being cyproheptadine; and a compound having an antagonistic action on the alpha1-noradrenergic receptors selected from prazosin, alfuzosin, terazosin and tamsulosin. |
US09238012B2 |
Transdermal patch
A transdermal patch for the treatment of Alzheimer's disease includes: a backing, a rivastigmine-containing layer, a pressure-sensitive adhesive layer, and a release liner. In the transdermal patch, the rivastigmine-containing layer contains rivastigmine and an alkyl(meth)acrylate resin, the pressure-sensitive adhesive layer is composed of an acrylic pressure-sensitive adhesive containing a (meth)acrylic acid ester having a hydroxyl group, and neither the rivastigmine-containing layer nor the pressure-sensitive adhesive layer contains an anti-oxidizing agent. |
US09238011B2 |
Compositions, methods and kits for therapeutic treatment with wet spun microstructures
Methods, compositions, systems, devices and kits are provided for preparing and using a multi-layer polymeric microstructure composition for delivering a therapeutic agent to a subject. In various embodiments, the therapeutic agent includes at least one selected from the group of: a drug, a protein, a sugar, a carbohydrate, and a nucleotide sequence. In related embodiments, the composition is a fiber, a suture, a sphere, an implant, or a scaffold. |
US09238010B2 |
Vesicles and nanostructures from recombinant proteins
The present invention includes a composition comprising at least one oleosin-like protein. The present invention also includes a composition comprising a vesicle comprising at least one oleosin-like protein. |
US09238009B2 |
Stable fat-soluble active principle particles
A method for preparing fat-soluble active ingredients, including the steps of preparing an oil-in-water emulsion including 8 to 20% of at least one protein, 5 to 15% of at least one sugar, 0.5 to 3% of at least one inorganic salt, 10 to 22% of at least one fat-soluble active ingredient in an oily form and/or dissolved in an edible oil, and qsp % of water, shaping of particles in a substantially spherical shape by the dispersing the oil-in-water emulsion obtained at the end of step a) in a fluid, adding at least one agent for cross-linking of the at least one protein to the dispersion obtained at the end of step b), and the active ingredients are recovered with the substantially spherical shape. |
US09238008B2 |
Particles containing a growth factor, and uses thereof
The present invention concerns particles containing at least one covalently cross-linked polysaccharide and at least one growth factor, a method of preparation, and uses thereof. |
US09238007B2 |
Method for the production of a medicament containing tadalafil
The invention relates to a method for producing a medicament containing tadalafil. In said method, tadalafil is mixed with suitable adjuvants and is heated to a temperature of about 100° C. to about 200° C., preferably about 150° C. to about 200° C., especially about 200° C. |
US09238006B2 |
Composition containing inorganic nanoparticles as an active ingredient for preventing or treating of angiogenesis-related diseases
Provided is a pharmaceutical composition containing inorganic nanoparticles selected from titanium oxide nanoparticles or silica nanoparticles as an active ingredient for preventing or treating angiogenesis-related diseases. The pharmaceutical composition for preventing or treating angiogenesis-related diseases according to the present invention may be used as a therapeutic agent for various diseases based on angiogenesis such as age-related macular degeneration, tumors, and diabetes-related complications. |
US09238004B2 |
Oral film-form base and oral film-form preparation
The present invention provides a film-form base having one or more sugars or sugar alcohols dispersed as fine particles therein, and also provides a film-form preparation containing the base and a drug. The base is produced by dispersing, in an organic solvent having a solubility parameter of 9.7 or higher, an edible polymer soluble in water and the organic solvent, and particles of one or two or more compounds selected from the group consisting of mono- to hexasaccharide sugars and sugar alcohols thereof which have an average particle size of 0.1 μm to 60 μm and are insoluble in an organic solvent. The present invention can therefore provide oral film-form base and preparation which have a rapid dissolution profile in the mouth and sufficient film strength, and provide a reduced sticky sensation attributed to the water-soluble polymer in the mouth and an improved feel when handled with the fingers. |
US09238003B2 |
Extended or continuous wear silicone hydrogel contact lenses for the extended release of comfort molecules
A drug delivery system is disclosed. The drug delivery system includes a recognitive polymeric hydrogel through which a drug is delivered by contacting biological tissue. The recognitive polymeric hydrogel is formed by using a bio-template, which is a drug or is structurally similar to the drug, functionalized monomers, preferably having complexing sites, and cross-linking monomers, which are copolymerized using a suitable initiator. The complexing sites of the recognitive polymeric hydrogel that is formed preferably mimics receptor sites of a target biological tissue, biological recognition, or biological mechanism of action. The system in accordance with an embodiment of the invention is a contact lens for delivering a drug through contact with an eye. |
US09238002B2 |
Suspensions of cyclosporin A form 2
Disclosed herein are methods of formulating cyclosporin A Form 2. |
US09238001B2 |
Delivery system for remote treatment of an animal
A remote treatment delivery system for an animal including a dosage projectile adapted to deliver a biologically active agent to an animal substantially without piercing the skin of the animal and containing a biologically active agent and a carrier in liquid or gel form, the carrier allows adhesion of the biologically active agent to skin, coat or fur of the animal; wherein the agent and the carrier are encapsulated in one or more encapsulating agents; and wherein the encapsulating agents forms a frangible shell. |
US09237994B2 |
Glass flake and coated glass flake
A glass flake (10) having improved heat resistance and chemical resistance is formed from a glass base material satisfying, in mass %, 60≦SiO2≦75, 5 |
US09237990B2 |
Polymerizable isocyanurate monomers and dental compositions
Polymerizable isocyanurate monomers and dental compositions are described. A hardenable dental composition is described comprising at least one isocyanurate monomer that is a stable liquid at about 25° C. The isocyanurate monomer comprises at least one divalent linking group bonded to a nitrogen atom of a trivalent isocyanuric acid ring, wherein the divalent linking group comprises a moiety selected from ester, thioester, ether, or thioether, and combinations of such moieties and a terminal ethylenically unsaturated polymerizable group. |
US09237989B2 |
Coating method
A method of coating an article includes the steps of providing a powder comprising coated particles; and spray coating the powder onto a surface of the article to form a composite coating. The spray coating may be carried out by combustion spraying, gas plasma spraying, including vacuum plasma spraying (VPS), and cold spraying. The article may be an implant for surgical or dental use. The powder may include particles of metal coated calcium phosphates, especially metal coated hydroxyapatite. The particles may include bioactive agents. |
US09237987B2 |
Metering device
A metering device is used for the metered administration of a flowable preparation together with a flowable carrier medium. A storage container for the preparation has at least one access opening. A metering plunger body can be moved in a sealed manner in the storage container between a starting position and at least one metering position. The metering plunger body is hollow. A metering sleeve has on a bottom side an eccentric metering sleeve opening. An inner plunger body has on the bottom side an eccentrically arranged plunger body opening. In a through relative rotation position of the metering sleeve relative to the inner plunger body a passage is provided between the inside of the storage container and the inside of the inner plunger body. In a closed relative rotational position this passage is closed. This results in a user-friendly and compact metering device. |
US09237978B2 |
Support for relief of pressure ulcers
A support for use with a pillow on a mattress and a method for use thereof are disclosed. The support includes a sham extending longitudinally along an axis. The sham has a pocket having three substantially closed sides and one substantially open side. The sham has extensions extending longitudinally from the pocket. The extensions are constructed to extend around sides and at least a portion of the bottom of a mattress. The pocket is constructed to receive a pillow therein. The method includes providing such a sham and extending the extensions around the sides and under a portion of the mattress. |
US09237970B2 |
Manufacturing method and apparatus for composite body of continuous sheet associated with absorbent article and manufacturing method for absorbent article
There is provided a manufacturing method for a composite body of a continuous sheet associated with an absorbent article, the composite body being manufactured by attaching a single-cut sheet to the continuous sheet at a predetermined attachment pitch. The method includes: holding the single-cut sheet by a holding section in surface-to-surface contact, the holding section moving along a path; weakening a holding force by which the single-cut sheet is held; exerting a suction force on the single-cut sheet through the continuous sheet, the suction force causing the single-cut sheet to be sucked toward the continuous sheet; and when the holding section passes a delivery position set on the path, separating the single-cut sheet from the holding section, and delivering the single-cut sheet to the continuous sheet by attaching the single-cut sheet to the continuous sheet without pinching the single-cut sheet between the holding section and the continuous sheet due to the weakening and the exerting, the continuous sheet being running through a neighboring position near the delivery position. |
US09237964B2 |
Multiple lumen heat exchange catheters
Catheter devices and methods for intravascular heating and/or cooling of human or veterinary patients. The catheter devices generally comprise catheters having inflow and outflow lumens and at least one curvilinear balloon connected to the inflow and outflow lumens such that heat exchange fluid may be circulated through the balloon(s). The catheter is inserted into the vasculature and heated or cooled fluid is circulated through the balloon(s) to heat or cool blood flowing in heat-exchange proximity to the balloon(s), thereby effecting heating or cooling of all or a portion of the patient's body. |
US09237963B2 |
Rapid extrication device
A light-weight rigid extrication board having an elongated central section and in-turned sidewalls including one or more planar sections, extending from both sides of the central section, having a plurality of openings formed along the length of both sidewalls, that include an upper opening at the top end of the board, a bottom opening at the bottom end of the board, and an intermediate opening. Straps are secured to each of the openings in the sidewalls, each strap having a fastening buckle at the end of the strap for temporary fastening to one of the other straps. A hoop-shaped halo extends from a top end of the board. The extrication board is slipped behind the driver and the straps secure the extrication board to the back of the driver while seated. Tape can be used to temporarily secure the driver's helmet to the halo during extrication and transport. |
US09237961B2 |
Stent delivery system for detecting wall apposition of the stent during deployment
A stent delivery and apposition detecting system includes at least one electrode pair of dissimilar metals mounted on a balloon of a balloon catheter. The electrode pair forms part of an electrochemical cell, and voltage and current generated from the electrochemical cell enables the system to detect when a stent mounted on the balloon achieves proper wall apposition. As the balloon is exposed to different environments, i.e., blood or tissue having different resistances, the electric potential of the electrochemical cell changes and an alert is generated by a feedback circuit to notify a user that the electrodes are in contact with tissue of the vessel wall. In one embodiment, the feedback circuit may be powered by the electrochemical cell. Multiple sets of electrode pairs may be mounted along the circumference and length of the balloon to detect differential contact between the deployed stent and the vessel wall. |
US09237959B2 |
Stent and barb
A stent is described and comprises an elongate strut having a first end and a second end, an aperture formed in the strut, and a barb having a base and a distal anchor. The barb base is attached to the strut and the barb extends distally from the base through the aperture. Other devices, systems, and methods are described. |
US09237958B2 |
Joint prostheses
The present invention provides an implantable joint prosthesis configured to replace a natural joint, and methods for implantation. The prosthesis may include a first component implantable in a first bone, having a first bearing surface, and a second component implantable in a second bone, having a second bearing surface which corresponds to the first bearing surface. Each bearing surface may include a flattened section such that when the bearing surfaces are placed in cooperation with one another in a preferred orientation, the flattened sections are aligned. Alternatively, the bearing surfaces may have and asymmetric configuration, with non-congruent surfaces that may enable correction of deformity. Several types of implantable joint prostheses are disclosed, including: carpometacarpal, metacarpophalangeal, metatarsophalangeal, distal interphalangeal, proximal interphalangeal, ankle, knee, shoulder, and hip. |
US09237957B2 |
Low profile plate
The present application generally relates to orthopedic systems, and in particular, to systems including independent plates and spacers. A plating system can include a spacer and a plate that is independent from the spacer. A number of locking mechanisms can be provided to secure the plate to the spacer. In some cases, the spacer includes a pair of notches that extend on an outer surface of the spacer. The plate can include a pair of lateral extensions that can engage the notches to secure the plate to the spacer. In other cases, the spacer includes an opening including a pair of inlets. The plate can include an enclosed posterior extension that can be received in the pair of inlets to secure the plate to the spacer. |
US09237953B2 |
Mechanical assembly of pegs to prosthesis
An orthopaedic prosthesis for cementless fixation has a solid metal base and porous metal pegs extending out from the base. The pegs are mechanically, rather than metallurgically, fixed to the base. A process for making such a prosthesis is also disclosed. |
US09237951B1 |
Apparatus and method for identifying tibia bone rotation in knee implant surgery
A method and an apparatus are disclosed for identifying a proper tibia bone rotation relative to the femur bone for orientating a prosthesis in a knee replacement surgery. The proper tibia bone rotation is identified from an external rotation of the tibia in extension and an internal rotation of the tibia flexion. A point located midway between the external and internal rotations and a Whiteside line of the femur defines a center axis of tibia rotation plane. The rotational angles of the tibia may be measured by a mechanical goniometer or a computer navigation apparatus. |
US09237949B2 |
Method and apparatus for hip replacement
Methods and apparatus for orthopedic replacement of the hip through three incisions with a modular prosthetic system assembled in vivo while substantially preserving muscles and soft tissues around the hip joint resulting in reduced healing time and decreased risk of dislocation. A prosthetic femoral stem is inserted into the femur. A prosthetic femoral neck is inserted from a point along the side of the patient's body and into the side of the femur and through a lateral bore in the prosthetic femoral stem to join the prosthetic femoral head. The methods and apparatus include structures and techniques for fixing or enhancing interconnection of implant components, such as by increasing the interconnection in an interference fit with one or more tapers, threads, and/or cooling of components prior to assembly. |
US09237943B2 |
Brush head attachment
The present invention relates to a brush head attachment, in particular for an electric sonic toothbrush, comprising a shank member carrying a bristle bundle, and a coupling member (1) provided on the fastening-side end of said shank member with at least one connection surface for a drive shaft of said handpiece which, when a brush head attachment is mounted on a handpiece, protrudes into said coupling member (1), a spring element that can be operatively connected with said drive shaft for securing said drive shaft to said brush head attachment and/or transferring a drive motion of said drive shaft to said brush head attachment, and a metal ring (4) disposed in a widened fastening foot (2) formed by said coupling member (1). In this inexpensively manufactured brush head attachment according to the present invention, said metal ring (4) is a die-cast member. |
US09237942B2 |
Tools for customized design of dental restorations
Tools in a system for the design of customized three-dimensional models of dental restorations for subsequent manufacturing. Dental restorations such as implant abutments, copings, crowns, wax-ups, bridge frameworks. Moreover, a computer-readable medium for implementing such a system on a computer. A system for designing at least one dental restoration, said system including: a display, means for acquiring and displaying a three dimensional dental restoration model of the dental restoration, and means for displaying a plurality of control points, each of the control points corresponding to a respective location on the dental restoration model, and each of said control points enabling manual customization of the dental restoration model. |
US09237941B2 |
Orthodontic appliance and system
An orthodontic appliance and system are provided for adjusting the relative positions of mandibular and maxillary arches. The orthodontic appliance includes a telescoping assembly including a plurality of telescoping members, and at least a first end member supportably retaining at least a portion of a spring member. The end member is adapted to slidably receive an end of a first telescoping member for selectively interconnection and disconnection therebetween. When interconnected, the spring member extends into an open end of the first telescoping member and is operative to apply spring-force to a second telescoping member. A plurality of interchangeable end members may be provided for use with the telescoping assembly, wherein the different end members have different spring-force delivery attributes. The orthodontic appliance may be installed utilizing an attachment device selectively interconnectable to and disconnectable from orthodontic archwires. |
US09237933B2 |
Universal arm system
A universal arm has a proximal end, a distal end and a middle portion therebetween. The middle portion has a plurality of interconnected ball and socket pieces. A plurality of clamps are selectively fixedly connected to the distal end of the universal arm by a connection that permits the selective rotation of each one of the plurality of clamps by 360° with respect to the distal end of the universal arm. |
US09237932B2 |
Vacuum shell for robotic surgery of soft tissue
A device for assisting robotic surgery of soft tissue, that comprises a shell with a flexible sealing rim, instrument ports, and a vacuum port. The flexible sealing rim seals the shell around a surgical area and allows for the application of negative pressure via the vacuum port. The negative pressure manipulates soft tissue to allow a surgeon to perform an incision with a robotic surgery apparatus. |
US09237931B2 |
Stereotactic access devices and methods
This invention is directed to devices and methods for stereotactic access, and particularly to a frameless stereotactic access device for accessing a body cavity and methods therefor. In general, a stereotactic device may include portions or features for fixing the device to a portion of a patient's body, such as, for example, a skull, such that the device may be generally spatially fixed in relation to the patient's body or part thereof. The stereotactic device may also generally include portions or features for guiding a medical device or other device at a particular trajectory in relation to the patient's body or part thereof. |
US09237927B2 |
Flow rate monitor for fluid cooled microwave ablation probe
A microwave ablation system includes an antenna assembly configured to deliver microwave energy from a power source to tissue and a coolant source operably coupled to the power source and configured to selectively provide fluid to the antenna assembly via a fluid path. The system also includes a controller operably coupled to the power source and a sensor operably coupled to the fluid path and the controller. The sensor is configured to detect fluid flow through the fluid path and the controller is configured to control the energy source based on the detected fluid flow. |
US09237925B2 |
Expandable catheter system for peri-ostial injection and muscle and nerve fiber ablation
At the present time, physicians often treat patients with atrial fibrillation (AF) using radiofrequency (RF) catheter systems to ablate conducting tissue in the wall of the Left Atrium of the heart around the ostium of the pulmonary veins. These systems are expensive and take time consuming to use. The present invention circular ablation system CAS includes a multiplicity of expandable needles that can be expanded around a central axis and positioned to inject a fluid like ethanol to ablate conductive tissue in a ring around the ostium of a pulmonary vein quickly and without the need for expensive capital equipment. The expansion of the needles is accomplished by self-expanding or balloon expandable structures. The invention includes centering means so that the needles will be situated in a pattern surrounding the outside of the ostium of a vein. Also included are members that limit the distance of penetration of the needles into the wall of the left atrium, or the aortic wall. The present invention also has an important application to ablate tissue around the ostium of one or both renal arteries, for the ablation of the sympathetic nerve fibers and/or other afferent or efferent nerves going to or from each kidney in order to treat hypertension. |
US09237919B2 |
Cryocatheter for introduction into a body vessel together with medical investigation and treatment equipment
A cryocatheter for introduction into a body vessel or into an organ, with a catheter inner surrounded by a catheter sheath, and with a catheter tip arranged at its distal end, with a feed line for an expansion or cooling agent arranged in the catheter sheath or the catheter inner, and with a balloon, arranged close to the catheter tip, which can be expanded and contracted again by means of the expansion and cooling agent, is to be constructed in such a way that by simple manipulation it can be positioned at a precise target position in the body vessel and, in addition, it minimizes the burden on the patient from invasive interventions. For this purpose, in accordance with the invention an image capture device, with at least one imaging sensor for mapping the region of the vessel around the balloon, is positioned in the region of the catheter tip. |
US09237918B2 |
Endoscope treatment tool
An endoscope treatment tool includes a sheath having electric insulation; and an electrode unit provided at a distal end portion of the sheath. The electrode unit includes a rod-shaped electrode that is provided to extend in an axis direction of the sheath and is capable of being arranged in a state where the electrode protrudes from the distal end portion of the sheath and is exposed to the outside; and a chip that is fixed in a state where a distal end portion of the electrode is inserted into a concave portion provided in a proximal end surface so as to extend in the axis direction, has a greater external diameter than the external diameter of the electrode, and is formed from a single electric insulation material. The concave portion is formed with a smaller-diameter portion that allows the distal end portion of the electrode to be inserted thereinto. |
US09237915B2 |
Bone screw and method for manufacturing the same
A bone screw and a method for manufacturing the same includes a screw thread configuration having one or more grooves cut into a leading face of the thread, a trailing face of the thread, and/or the shaft between the threads. Other implementations include the incorporation of facets into the one or more grooves. The implementation of the one or more grooves increases the surface are of the orthopedic screw and functions to increase in anchoring the bone screw within the bone once inserted therein, and thereby reduce the possibility for the screw backing out after insertion. |
US09237912B2 |
Minimally invasive implant and crimping system
A device for treating a bone comprises a cable block including a first lumen extending from a first proximal opening in a proximal face of the cable block to a first distal opening in a distal face thereof, the first lumen being configured to receive a cerclage cable including an enlarged end. The cable block further includes a second lumen extending from a second proximal opening in the proximal face to a second distal opening in the distal face and being configured to receive a portion of the cable extending from the enlarged end while preventing the enlarged end from passing therethrough. The cable block includes a slot connecting distal portions of the first and second lumens and being at least as large as the second lumen in combination with a crimpable locking member including a channel configured to receive the portion of the cable extending from the enlarged end. |
US09237909B2 |
Surgical nail
The surgical nail, here in the form of an intramedullary nail, has a central axis, a longitudinal borehole with a diameter D extending coaxially with the central axis, a casing with an inner surface and a transverse borehole, extending transversely to the central axis with the cross-sectional profile F and the borehole axis. A component, which narrows the cross-sectional profile F, is provided in the longitudinal borehole in the region of the transverse borehole. By these means, the clearance, which is usually present between the medullary nail and the locking screws that have been introduced therein, can be eliminated without risk and an improved holding force as well as an improved guiding effect between the locking screw and the medullary nail can be achieved. |
US09237907B2 |
Spinal correction system and method
A spinal correction system comprises a first member configured for attachment to a first portion of vertebral tissue and a second member is configured for attachment to a second portion of the vertebral tissue spaced from the first portion. A third member has a non-flexible configuration relative to the first and second members and is configured for attachment to an apical portion of the vertebral tissue and along at least a portion of at least two vertebrae. The third member extends between a first end connected to the first member at a first transition configured for attachment to the first vertebral tissue and a second end connected to the second member at a second transition configured for attachment to the vertebral tissue. Methods of use are disclosed. |
US09237906B2 |
Combination of a bone drill and a sleeve
Combination of a bone drill and a sleeve, whereby the combination comprises a receiving space for bone chips between the sleeve and the bone drill when the bone drill is inserted in the sleeve |
US09237904B2 |
Puncturing instrument
A puncturing instrument includes a cylindrical main body case having a puncture aperture on a lower end side; a needle holder provided on a puncture aperture side inside the cylindrical main body case; a first elastic object for moving the needle holder to the puncture aperture side; and a second elastic object for pulling the needle holder back to an upper end side inside the cylindrical main body case, from a state in which the needle holder is moved to the puncture aperture side by the first elastic object. A rotator rotates around a rotation shaft fixed to the cylindrical main body case, and is coupled with a coupling portion of the needle holder on a first one of two sides of the rotator with the rotation shaft interposed therebetween and is coupled with the second elastic object on a second one of the two sides of the rotator. |
US09237896B2 |
Ghost ring guide for assistance in percutaneous insertions
Among other things, there is disclosed embodiments of devices for assisting in aiming and inserting percutaneous medical tools or devices. A mandrel portion with a sharpened end has two or more guiding or directing members attached to it. The guiding or directing members at least partially define spaces that form part of a channel that is oriented parallel to the longitudinal axis of the mandrel portion, and one or both can be easily visualizable using imaging technology. The clinician can insert the aiming or guiding device into the patient, use imaging technology along the axis of the channel of the device to see whether the device is accurately placed, and if so, the guiding or directing members can be used to guide the percutaneous insertion of a medical tool or device. |
US09237893B2 |
Surgical stapling apparatus including buttress attachment via tabs
An apparatus for joining two hollow organ sections with an annular array of surgical staples includes a staple cartridge component, an anvil component, a buttress component and a fastening member. The staple cartridge component includes a plurality of surgical staples arranged in an annular array. The anvil component is movable relative to the staple cartridge component between spaced apart and approximated positions to adjustably clamp the organ sections between the staple cartridge and anvil components. The buttress component is configured and dimensioned to be positioned on a distal surface of the staple cartridge component. In particular, the buttress component includes a buttress member and a plurality of circumferentially arranged tabs extending proximally from the buttress member. The fastening member is configured and dimensioned to engage the plurality of circumferentially arranged tabs to securely position the buttress component on the staple cartridge component. |
US09237892B2 |
Buttress attachment to the cartridge surface
An end effector for use with a surgical apparatus. The end effector comprising a staple cartridge having a tissue contacting surface defining a central longitudinal slot and an anvil plate having a tissue contacting surface defining a central longitudinal slot. A surgical buttress releasbly disposed on the tissue contacting surfaces of each of the staple cartridge and anvil plate. An adhesive tape is disposed over the central longitudinal slot of each of the staple cartridge and anvil plate and configured retain the respective surgical buttress atop the respective tissue contacting surface. |
US09237886B2 |
Implant for treatment of a heart valve, in particular a mitral valve, material including such an implant, and material for insertion thereof
This implant (1) is formed by a helically wound wire (2). According to the invention, it has dimensions such that it is able to be screwed into the wall of the annulus (103) and/or into the cardiac wall (101) adjoining this annulus (103) such that a portion of said annulus (103) and/or of said wall (101) is located in the perimeter of the implant (1); and it comprises at least one first coil able, during said screwing of the implant (1), to insert itself into said wall while having a first dimension and at least one second coil having a second dimension, or adopting this second dimension after implantation, said second dimension being smaller than the first dimension such that the implant (1), once inserted, enables contraction of said wall portion located in the perimeter of this implant (1). |
US09237885B2 |
Muscular-skeletal tracking system and method
At least one embodiment is directed to a tracking system for the muscular-skeletal system. The tracking system can identify position and orientation. The tracking system can be attached to a device or integrated into a device. In one embodiment, the tracking system couples to a handheld tool. The handheld tool with the tracking system and one or more sensors can be used to generate tracking data of the tool location and trajectory while measuring parameters of the muscular-skeletal system at an identified location. The tracking system can be used in conjunction with a second tool to guide the second tool to the identified location of the first tool. The tracking system can guide the second tool along the same trajectory as the first tool. For example, the second tool can be used to install a prosthetic component at a predetermined location and a predetermined orientation. The tracking system can track hand movements of a surgeon holding the handheld tool within 1 millimeter over a path less than 5 meters. |
US09237883B2 |
Full core biopsy device
A biopsy device includes coaxially disposed inner and outer needles in which the outer needle tip is configured for obtaining a tissue sample. The inner surface of the outer needle includes a tissue retention feature which may include a countersink and/or a feature formed in the inner surface. The device may be configured such that the inner needle does not extend past a certain point within the outer needle. |
US09237882B2 |
Ultrasound probe diagnosing apparatus, ultrasound diagnostic apparatus, and ultrasound probe diagnosing method
An ultrasound probe diagnosing apparatus which diagnoses an ultrasound probe having an array of a plurality of ultrasound transducing elements on the basis of how the ultrasound probe receives reflected ultrasound waves from a test object placed to face the ultrasound probe, includes a part which detects a posture of the ultrasound probe with respect to the test object by comparing reflected ultrasound signals received by at least some of the plurality of ultrasound transducing elements, and a presenting part which presents information based on the detected posture. |
US09237881B2 |
Ultrasonic diagnostic apparatus and method of retrieving and displaying heart function test period
The present invention provides an ultrasonic diagnostic apparatus including a bio-signal analyzing section sequentially acquiring a bio-signal from a bio-signal acquiring section over a plurality of cycles to evaluate stability of a heart function in one cycle between particular signal waveforms of the bio-signal and one cycle between particular signal waveforms adjacent to the one cycle between the particular signal waveforms, selecting the one cycle between the particular signal waveforms and one cycle between the particular signal waveforms adjacent to the one cycle between the particular signal waveforms as a test period for the heart function based on the content of the evaluation, and associating the selected test period with a time phase of the bio-signal. |
US09237872B2 |
X-ray source with moving anode or cathode
An X-ray source comprising a cathode element adapted to generate a stream of electrons. The X-ray source includes an anode element adapted to present a focal spot position for the stream of electrons. A vacuum chamber contains the cathode element and anode element. The anode element and/or the cathode element can be moveable with respect to the other in coordination with the generation of the stream of electrons. |
US09237867B2 |
Cartridge for insertion into a blood glucose meter
A cartridge (700) for insertion into a meter comprises: a plurality of cartridge brackets (704) disposed on an inner wall (703) of the cartridge; a spindle (702) mounted so as to be rotatable within the cartridge and movable longitudinally in first and second directions within the cartridge; and a plurality of testing members (708) each arranged to be supported temporarily by at least one of the plurality of cartridge brackets, each of the testing members including) a hole (306) through which the spindle is located, the spindle having a plurality of spindle brackets (706) disposed on an outer surface thereof, each spindle bracket being movable between first and second positions. |
US09237865B2 |
Analyte sensors and methods for making and using them
Embodiments of the invention provide analyte sensors having elements designed to modulate their chemical reactions as well as methods for making and using such sensors. In certain embodiments of the invention, the sensor includes a hydrophilic comb-copolymer having a central chain and a plurality of side chains coupled to the central chain, wherein at least one side chain comprises a silicone moiety. |
US09237862B2 |
Diagnosis of asthma
An apparatus (200) for diagnosing asthma is disclosed. The apparatus (200) comprises a data acquisition module (210) configured to acquire at least one physical deformation feature associated with at least one of nasal flaring, neck retraction and inter-coastal retraction of a subject under examination and an analysis module (220) configured to analyze the acquired at least one physical deformation feature associated with at least one of the nasal flaring, the neck retraction and the inter-coastal retraction of the subject under examination and diagnose the asthma based on the analyzed at least one physical deformation feature associated with at least one of the nasal flaring, the neck retraction and the inter-coastal retraction of the subject under examination. The disclosed apparatus (200) can be used for monitoring asthma at home, at hospital or in ambulatory patients. |
US09237859B2 |
Multi-function health monitor
A system and method for a multi-function remote ambulatory cardiac monitoring system. The system includes a microprocessor for controlling the remote ambulatory cardiac monitoring system and a non-transitory computer readable medium associated with the microprocessor. The non-transitory computer readable medium includes instructions to perform one of the following modes: EKG mode, ECG Holter mode, or MCT/Event mode. The system also includes a controller connected to the microprocessor. The controller initiates or switches the functionality of the remote ambulatory cardiac monitoring system by causing the microprocessor to initiate one of the EKG mode, ECG Holter mode, or MCT/Event mode. |
US09237857B2 |
Device for applying electrode assemblies
The invention relates to a device comprising a number of electrode assemblies (10), which can be applied to the skin surface (4) of an animal or human being and by means of which voltages and currents can be tapped from the skin surface (4), and comprising a flexible, in particular extendable, retaining element (6) formed by a planar or film-like molded part. According to the invention, the electrode assemblies (10) comprise a main body (1) and a number of pin electrodes (2) that protrude from the main body (1) in the same direction, the electrode assemblies (10) are fastened to the retaining element (6), and the main body (1) of the respective electrode assembly (10) is connected to the retaining element (6), wherein the pin electrodes (2) of all electrode assemblies (10) protrude in the same direction. |
US09237854B2 |
Valve, fluid control device
In a fluid control device, a check valve includes a first valve housing and a first diaphragm. The first diaphragm defines a first valve chamber and a second valve chamber. An exhaust valve includes a second valve housing and a second diaphragm. The second diaphragm defines a third valve chamber and a fourth valve chamber. The check valve is opened and closed by a difference in pressure between the first valve chamber and the second valve chamber. The exhaust valve is opened and closed by a difference in pressure between the third valve chamber and the fourth valve chamber. |
US09237851B2 |
Imaging system producing multiple registered images of a body lumen
Systems, devices and methods for producing registered images of a body lumen are provided. The system includes a first imaging device having an imager positioned at a distal end thereof, said first imaging device configured to produce a first image of a body cavity; and an imaging system, including a second imaging device having an imager positioned at a distal end thereof and configured to be positioned approximate to said imager of said first imaging device within said body cavity and configured to produce a second image; an elongated member configured to contain said second imaging device; and at least one marker configured to produce registration information in the first image and the second image. |
US09237846B2 |
Photorefraction ocular screening device and methods
A photorefraction ocular screening device for assessing vision and corresponding disorders associated with the human ocular system is provided. More specifically, the present invention provides for a photorefraction ocular screening device employing advanced methods of pupil detection and refractive error analysis. The photorefraction ocular screening device is comprised of an LED arrangement configured with a plurality of irradiation sources serving as visual stimuli, wherein the visual stimuli may be presented in varying illumination patterns to the pupils of an examinee for expanding the range of ocular responses that can be used to determine refractive error. |
US09237845B2 |
Ophthalmologic image pickup apparatus and control method therefor
Provided is an ophthalmologic image pickup apparatus for measuring movement of an eye to be inspected at higher speed than a conventional one. The ophthalmologic image pickup apparatus for acquiring an image of an eye to be inspected based on return light from the eye to be inspected which is irradiated with measuring light via a scanning unit, includes: a position acquiring unit for acquiring a plurality of positions of characteristic portions in the image of the eye to be inspected based on the return light from the eye to be inspected corresponding respectively to a plurality of scanning lines of the scanning unit in the image of the eye to be inspected; and a measuring unit for measuring movement of the eye to be inspected based on the plurality of positions. |
US09237841B2 |
Adjustable bite blocks
Embodiments of the present invention relate to an adjustable bite block for positioning within a person's mouth and maintaining the mouth in an open position. The adjustable bite block comprising at least one band of curved material comprising a first portion and a second portion. The first and second portions configured to be coupled to one another so as to define a closed loop with an opening defined therethrough, wherein the first and second portions are further configured to be selectively adjusted relative to one another so as to adjust a radial dimension of the loop, and wherein the band is configured to be positioned within the person's mouth such that at least a portion of the loop maintains the person's mouth in an open position. Embodiments of the adjustable bite block may use snap tabs spaced along the band or a ratchet mechanism for adjustment of the radial dimension. |
US09237840B2 |
Light source system
A light source system includes an endoscope having an illumination section and an illumination control section connected to the endoscope and provided with a drive circuit that generates drive pulses for driving the light source, the light source system including: a type information generating section that generates type information regarding the endoscope; a signal generating section generates a signal indicative of a duty ratio of the drive pulses which is permitted to the illumination section; a light adjusting section that outputs light-adjusted drive pulses having a duty ratio not greater than a permissible duty ratio based on the type information and a limiting section that limits the light-adjusted drive pulses to have a duty ratio not greater than a duty ratio based on the signal from the signal generating section, and provides limited pulses to the drive circuit. |
US09237839B2 |
Device, system and method for activation, calibration and testing of an in-vivo imaging device
A device, system, and method for activating and initializing an in vivo imaging device with an RF radiation signal. Functionality of the in vivo imaging device is tested and results may be reported to a user. The in vivo imaging device may include an RF switch to facilitate powering or deactivation of one or more electrical components of the device. The initialization system may include an optical artifact testing unit, a field of illumination testing unit, and a transmission/reception testing unit. The activation system may comprise an in vivo device association unit which may relate a designated device to a single data recorder or to a single controller. |
US09237838B2 |
Endoscopy system and a pressure transmitting connector for said system
The inventive endoscopy system includes a cannula for arranging an endoscope and forming, between said cannula and endoscope, an irrigation or aspiration channel for transporting an irrigation or aspiration fluid, respectively, a connection ring mounted around the cannula and provided with a connection channel connectable to the irrigation or aspiration channel, respectively and a connector which is mounted on the connection ring and includes a transport channel with the connection channel and a first pressure sensor for detecting pressure in the transport channel. The connection ring is provided with a bypass circuit connectable to the irrigation or aspiration channel, respectively and the connector including a dead channel connectable to the bypass circuit and a second pressure sensor for detecting pressure in the dead channel. |
US09237837B2 |
Insertion device with the operation input unit
An insertion device sets engage range which it prescribed in return power to the neutral position by elastic force of the spring and rotation resistance force by the slide power by elastic member for dial portion performing curving operation of a curving portion. If a rotary angle is beyond an engage range, the dial part lets a rotary point of view to order return in an engage range and, if there is a rotary angle in an engage range, the dial part keeps a target part in an observation field of vision. |
US09237832B2 |
Illuminated inlet for vacuum cleaning apparatus
An illuminated inlet for a vacuum cleaning system which can be mounted in a wall of a structure or in a cabinet. The inlet includes a main frame, a front plate, a door, and an electrical switch that operates the motor of the vacuum cleaning system. Illumination of the area directly in front of the inlet is provided by LED's operated upon the opening of the door. The inlet is mounted adjacent a floor so that an individual can clean a room by sweeping up the dirt and debris towards the present invention. The door of the inlet is then opened and the dirt and debris is swept into the present invention. When the door opens the LED's are illuminated and the motor of the vacuum cleaning system is turned on so that the dirt and debris can be drawn into a collection container. When the door is closed, the LED's and the motor for the vacuum cleaning system is turned off. A magnet is used to keep the door in the open position and a retainer to keep the door in the closed position. |
US09237822B2 |
Hand operated fruit squeezer
A fruit squeezer for squeezing juice picks up, squeezes and discards the squeezed fruit with use of a single hand. The squeezer has a first handle and a second handle that are rotatably connected to each other. Each handle has a top portion and a bottom portion. A biasing spring biases the top and bottom portions apart. A U-shaped jaw is fixed to the bottom end of the second handle. A pressing plate jaw is pivotally mounted to the bottom end of the first handle. Squeezing the top ends of the handles toward each other against the force of a spring moves the jaws for squeezing the fruit. A screen operatively connected to the handles simultaneously rotates at a second pivot axis from a rest position to a screening position below the fruit for screening solids from the squeezed juice. |
US09237820B2 |
Ornament assembly with attachment clip
An ornament assembly includes an attachment clip, an elongated shaft, and an ornament. The attachment clip includes a first jaw and a second jaw. The first jaw includes a first spine and a first finger extending from the first spine. The second jaw includes a second spine and a second finger extending from the second spine toward the first finger. The elongated shaft includes a first end and a second end. The second end of the elongated shaft is coupled to each of the first spine and the second spine such that at least one of the first jaw and the second jaw rotates about the elongated shaft to move the attachment clip between an open position and a closed position. The ornament is coupled to the first end of the elongated shaft such that the ornament is spaced from the attachment clip via a length of the elongated shaft. |
US09237818B2 |
Mounting assembly for a medal and a ribbon and a method of mounting the medal and the ribbon
A mounting assembly for a medal is provided. The medal is coupled to a ribbon. The mounting assembly includes a housing, a magnet disposed in the housing, and a clip member having first and second walls. The first wall has a first surface and a second surface. The second wall has a biasing portion extending toward the first wall. The second wall is coupled to the housing such that a gap is formed between the biasing portion and the first surface of the first wall. The mounting assembly further includes an adhesive sheet that is disposed on the second surface of the first wall. The adhesive sheet is configured to hold the medal thereon. |
US09237817B2 |
Restaurant system
The invention relates to a restaurant system (2), comprising a) at least one working area (3) for cooking and/or preparing meals and/or beverages, b) at least one customer area (4), in particular with one or more tables (5) for restaurant customers, c) working area (3) and customer area (4) being connected via a transport system (6) for meals and/or beverages, d) the transport system (6) being designed to transport meals and/or beverages from the working area (3) to the customer area (4), and e) the transport of meals and/or beverages from the working area (3) to the customer area (4) via the transport system (6) taking place, at least in some sections, by means of gravity. |
US09237814B2 |
Feedback loop in control of an adjustable bed including a memory
This disclosure concerns a wireless communication system adapted to establish a feedback protocol between a handheld remote control and at least an adjustable bed controller, the handheld remote control having a memory position user interface adapted to initiate a transmission of a position recall command from the handheld remote control to an adjustable bed controller using the feedback protocol to adjust a position of a bed segment to a preset position from within a predetermined range of acceptable positions stored in memory. The adjustable bed controller is adapted to initiate a communication from the adjustable bed controller to the handheld remote to indicate that the adjustable bed controller has responded to the position recall command. |
US09237810B2 |
Folding furniture
A folding chair includes a frame, a seat bottom coupled to the frame, and legs for supporting the seat bottom in a horizontal position relative to the frame. The frame is formed to include a seat back. |
US09237805B2 |
Storage system
A storage system including a first component (102), and an extendable component (130) slidably mounted on the first component. The extendable component includes a pair of side members (132) spaced apart to accommodate a container (150) in use and at least one base member (132) arranged to support a lower surface of the container in use. The extendable component includes a first fixing arrangement (138) located at or adjacent one end of the extendable component and a second fixing arrangement (134) located at or adjacent another end, in use, the first and second fixing arrangements being configured to releasably engage with members on a container supported by the extendable component. |
US09237804B1 |
Drawer slide rail assembly
A drawer slide rail assembly includes movably connected first and second rails, a movable member, a supporting member, and an adjusting member. The movable member has a mounting hole corresponding to a mounting portion of the second rail and is linearly movably mounted to the second rail via the supporting member. The adjusting member includes a cam with an eccentric shaft. The cam at least partially presses against the movable member. The shaft extends through the movable member and is connected to the second rail. The second rail can be mounted to a drawer via a connector which also connects the movable member and the second rail. The drawer is adjustable in position relative to the second rail by the adjusting member. |
US09237802B1 |
Multifunctional portable workstation
A portable, monopod workstation including a planar surface and an unstable support rod. The planar surface configured to support a tablet or notepad and detachably couple to an unstable support rod. The unstable support rod comprising one or more first type mounting joints and one or more second type mounting joints and configured elevate the planar surface, and further comprises a first member and a second member. The first member and second member are configured to detachably couple to different mounting locations on the planar surface, orient the planar surface when coupled to the back side of the planar surface, and restrain articles from sliding off the planar surface. |
US09237797B2 |
Conical sponge brush for cleaning semiconductor wafers
A cleaning device for cleaning a substrate is provided. In one aspect, the cleaning device includes a brush including a first end, a second end opposed to the first end, an outer surface, and a hollow bore defined in the brush about a central axis of the brush. The brush defines a first cross-sectional area near the first end and a second cross-sectional area near the second end. Both the first and second cross-sectional areas are generally perpendicular to the central axis and the second cross-sectional area is greater than the first cross-sectional area. |
US09237795B2 |
Collapsible beverage cup
A collapsible beverage cup and method for its use. The beverage cup is provided with a body portion capable of lying flat in a first state and capable of assuming the shape of a beverage cup in a second state. In its first state, the collapsible beverage cup is substantially two dimensional and planar having a relatively rigid outer shell having a first edge, second edge and boundary edges joining said first and second edges, the collapsible beverage cup further comprising an inner liner for retaining a beverage therein when said collapsible beverage cup is in its second state and a loop, preferably in the shape of a round ring, sized to slide onto the outer shell and releasably maintain the collapsible beverage cup in its second state. |
US09237791B2 |
Cosmetic container
A container for holding cosmetics which has a base assembly, a cover member configured to engage the base assembly, and a receptacle retained by the base assembly. The base assembly and the receptacle are attracted by a magnetic force and a release lever extends between the base assembly and the receptacle. |
US09237790B2 |
Head-hair treatment-agent applicator
A head-hair treatment-agent applicator (1) according to the present invention has an agent applying part (2) which has a comb part (23) formed with a plurality of annularly arranged comb teeth (22), and the comb teeth (22) each have an inversely-tapered part (22c) in which a comb tooth width W decreases from a vicinity of a tip (22a) to a base end (22e). |
US09237789B2 |
Hair dryer systems and methods and attachments for such hair dryer systems
A hair dryer system includes a hair dryer connectable to a power source and having a power connection, an attachment that is connectable to the power connection and is supplied power from the power source by the power connection. When the hair dryer is connected to the attachment by the power connection, the hair dryer and attachment consume a predetermined amount of power. When the hair dryer is disconnected from the attachment, the hair dryer consumes less power than the predetermined amount of power. |
US09237788B2 |
Bristle hair roller
A roller for creating a curl, wave, or volume in human hair extending across a width of a human head is disclosed. The roller has cylinder and a plurality of bristle groups. The cylinder has a first end, a second end, a cylindrical side wall, a central passage, and a plurality of vent apertures. Each bristle group comprises a plurality of bristles. The cylindrical side wall extends between the first and second end. The central passage extends within the cylinder between the first and second end. The plurality of bristle groups are spaced about the cylindrical side wall. |
US09237782B2 |
Slide fastener
The slide fastener includes a pair of fastener tapes, a pair of fastener element rows respectively including a plurality of fastener elements and coupling yarns coupling the plurality of fastener elements, and a slider configured to engage and disengage the pair of fastener element rows. Each of the fastener elements includes a body portion, a neck portion, an engaging head, portion and a pair of shoulder portions provided at both sides of the neck portion in the tape longitudinal direction and configured to come in contact with opposite engaging head portions. The pair of fastener tapes have stretchability in the tape longitudinal direction. |
US09237780B2 |
Conditionally visible bite lines for footwear
A conditionally visible bite line may be demarcated on a shoe upper using one of a fluorescent material and an Infrared (IR) material. Such a conditionally visible bite line may be observable only under particular conditions, such as when illuminated by an ultraviolet light source or an IR light source, as appropriate. A light may be projected to intersect the conditionally visible bite line under conditions rendering the conditionally visible bite line detectable. The intersection(s) of the projected light and the conditionally visible bite line may be used to create a virtual bite line for use in generating a tool path to process the surface of a shoe upper bounded by the conditionally visible bite line. |
US09237779B2 |
Shoe upper having multiple unwelded flex zones
A shoe having a shoe upper including multiple unwelded flex zones in selected locations on the shoe upper. The flex zones may be selectively located on the upper to flex when the shoe is in use. |
US09237774B2 |
Cladding element made of chain mail
A cladding element is formed from chain mail for cladding forms having different radii with the chain mail. For this purpose, the chain mail has at least one cut, which is connected at the edges thereof or to the edges of a further cut in order to clad the form. The chain mail has a running direction, in which the chain mail can be stretched to a substantially smaller degree, or cannot be stretched at all, compared to a direction running transversely thereto, preferably at a right angle. Because the chain mail with the running direction is arranged along an arc of the form specified by the radius and has indentations transversely to the running direction, wherein the connection takes place particularly along the edges of the cuts, three-dimensional round forms such as spheres or annular shapes or the segments thereof are clad efficiently. |
US09237773B2 |
Self-securing forearm guard
A self-securing forearm guard used to protect a user's upper extremity during athletic training and competition. The current design incorporates heat moldable materials that allows an athlete to customize the guard's fit around their forearm using pressure applied by hand, and wherein the arm guard will retain the desired shape after the pressure is released, and thereby stay securely attached to said athlete's forearm without the need for straps and/or removable fasteners. The arm guard is adapted to protect a user's forearm during athletic activities such as skiing past and through ski gates, wherein it is common for a skier's forearm to intentionally contact the poles of such gates when skiing at a high rate of speed therethrough, thereby avoiding varying degrees of injury. |
US09237770B2 |
Hookah heat management accessory
A Hookah Heat Management Accessory comprising a base plate configured to rest on the tobacco bowl sitting on the top of a Hookah and which conducts heat from charcoal, or other heat source, to the tobacco beneath it; an insulating wall connected to the base plate; an inner lid that mates to the aforementioned wall piece; and an outer lid that is loosely attached to the inner lid allowing for rotation, ventilation, and thermal regulation. |
US09237768B2 |
Preformed smokeless tobacco product
Some embodiments of a smokeless tobacco system include one or more preformed smokeless tobacco products configured to generally retain their shape during processing, shipping, and consumer handling. In particular embodiments, each smokeless tobacco product can comprise a moist smokeless tobacco in combination with a selected binder such that the final product is configured to have material properties providing improved handling, an improved mouth feel, and a satisfying flavor profile. |
US09237766B2 |
Vacuum food preservation system
A refrigerator includes a cabinet defining an open storage space and including a door with an exterior side and an interior side adapted to receive a modular component. The modular component includes a base removably connected to the interior side and has a first edge and a second edge. A component door is hingedly-connected to the first edge of the base and is operable between an open position and a closed position. The base and component door define a sealed compartment when the component door is in the closed position. First fasteners are disposed on the component door, and second fasteners are disposed on the base. The second fasteners engage the first fasteners to create an airtight seal between the component door and the base. A vacuum device is in communication with the sealed compartment and a heat sealer is disposed on the base or the component door. |
US09237764B2 |
Production of 6′-O-sialyllactose and intermediates
The present invention relates to a method for preparation of the trisaccharide 6′-O-sialyllactose (formula (I)) or salts thereof as well as intermediates in the synthesis and for the use of 6′-O-sialyllactose salts in pharmaceutical or nutritional compositions. |
US09237762B2 |
Aqueous dispersion comprising galactolipids and method for production thereof
A method for preparing a dispersion of polar lipids in an ethanol-water mixture, the polar lipids including galactolipids. An oil containing polar lipids including galactolipids is diluted using a first ethanol-water mixture having an ethanol concentration close to the critical polarity, wherein upon dilution the polar lipids form a lamellar liquid-crystalline phase, without first forming a hexagonal HII-phase. The invention also refers to an oil obtained by evaporating ethanol and water from the dispersion. The invention further refers to aqueous colloidal dispersions of polar lipids including galactolipids, to an oil containing polar lipids including galactolipids and to pharmaceutical, cosmetic and food compositions including such dispersions and/or oil. |
US09237757B2 |
Banana ripening
The present invention provides methods and systems for accelerating the ripening of bananas to a color stage of 3.0 to 3.5. Also provided herein are bananas ripened according to the methods of the present invention. |
US09237756B2 |
Method for preparing and conditioning granular burdock roots through combined uniform drying by using radio frequency pretreatment and microwave pulse spouting
A method for preparing and conditioning granular burdock through combined uniform drying by using radio frequency (RF) pretreatment and microwave pulse spouting is provided. The process of the present disclosure includes performing pretreatment on fresh burdock, protecting color, pre-drying by RF, drying through microwave pulse spouting, and packaging. The color and luster of a product are greatly improved after color protection, the RF pre-drying treatment may be performed for 20 minutes, and hot air drying treatments for removing moisture on the surface may be performed for 60 minutes. The method has a short drying time and high efficiency. The sectional microwave pulse spouting treatment needs 60 minutes totally, while the complete hot air drying treatment needs 400 minutes. Therefore the drying time of the method is greatly shortened, and the drying is uniform, and a sample after microwave pulse spouting drying has strong fragrance. |
US09237740B2 |
Compositions and methods relating to non-human animals modified to promote production of selected gametes
Methods and compositions for producing selected non-human mammalian germ cells and gametes and for making non-human animals using the produced germ cells and gametes are provided by the present invention. Methods of generating a non-human embryo and/or animal derived from donor stem cells, methods of generating chimeric non-human animals having substantially all gametes and/or germ cells derived from the donor stem cells, methods of producing a non-human host embryo lacking functional endogenous germ cells and non-human host embryos incapable of developing endogenous gametes of the present invention are described herein. |
US09237736B2 |
Soybean variety 01046238
The invention relates to the soybean variety designated 01046238. Provided by the invention are the seeds, plants and derivatives of the soybean variety 01046238. Also provided by the invention are tissue cultures of the soybean variety 01046238 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety 01046238 with itself or another soybean variety and plants produced by such methods. |
US09237735B2 |
Soybean variety 01046211
The invention relates to the soybean variety designated 01046211. Provided by the invention are the seeds, plants and derivatives of the soybean variety 01046211. Also provided by the invention are tissue cultures of the soybean variety 01046211 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety 01046211 with itself or another soybean variety and plants produced by such methods. |
US09237733B2 |
Soybean variety 01045798
The invention relates to the soybean variety designated 01045798. Provided by the invention are the seeds, plants and derivatives of the soybean variety 01045798. Also provided by the invention are tissue cultures of the soybean variety 01045798 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety 01045798 with itself or another soybean variety and plants produced by such methods. |
US09237730B2 |
Plants and seeds of hybrid corn variety CH970807
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH970807. The invention thus relates to the plants, seeds and tissue cultures of the variety CH970807, and to methods for producing a corn plant produced by crossing a corn plant of variety CH970807 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH970807. |
US09237728B2 |
Plants and seeds of hybrid corn variety CH989672
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH989672. The invention thus relates to the plants, seeds and tissue cultures of the variety CH989672, and to methods for producing a corn plant produced by crossing a corn plant of variety CH989672 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH989672. |
US09237727B2 |
Plants and seeds of hybrid corn variety CH306764
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH306764. The invention thus relates to the plants, seeds and tissue cultures of the variety CH306764, and to methods for producing a corn plant produced by crossing a corn plant of variety CH306764 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH306764. |
US09237726B2 |
Plants and seeds of hybrid corn variety CH364361
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH364361. The invention thus relates to the plants, seeds and tissue cultures of the variety CH364361, and to methods for producing a corn plant produced by crossing a corn plant of variety CH364361 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH364361. |
US09237723B2 |
Soybean cultivar S130049
A soybean cultivar designated S130049 is disclosed. The invention relates to the seeds of soybean cultivar S130049, to the plants of soybean cultivar S130049, to the plant parts of soybean cultivar S130049, and to methods for producing progeny of soybean cultivar S130049. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar S130049. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar S130049, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar S130049 with another soybean cultivar. |
US09237721B2 |
Plants and seeds of hybrid corn variety CH097633
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH097633. The invention thus relates to the plants, seeds and tissue cultures of the variety CH097633, and to methods for producing a corn plant produced by crossing a corn plant of variety CH097633 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH097633. |
US09237720B2 |
Plants and seeds of hybrid corn variety CH519842
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH519842. The invention thus relates to the plants, seeds and tissue cultures of the variety CH519842, and to methods for producing a corn plant produced by crossing a corn plant of variety CH519842 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH519842. |
US09237719B2 |
Plants and seeds of hybrid corn variety CH392881
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH392881. The invention thus relates to the plants, seeds and tissue cultures of the variety CH392881, and to methods for producing a corn plant produced by crossing a corn plant of variety CH392881 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH392881. |
US09237717B2 |
Soybean cultivar S120091
A soybean cultivar designated S120091 is disclosed. The invention relates to the seeds of soybean cultivar S120091, to the plants of soybean cultivar S120091, to the plant parts of soybean cultivar S120091, and to methods for producing progeny of soybean cultivar S120091. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar S120091. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar S120091, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar S120091 with another soybean cultivar. |
US09237708B1 |
Maize inbred PH253R
A novel maize variety designated PH253R and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH253R with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH253R through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH253R or a locus conversion of PH253R with another maize variety. |
US09237704B1 |
Maize inbred PH1MJ8
A novel maize variety designated PH1MJ8 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH1MJ8 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH1MJ8 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH1MJ8 or a locus conversion of PH1MJ8 with another maize variety. |
US09237702B1 |
Maize inbred PH25M1
A novel maize variety designated PH25M1 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH25M1 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH25M1 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH25M1 or a locus conversion of PH25M1 with another maize variety. |
US09237701B1 |
Maize inbred PH1KH4
A novel maize variety designated PH1KH4 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH1KH4 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH1KH4 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH1KH4 or a locus conversion of PH1KH4 with another maize variety. |
US09237699B2 |
Cotton variety 11R154B2R2
The invention relates to the novel cotton variety designated 11R154B2R2. Provided by the invention are the seeds, plants, plant parts and derivatives of the cotton variety 11R154B2R2. Also provided by the invention are methods of using cotton variety 11R154B2R2 and products derived therefrom. Still further provided by the invention are methods for producing cotton plants by crossing the cotton variety 11R154B2R2 with itself or another cotton variety and plants and seeds produced by such methods. |
US09237697B2 |
Soybean variety A1036292
The invention relates to the soybean variety designated A1036292. Provided by the invention are the seeds, plants and derivatives of the soybean variety A1036292. Also provided by the invention are tissue cultures of the soybean variety A1036292 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety A1036292 with itself or another soybean variety and plants produced by such methods. |
US09237695B2 |
Soybean variety A1036208
The invention relates to the soybean variety designated A1036208. Provided by the invention are the seeds, plants and derivatives of the soybean variety A1036208. Also provided by the invention are tissue cultures of the soybean variety A1036208 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety A1036208 with itself or another soybean variety and plants produced by such methods. |
US09237690B2 |
Equipment for cutting, collecting and dynamic processing of grass
The present invention refers to an mowing equipment (100) for cutting, collecting and dynamic processing of grass used for grass mowing, which, as well as mowing, innovates on gathering the mowed grass and proceeding on its dynamic processing, in order to transform the mowed and gathered grass amount in a disaggregated mass, similar to powder that is returned to the soil, thus being exempted from any subsequent steps on combing, sweeping, or picking. |
US09237689B2 |
Lawn mower robot system and method of controlling the same
A lawn mower robot system, comprising: a lawn mower robot disposed with a moving device; a mowing device disposed in the lawn mower robot and mowing lawns; a first communication device disposed in the lawn mower robot and transmitting an inquiry signal for state information; a plurality of boundary display apparatuses, arranged in a lawn presence region, disposed with a second communication device for receiving the inquiry signal for the state information from the first communication device and for transmitting an acknowledge signal for the state information to the first communication device; a controller for recognizing a plurality of absolute coordinates from the lawn presence region based on the acknowledge signal for the state information received from the second communication device and for controlling the mowing device within the limit of the plurality of absolute coordinates. |