最新美国发明专利第2010-06-08期 - 专利汇|PatentHub专利检索|专利查询网|发明专利查询分析

Document	Document Title
US07733556B2	Optical devices with cascaded liquid crystal elements An optical beam processing device with two serially disposed birefringent elements, each element having its own direction of orientation. At least one element is pixelated with electrodes activated by control signals. The directions of orientation of the elements are aligned such that the phase shift imparted to the beam by an unactivated pixel of one element, cancels the phase shift imparted to the beam by the other element, such that the beam traversing that pixel undergoes zero phase shift. An appropriate control signal adds a phase shift to the beam passing through that pixel, so as to generate an overall phase shift through the device for any desired wavelength, which could not be readily achieved by either of the elements alone. The resulting device is thus able to provide switchable phase shifts of exactly zero and pi, for different wavelengths, generally unattainable by a single element device.
US07733549B2	Actuators, pumps, and optical scanners An actuator includes a substrate including an insulating surface, a first electrode positioned on the insulating surface, and a flexible drive plate which opposes the insulating surface. Te actuator also includes a conductive liquid positioned between the insulating surface and the flexible drive plate, and the conductive liquid directly or indirectly contacts the insulating surface and the flexible drive surface. Moreover, the actuator includes a potential application device electrically coupled to the first electrode and configured to apply a potential to the first electrode.
US07733544B2	Laser scanner A laser scanner may include a measuring head structured to be rotatable around a first axis, a first rotary drive structured to rotate the measuring head, a rotary mirror rotatable around a second axis, a second rotary drive structured to rotate the rotary mirror, a transmitter structured to transmit a light beam, a receiver structured to receive a reflection of the light beam from an object located at a distance from the laser scanner, and a processor structured to process signals embedded within the reflection of the light beam. The measuring head may include a plurality of modules, and the first rotary drive, rotary mirror, second rotary drive, transmitter, and receiver may be provided on one of the plurality of modules. At least two of the plurality of modules may be releasably connected to each other.
US07733541B2	Method of shortening multiple-image scanning duration A method of shortening multiple image-scanning duration including setting the scanning parameters of each images in a pre-scanning operation, categorizing the images into groups, assigning images belonging to the same group to a scanning region and finally initializing the scanning operation.
US07733537B2	Scanning device and calibration mechanism thereof A scanning device includes a first chassis, a second chassis and a calibration mechanism. The first chassis is for scanning one side of a document. The second chassis is for scanning the other side of the document. The second chassis is movably disposed opposite the first chassis. The calibration mechanism is for calibrating the color depth of the scan image. The calibration mechanism includes a calibration sheet and an elastic member. One end of the elastic member is fixed in the scanning device. The second chassis exerts a force on the calibration sheet to generate a relative movement between the calibration sheet and the first chassis. When the second chassis ceases exerting the force, the elastic member releases a resilient force for moving the calibration sheet to a starting position. The first chassis performs dynamic calibration by the relative movement between the first chassis and the calibration sheet.
US07733534B2	Image processing method, image processing apparatus, image forming apparatus, and recording medium In an image processing apparatus that performs a dither processing using a dither matrix based on the result of determination of the segmentation class to which the pixel to be processed belongs, to perform the dither processing, any of a plurality of pairs of threshold values is selected according to the result of determination of the segmentation class, and the selected pair of threshold values are compared with the value of the pixel to be processed, which are set so that in correspondence with each position of a dither matrix of a same configuration and a same size, a different dither processing is performed according to the result of determination of the segmentation class on part of the dither matrix and a same dither processing is performed irrespective of the result of determination of the segmentation class on the remainder of the dither matrix.
US07733532B2	Laser print apparatus with dual halftones A printing system comprises a memory configured to store image data representing an image. The printing system comprises a processor configured to perform a first digital halftone process on a first portion of the image and a second digital halftone process on a second portion of the image.
US07733531B2	Image processing apparatus, image processing program, and image processing method with error diffusion An image processing apparatus includes: an image data acquiring unit that acquires image data formed of plural pixel data having an M-ary (M≧3) gradation value; a grouping unit that divides the image data acquired into J (J≧2) image data areas and sections the J image data areas into K (2≦K≦J) groups; a pixel data selecting unit that selects, for each of the image data areas forming the respective groups, predetermined pixel data out of pixel data included in the image data area; an N-arization processing unit that applies the N-arization (M>N≧2) processing to the pixel data selected on the basis of a predetermined threshold value; and an error diffusing unit that diffuses a difference between a value of the selected pixel data and a value after the N-arization processing for the selected pixel data to pixel data not subjected to the N-arization processing, wherein the error diffusing unit diffuses the difference in directions different from one another in two or more groups of the K groups.
US07733530B2	Method and system for printing secure value documents and non-secure documents utilizing the same printing device A printing system for printing both secure value documents and non-secure documents while ensuring that fraudulent copies of secure value documents printed by the printing system can be detected is provided. The printing system determines if the source is a secure or non-secure source. If the source of the image is a secure source, it will print the image, including any graphic security features. If the source is a non-secure source, before printing the image a filter is applied to the image data to remove any graphic security features included in the received image and/or the printing system will not add any graphic security features to the received image to ensure that the printed image will not contain any copy detection graphic security features.
US07733528B2	Printing method for determining color loss in a color printer, and a management print medium A management label has a color loss determination area that enables easy determination of color loss. An identification color printing area 11 where an inventory control color for managing products and a color loss determination area 15 for determining color loss are printed on the label side 10a of an inventory management label 10. The color loss determination area 15 contains a color loss determination section 18 including the letters “NG” printed with a black coloring agent, and a background portion 19 that is printed using cyan, magenta, and yellow coloring agents. When there is no color loss and the letters “NG” and background portion 19 are printed normally, the letters “NG” and background portion 19 are both gray and the “NG” letters cannot be read. If one of the colors is lost, the printed colors change, the letters “NG” become discernable, and color loss can be easily determined.
US07733527B2	Image processing device, image output device, terminal device, and image forming system and computer readable medium storing program thereof An image processing device includes a separation unit that separates image information including a first image having plural color components and a second image having a specific color component and to be overlaid at least in part on the first image into a specific color component image of the same color component as the specific color component and an image with color components other than the specific color component among the plural color components; a color conversion unit that performs color conversion of the image with color components other than the specific color component, separated by the separation unit; and a combination unit that combines the color-converted image with color components other than the specific color component, converted by the color conversion unit, and the specific color component image separated by the separation unit.
US07733526B2	Method and apparatus for converting input color space into CMYK color space A method and apparatus for converting an input color space into a CMYK color space are provided. The method includes converting a color signal of a predetermined input color space into an sRGB color space, converting the color signal of the sRGB color space into an sRGB Lab* color space, and converting the color signal of the sRGB Lab* color space into a color signal of a printer-output CMYK color space (CMYKPrinter) using a lookup table.
US07733524B2	Monochromic image processing system and method for background removal according to dynamic data A monochromic image processing system and method for background removal according to dynamic data firstly obtain pixel histogram data in part of an image during a photo/text separation process. Afterwards, look-up tables for executing a background removal process are generated immediately to remove background noise of all images simultaneously. This method can solve the problem that in the multi-source document copy mode the background noise of all images cannot be removed at the same time in the prior art. It also increases the flexibility in the background removal process in various copy modes.
US07733522B2	Apparatus and method for optimized facsimile transmission The present invention is configured to provide optimization of printed output transmitted by a facsimile machine. By generating and comparing a baseline quality score with a companion quality score, optimization decisions can enhance the quality of facsimile transmissions. Optimization is also enhanced by recognizing the type of facsimile machine used and the optimal configuration settings for the facsimile. The settings for multiple facsimile machines are stored in a database, along with optimal settings for each facsimile machine. To further enhance the results of a facsimile transmission, a database of printers may also be consulted. By utilizing the best possible output from a printer, combined with the optimal settings for a fax machine, the optimal results for can be obtained. Additionally, the use of bar-coded identification for facsimile transmission provides a method of automating the optimization, thereby increasing efficiency by reporting the results of the optimization.
US07733515B2	Two-branch outputting solid-state imaging device, driving method for the same and imaging apparatus A solid-state imaging device is provided and includes: a semiconductor substrate; a plurality of photoelectric conversion elements arranged in a two-dimensional array, each of the photoelectric conversion elements accumulating a signal charge in accordance with a received amount of light; a charge transfer path that transfers the signal charge read out from the photoelectric conversion elements; two branch transfer paths, each receiving the signal charge transferred through the charge transfer path and transferring the signal charge to an output end of the solid-state imaging device; a charge branching part in a connecting portion between the charge transfer path and the two branch transfer paths, the charge branching part distributing the signal charge toward one of the two branch transfer paths, and a unit that treats signals corresponding to branching residual charges in the charge branching part so that the signals are distributed in a checkerboard pattern on a reproduced image.
US07733513B2	Image forming apparatus A first scanner unit and a second scanner unit simultaneously read the front surface and rear surface of a document, respectively, once stores the read image data in a first memory while adjusting the timing by a memory I/F, and then transfers the same to an ASIC. The image data is read out of the first memory and is inputted into an R channel and a B channel at an identical timing. The ASIC executes predetermined image processings and stores monochrome data on the front surface and rear surface of the document in a second memory through a PCI bus in parallel.
US07733511B2	Image processing system The invention provides an image processing system which can give different securities to data of respective receivers with a simple operation and, in this case, which can realize shortening of time for communication to a destination and suppression of use of memory resources. A plurality of regions preset in image data are related to destinations, code data constituting one of regions corresponding to the destinations or the other regions is replaced with code data which make pieces of information included in the regions invisible in the JPEG2000 file transmitted to the destinations, and the JPEG2000 file after the replacing process is transmitted to the destinations.
US07733501B2	Optical system of a microlithographic projection exposure apparatus In a method for improving imaging properties of an illumination system or a projection objective of a microlithographic projection exposure apparatus, which comprises an optical element having a surface, the shape of the surface is measured directly at various points. To this end, a measuring beam is directed on the points, and the reflected or refracted beam is measured, e.g. using an interferometer. Based on deviations of the measured shape from a target shape, corrective measures are derived so that the imaging errors of the optical system are improved. The corrective measures may comprise a change in the position or the shape of the optical element being analyzed, or another optical element of the optical system. The target shape of the surface may, for example, be determined so that the optical element at least partially corrects imaging errors caused by other optical elements.
US07733497B2	Method and apparatus for performing optical imaging using frequency-domain interferometry An apparatus and method are provided. In particular, at least one first electro-magnetic radiation may be provided to a sample and at least one second electro-magnetic radiation can be provided to a non-reflective reference. A frequency of the first and/or second radiations varies over time. An interference is detected between at least one third radiation associated with the first radiation and at least one fourth radiation associated with the second radiation. Alternatively, the first electro-magnetic radiation and/or second electro-magnetic radiation have a spectrum which changes over time. The spectrum may contain multiple frequencies at a particular time. In addition, it is possible to detect the interference signal between the third radiation and the fourth radiation in a first polarization state. Further, it may be preferable to detect a further interference signal between the third and fourth radiations in a second polarization state which is different from the first polarization state. The first and/or second electro-magnetic radiations may have a spectrum whose mean frequency changes substantially continuously over time at a tuning speed that is greater than 100 Tera Hertz per millisecond.
US07733488B1	Compact multi-wavelength optical reader and method of acquiring optical data on clustered assay samples using differing-wavelength light sources An optical reader having an array of differing-color light sources and a controller for controlling the light sources and acquisition of optical data. The light sources are arranged, and the controller is configured, to allow rapid acquisition of optical data regarding individual sample wells of a cluster of such wells. In some embodiments, multiple ones of the differing-color light sources are illuminated simultaneously for acquiring optical data on a corresponding number of sample wells. Depending on the configuration of the array and number of differing-color light sources illuminated simultaneously, the optical reader can acquire optical data for several wavelengths in a fraction of the time of conventional optical readers. Other embodiments include one or more non-contact temperature sensors for acquiring temperature data substantially simultaneously with the optical data. The temperature data can be used, for example, to adjust the optical data or warn a user of out-of-specification temperature conditions.
US07733477B2	Micro-cavity measuring equipment and method based on double optical fiber coupling A micro-cavity measuring equipment based on double optical fiber coupling includes a sight and transmitter, a controller, and a length measuring device. The equipment detects small changes in the position of an object with respect to a probe from a moment when the sight and transmitter starts working to another moment when the sight and transmitter stops working. The controller has a program to automatically control the whole measuring process. The measuring equipment is characterized in that the sight and transmitter consists of a laser unit, a data collecting and processing unit, and a double optical fiber coupling unit with its ends of incident and effluent optical fibers fixed on a coupler. A micro-cavity measuring method based on double optical fiber coupling consists of the following steps: inserting the probe into the micro-cavity and moving it in the measuring direction; sending signals to the length measuring device by the sight and transmitter to cause the length measuring device to record the corresponding position of the probe when the probe is contact with the sides of the micro-cavity; and then calculating the dimensions of the micro-cavity.
US07733476B2	Defect inspection apparatus and method The defect inspection apparatus and method for determining an acceptable condition of a reticle/mask member with a pattern area to be developed on a semiconductor device includes determining a non-pattern area and designating an inspection target area within a non-pattern area. Light is scanned across the inspection target area and detected to provide representative signals. The representative signals are processed to define the status of foreign matter including size and location and further compared with predetermined values to determine the acceptability of the mask for continued production purposes.
US07733475B2	Defect inspecting apparatus A defect inspecting apparatus of the invention solves a problem that in a defect inspecting apparatus, because of improving detection sensitivity of a microscopic defect by reducing a detection pixel size, a focal depth becomes shallow, a height of imaging is varied due to environmental change and the detection sensitivity of a defect becomes unstable. This apparatus comprises an XY stage, which carries a substrate to be inspected and scans in a predetermined direction, and a mechanism having a system of irradiating a defect on the inspected substrate at a slant and detecting the defect by a detection optical system disposed on the upper side, which corrects a height of imaging in real time for change in temperature and barometric pressure in order to keep the imaging in a best condition.
US07733474B2	Defect inspection system A defect inspection system can suppress an effect of light from a sample rough surface or a regular circuit pattern and increase a gain of light from a defect such as a foreign material to detect the defect on the sample surface with high sensitivity. When a lens with a large NA value is used, an oblique detection optics system receives the light from the defect at a reduced elevation angle with respect to the sample surface to reduce light from the sample rough surface, an oxide film rough bottom surface, and a circuit pattern, and increases the amount of the light from the defect and detected. The diameter of a lens is smaller than the diameter of a second lens, resulting in a reduction in the ability to focus the scattered light.
US07733467B2	Optical passive device product identification apparatus and connectivity determination apparatus An identification apparatus for identifying an optical passive device product. The apparatus includes an optical input output monitor section for monitoring an optical input and an optical output of the optical passive device product respectively; a loss calculation section for calculating a loss in the optical passive device product based on a monitoring result of the optical input output monitor section; and a product identification section in which product information indicating a correspondence between a loss characteristic and a product has been stored in advance, and which identifies the optical passive device product by comparing the stored product information and the loss calculated by the loss calculation section.
US07733459B2	Lithographic apparatus and device manufacturing method In a lithographic projection apparatus, a liquid supply system maintains liquid in a space between the projection system and the substrate. The liquid supply system may further include a de-mineralizing unit, a distillation unit, a de-hydrocarbonating unit, a UV radiation source, and/or a filter configured to purify the liquid. A gas content reduction device may be provided to reduce a gas content of the liquid. A chemical may be added to the liquid using an adding device to inhibit lifeform growth and components of the liquid supply system may be made of a material which is non-transparent to visible light such that growth of lifeforms may be reduced.
US07733458B2	Method for manufacturing an electro-optic device and electro-optic device, and article therefor To obtain truly flexible electro-optic films for image display or other related applications and to obtain a low cost solution for making electro-optic films, a new concept for manufacturing such films is disclosed. The method disclosed in this invention include mixing liquid crystal with “sponge particles” having fibril or porous surface morphology, coating such mixture directly on substrates with conductive electrodes and laminating with release liner or another substrate having conductive electrodes. The electro-optic films manufactured by using traditional R2R coating techniques. The electro-optic film manufactured by the method disclosed in the invention can be used for segment type, passive matrix type or active matrix type display applications or other related applications.
US07733443B2	LCD comprising backlight and reflective polarizer on front panel A liquid crystal display with a backlight is described. The liquid crystal cell comprising a front panel and a rear panel with polarizing means on each panel, and the front polarizing means includes a reflective polarizer and a dichroic polarizer.
US07733440B2	Liquid crystal display device An object of the present invention is to provide a liquid crystal display apparatus that can eliminate brightness nonuniformity by suitably diffusing light emitted from a light source. The liquid crystal display apparatus includes a liquid crystal panel providing a liquid crystal between a pair of substrates, the liquid crystal panel having an effective display area for displaying information, a sealing member placed around the liquid crystal in order to seal the liquid crystal between the pair of substrates, a light source for illuminating the liquid crystal panel from an edge thereof, and light diffusing means, provided between the pair of substrates, for diffusing the light introduced from the light source into the effective display area.
US07733435B2	Active matrix substrate, display apparatus, and pixel defect correction method An active matrix substrate comprises a TFT (4) in which a plurality of drain electrodes (16a and 16b) are provided for a single source electrode (6), and at least one of the drain electrodes is electrically connected to the pixel electrode (1) via the drain outgoing wire. The drain outgoing wire includes a first conductive pattern section comprising (i) a drain outgoing wire common section (7d) and drain outgoing branch sections (7a and 7b) each of which extends from said drain outgoing common section into each of said drain electrodes, and (ii) a correction connection electrode 9 which is partially overlapped with said branch sections of said first conductive pattern section via an insulating layer. The correction connection electrode 9 is electrically connectable to a plurality of said branch sections by being conducted to said branch sections through said insulating layer. This structure allows pixel defect correction within the pixel.
US07733431B2	Laser repair structure and method for TFT-LCD A laser repair structure and method for TFT panel. A first metal conductor is located in the source-drain layer and having a contact hole to the pixel electrode, and the region of the first metal conductor is within the region of the storage capacitance line. To repair a white defect of a pixel, make extending portions of the first metal conductor to overlap with the gate line of the previous pixel so as to electrically connect them by the laser irradiation. Another choice is setting two second metal conductors located in the gate-electrode layer and partially overlapped with the data line and the first conductor separately, then using laser irradiation to electrically connect one second metal conductor to repair the white defect of a pixel or electrically connect two second metal conductors to repair an open-circuited data line.
US07733429B2	Automatic convergence for image projection systems Systems and methods are provided that facilitate automatic convergence and geometry alignment in projection systems. Preferably, an optical element such as a lens array is coupled to all areas of the projection system's screen and to a detector element such as a photocell array. In operation, each lens of the lens array is adapted to map an individual portion or region of the screen onto the photocell array. A microprocessor, controller or the like uses the data output from the photocells to instruct an alignment controller to center or steer the beams to compensate for convergence error at a particular location. In a center alignment mode, four (4) or more beacon dots located about the periphery of the screen are detected to determine screen size and position, which is used to center the video image and the centers of the mapped regions on the screen.
US07733416B2	Compact mobile reconnaissance system The present invention provides a compact mobile reconnaissance device that is designed to be deployed in hostile, dangerous, or difficult to access environments, to absorb shocks, to be resistant to adverse environmental conditions, and to transmit video and audio streams related to events at which it has been deployed to a remote receiver and display unit.
US07733414B2	Photographic device and control method therefor There is disclosed a photographic device that uses an image sensor and an electronic viewfinder. When a release button is pressed halfway, an aperture value, an electronic shutter speed and a photosensitivity are decided based on the present subject brightness to provide a proper exposure value for photographing a still image. So long as the release button is kept being pressed halfway, a timing generator drives the image sensor to shoot video images at a frame rate of 20 Hz, and the aperture value decided for still image photography is fixed, whereas the electronic shutter speed and the photosensitivity are adjusted according to the subject brightness by use of an aperture-priority type video program. When the release button is pressed to the full, an exposure for a still image is done with the fixed aperture value.
US07733413B2	Imaging apparatus with auto-focus function An imaging apparatus includes an image pickup device that converts light from a subject to image data a drive section that drives the image pickup device, an auto-focus section that performs an auto-focus operation, and a focus control section that controls the auto-focus section to perform an auto-focus operation while controlling the drive section so that the image data is read from the image pickup device at a predetermined read out cycle suitable for displaying a through image, when the first determination section determines that the shutter button is pressed halfway, and that controls the auto-focus section to perform an auto-focus operation while controlling the drive section so that the image data is read from the image pickup device at a shorter read out cycle than the predetermined read out cycle, when the second determination section determines that the shutter button is fully pressed at once.
US07733409B2	Method for detecting objects in a digital image using image zones of different resolutions A method and system according to the invention comprises the means for or steps of: acquiring, by means of a digital image taking apparatus, a digital image with aberration of a scene, the digital image incorporating at least a first image zone and a second image zone, the first and second image zones having respectively at least a first resolution and at least a second resolution, the first and second resolutions being different, calculating a deployed digital image, by deployment of at least one zone of the digital image with aberration, applying an object detection algorithm in the deployed digital image, and supplying information on each object detected in the deployed digital image.
US07733402B2	CMOS image sensor having wide dynamic range A solid-state image sensing device includes a pixel unit, analog-to-digital converter, controller, and adder. In the pixel unit, cells are two-dimensionally arranged on a semiconductor substrate. An output analog signal from the pixel unit is converted into a digital signal by the analog-to-digital converter and output. The controller controls the pixel unit and analog-to-digital converter, and causes the analog-to-digital converter to digitize a plurality of analog signals different in storage time in the pixel unit during the storage period of the electric charge of one frame. The adder adds digital signals corresponding to the analog signals different in storage time and output from the analog-to-digital converter.
US07733399B2	Image sensing apparatus and method of acquiring traveling characteristics of light-shielding member A method of acquiring traveling characteristics of rear blades in a camera having an image sensing element including a plurality of pixels. The method comprising acquiring the traveling characteristics of the rear blades based on an image signal output from a preset partial area of the image sensing element, and storing the acquired traveling characteristics (S34, S36), shifting the partial area to a different position along the traveling direction of the rear blades (S38), and updating the traveling characteristics of the rear blades stored in the storage medium, based on an image signal output from the partial area shifted to the different position (S35, S36).
US07733393B2	Digital camera comprising smear removal function A horizontal evaluation data generation section calculates an average value of pixel signals in a vertical optical black region based on given pixel data in the horizontal optical black region and outputs the calculated average value to an evaluation section. A vertical evaluation data generation section calculates an average value of pixel signals in a vertical optical black region based on given pixel data in the vertical optical black region and outputs the calculated average value to the evaluation section. The evaluation section outputs a gain value according to the difference between the two sent average values to a computing section. A smear information memory stores pixel signals in a line in the vertical optical black region. The computing section multiplies the pixel data stored in the smear information memory by the sent gain value, and subtracts the multiplied pixel data from the pixel data imaged by the CCD 5.
US07733391B2	Method and system for black-level correction on digital image data The black level in raw image data captured from an image sensor does not always stay fixed at a constant level, but may change as a function of the analog gain and exposure time and may vary from one spatial location of the pixels to another. To carry out black-level correction on the raw image data, the black level of each of the color components is measured at one or more sampling locations. A look-up table is generated based on the measured black levels and a computation module is used to carry out black-level correction based on the information stored in the look-up table. The look up table may have information indicative of the analog gain level and the exposure time and the variations of black-levels in different spatial locations.
US07733378B2	Matching frame rates of a variable frame rate image signal with another image signal An image signal generation portion 10 generates an image signal DVb of a variable frame-rate picked-up image whose frame rate can be varied. A frame rate conversion portion 30 converts a frame rate of an image signal DVu supplied to it into a frame rate of the image signal DVb and synchronizes them to provide an image signal DVw. A monitor image signal generation portion 40 uses the image signals DVb and DVw to generate an image signal DVmix of an image in which an image based on the image signal DVb and an image based on the image signal DVw are mixed and output it as a monitor image signal DMTout or SMTout. Alternatively, it generates an image signal DVwp of an image in which a part of an image based on the image signal DVb is replaced by an image based on the image signal DVw and outputs it as the monitor image signal DMTout or SMTout. It is possible to simultaneously display a variable frame-rate picked-up image and an image having a different frame rate.
US07733374B2	Image pickup device and substrate mounting apparatus for an electronic part An image pickup device includes: a prism ii including light entrance holes (16, 16) and a light exit hole (17) for exiting incident light by refracting the incident light from the light entrance holes (16, 16) and; a lens (12) located on a light exit hole (17) side of the prism (11); a camera (13) located on an opposite side to the prism (11) with respect to the lens (12), and a base (14) that supports the prism (11), the lens (12), and the camera (13). The light exit hole (16) of the prism (11), the lens (12), and the camera (13) are arranged on the same optical axis (10). Any one or both of the prism (11) and the lens (12) and/or the lens (12) and the camera (13) are separated from each other.
US07733371B1	Digital security multimedia sensor A fully digital camera system provides high-resolution still image and streaming video signals via a network to a centralized, server supported security and surveillance system. The digital camera for collects an image from one or more image transducers, compressing the image and sending the compressed digital image signal to a receiving station over a digital network. A plurality of image transducers or sensors may be included in a single camera unit, providing array imaging such as full 360 degree panoramic imaging, universal or spherical imaging and field imaging by stacking or arranging the sensors in an array. The multiple images are then compressed and merged at the camera in the desired format to permit transmission of the least amount of data to accomplish the desired image transmission. The camera also employs, or connects to, a variety of sensors other than the traditional image sensor. Sensors for fire, smoke, sound, glass breakage, motion, panic buttons, and the like, may be embedded in or connected to the camera. Data captured by these sensors may be digitized, compressed, and networked to detect notable conditions. An internal microphone and associated signal processing system may be equipped with suitable signal processing algorithms for the purpose of detecting suitable acoustic events and their location. In addition, the camera is equipped with a pair of externally accessible terminals where an external sensor may be connected. In addition, the camera may be equipped with a short-range receiver that may detect the activation of a wireless ‘panic button’ carried by facility personnel. This ‘panic button’ may employ infrared, radio frequency (RF), ultrasonic, or other suitable methods to activate the camera's receiver.
US07733369B2	View handling in video surveillance systems A method of video processing may include analyzing input video information to determine if a current video frame is directed to a same view as a previous video frame; determining whether a new view is present; and indicating a need to use video processing information pertaining to the new view if a new view is determined to be present.
US07733362B2	Optical writing device and image forming apparatus A rotating deflection unit deflects a laser light emitted from a light-emitting element and performs a scanning with the laser light. A light-intensity detecting unit detects a light intensity of the laser light. A current control unit controls a current to be supplied to the light-emitting element so that the light intensity of the laser light reaches a target light intensity. An initializing unit determines an initial current value with which the target light intensity is obtained from the light-emitting element by eliminating an influence of a noise caused by a reflected light input into the light-intensity detecting unit from the rotating deflection unit.
US07733361B2	Printer cartridge unifying thermal ribbon and transfer medium and thermal transfer printer employing the same A thermal transfer printer having simpler structure, occupying less installation space, and enhancing the user convenience. The thermal transfer printer includes a cartridge having print paper wound in a roll, a capstan roller for conveying the print paper by applying frictional force on the print paper, a printing head for printing images on the print paper, and a platen roller for selectively pressing the print paper against the printing head. The housing of the cartridge has a first opening penetrating the housing and extending laterally. A paper roll case is rotatably installed in the housing and has a second opening penetrating the paper roll case and extending laterally. Inside the paper roll case, a paper roll is stuck on the inner surface of the paper roll case, and print paper is wound from the inner surface of the paper roll case to inward direction, while a first end of the print paper is exposed through the second opening.
US07733360B2	Line head and image forming apparatus incorporating the same In a line head, a plurality of element arrays arranged in a first direction. Each array includes a plurality of light emission elements arrayed in a second direction which is perpendicularly to the first direction. The light emission elements emit light for forming an electrostatic latent image on a photosensitive surface of an image carrier. A switcher activates the light emission elements in at least one of the element arrays while deactivating the others. A developer develops the latent image as a visible image with toner.
US07733356B2	Method for requesting and viewing an attachment image on a portable electronic device A method for viewing a full image of a server stored original attachment on a portable electronic device including: building a graph structure within the server representing a map of the original image, downloading and displaying a re-sized image from the server to the portable electronic device, the original image exceeding an image size limit of the portable electronic device indicative of screen size of the portable electronic device, calculating width and height parameters of the full image, sending a request from the portable electronic device to the server to enlarge the image displayed on the device based on the width and height parameters, the request including the image size limit, retrieving and traversing the graph structure within the server to locate a separate image component constructed for the image size limit, collecting image binary data from the separate image component and modifying the image binary data based on the width and height parameters to create the full image of the original image and downloading the full image of the original image to the portable electronic device.
US07733353B2	System and method for profiling digital-image input devices In a system and a method for profiling a digital-image input device, profiling of the digital-image input device is performed based at least on an image of a color chart and an estimated illumination of the color chart generated by comparing illumination of device-dependent coordinate values for the image of the color chart with illumination of device-independent coordinate values of the color chart. Because the estimated illumination of the color chart is performed on data pertaining to the color chart, the present invention may generate a profile without reference to data pertaining to scenery in the image outside of the color chart. Consequently, the present invention may generate a profile irrespective of the relative exposure of the color chart with respect to other scenery in the image.
US07733352B2	Efficient bump mapping using height maps A method for generating bump map data substantially in real time for use in a 3-dimensional computer graphics system. Data is received which defines an area to which a texture is to be applied. Texture data to apply to the area is also received. This data includes surface height data. A set of partially overlapping samples of texture data are then filtered and surface tangent vectors derived therefrom. A bump map surface normal is then derived from the tangent vectors.
US07733349B1	Device, method, and system for generating per-pixel light values using texture parameters A method for applying texture mapping in per-pixel operations includes receiving a plurality of parameters. The parameters define a pixel value at a pixel in a graphics primitive. From among these parameters, a set of parameters is selected to be associated with textures. The parameters that are not selected define a set of unselected parameters that have constant values over the primitive. A texture value is then determined for each of the selected parameters by accessing a set of textures, with the texture value for the selected parameters varying over the primitive. The pixel value at the pixel is then evaluated using the constant unselected parameters and the texture values for the selected parameters. A device and system for applying texture mapping in per-pixel operations also are described.
US07733347B2	Automated construction of shader programs Although GPUs have been harnessed to solve non-graphics problems, these solutions are not widespread because GPUs remain difficult to program. Instead, an interpreter simplifies the task of programming a GPU by providing language constructs such as a set of data types and operations that are more familiar to non-graphics programmers. The interpreter maps these familiar language constructs to the more difficult graphics programming resources such as DirectX®, OpenGL®, Cg®, and/or HLSL®.
US07733343B2	Virtual shadow for physical object placed on surface The placement of a physical object at a location on a surface is detected. A virtual shadow for the physical object is displayed at the location on the surface.
US07733342B2	Method of extracting 3D building information using shadow analysis Disclosed herein is a method of extracting three-dimensional building information using shadow analysis. In the method, an image of a building captured through a manmade satellite, an airplane or some other means, and metadata to be used for extraction of building information is received, the azimuth and altitude angles of a sun in an area of capture, and the azimuth and altitude angles of a camera are calculated. The contour of the roof of the building, the location and height of which are desired to be obtained, is extracted from the image. A height value is assigned to the extracted contour of the roof of the building, and the height value is adjusted until the assigned height value satisfies a predetermined condition. The vertical line and shadow of the building, which are based on the height value, is projected onto the image. The location of the building is extracted using the height value and vertical line of the building if the location of the projected shadow coincides with the location of the shadow of the building.
US07733340B1	Systems and methods for using a single tool for the creation and modification of solids and surfaces Systems and methods for creating and editing 3D solids and surfaces in an intuitive manner are described. A single tool infers the most-likely correct action based on its context to a particular geometry case. The tool predicts a user's intended modification, and performs the predicted modification without recording related history information. The method includes receiving a selection of at least one CAD object. The method also includes the tool automatically predicting the user's intended type of modification to the at least one CAD object based on the type of the at least one CAD object and the at least one CAD object's relationships with the geometry of at least one surrounding (or related) CAD object. The tool can perform multiple types of modifications, and the modification is selected from the multiple types of modifications, without explicit commands from the user directing the type of modification.
US07733338B2	Reduction of a mesh with preservation of flow lines To preserve flow line characteristics in a reduced mesh, the mesh is reduced by identifying one or more flow lines in the mesh and removing a plurality of edges associated with the one or more flow lines. Such a reduction may be achieved by identifying a set of connecting edges between adjacent flow lines, or between portions of adjacent flow lines, and contracting these connecting edges in one step. The set of connecting edges to contract in any given iteration may be identified based on the flow lines. A cost metric also may be used to decide which connecting edges are in the set to be contracted. In a first technique, a lowest cost edge is selected, and other connecting edges between the same adjacent flow lines are added to the set until a threshold condition is met. This threshold condition balances preservation of flow lines with preservation of attributes. In a second technique, several sets of connecting edges are identified. The set of connecting edges with the lowest cost is contracted in each iteration, and the cost of each set is updated after each iteration.
US07733336B2	Liquid crystal display device and method of driving the same A liquid crystal display device includes a liquid crystal panel, a backlight unit supplying light to the liquid crystal panel, a photo sensor detecting a brightness of an ambient surrounding the liquid crystal panel and generating a sense signal, and a signal processor adjusting a luminance of the light supplied by the backlight unit according to the sense signal.
US07733334B2	Hidden touch pad structure A hidden touch pad structure adapted for an electronic product has a plate, a touch pad arranged inside the plate, a circuit board disposed under and retained against the plate and the touch pad simultaneously, and a lighting device surrounding the touch pad and received inside the plate. The circuit board receives a pressure signal via the plate and the touch pad and drives the lighting device to provide light. The touch pad is recognized via the lighting device surrounding the touch pad.
US07733333B2	Shared electrode pattern field effect sensor and joystick therewith The present invention is directed to a shared electrode pattern field effect touch sensor apparatus. The apparatus includes first and second spaced electrode patterns, each having an inner electrode and an outer electrode. The inner electrode includes a primary portion defining a primary sense area and at least one secondary portion. Secondary portions of at least two patterns are adjacently disposed, and define secondary sense areas. A pulse generation circuit and a detection circuit are electrically coupled to each pattern. The presence of an object proximate a primary sense area activates one detection circuit. The presence of an object proximate a secondary sense area activates two detection circuits. A controller in communication with the detection circuits senses activation of the detection circuits. In a preferred embodiment, the apparatus is a navigational control device. A method of processing touch sensor field effect signals is also disclosed.
US07733327B2	Re-centering mechanism for an input device An input device includes a positioning element and a spring member. The positioning element comprises a generally disc shaped member. The spring member is a generally annular shaped spring member that is generally planar and that defines a generally serpentine pattern. The spring member is positioned laterally outward relative to the positioning element and is configured to exert a biasing force radially inwardly toward the positioning element.
US07733326B1	Combination mouse, pen-input and pen-computer device An apparatus that can be used as a mouse device and as a pen device. The apparatus has modular configuration. It has four types of units: a sensor unit, a processor unit, a mouse converter unit and a pen attachment unit. The sensor unit may use an optical arrangement for detecting relative motion. The sensor unit and processor unit are used in mouse and pen device configurations. Mouse converter unit is a mouse-shape enclosure useful mainly when apparatus is employed for mouse-input. Pen attachment unit is actively employed when the apparatus is used as a pen device, but it can be made compact to fit into mouse converter unit when the apparatus is used as a mouse device. The pen attachment unit connects the sensor unit with any pen-shaped object, selectively coupling the motion of the object with the sensor unit. When the apparatus is used as a pen-device, the processor unit can be conveniently worn on hand thereby making the device highly portable. As a pen device, the apparatus can be used in pen-input mode to provide real-time input to a host device. It can also be used as a pen computer whereby input is processed and stored offline for future synchronization with the host device.
US07733317B2	Image display apparatus and alternative current drive method A reliable image display apparatus is provided that is capable of preventing a direct current from being applied to liquid crystal of a spatial light modulating element so that damage such as burns in the liquid crystal and screen flicker may be prevented and a high resolution image with high image quality may be displayed. The image display apparatus is configured to divide a frame into 2i sub frames (i corresponding to a natural number) and sequentially display the sub frames using the liquid crystal spatial light modulating element. The image display apparatus includes a polarity switching unit configured to reverse the polarity of a drive voltage for a pixel of the spatial light modulating element for every j sub frame(s) (j corresponding to a natural number that is less than 2i) and for every n frame(s)(n corresponding to a natural number).
US07733315B2	Display device The invention provides an active matrix EL display device which can perform a clear multi-gray scale color display. In particular, the invention provides a large active matrix EL display device at low cost by a manufacturing method which can selectively form a pattern. Power supply lines in a pixel portion are arranged in matrix by the manufacturing method which can selectively form a pattern. Further, capacitance between wirings is reduced by providing a longer distance between adjacent wirings by the manufacturing method which can selectively form a pattern.
US07733314B2	Display device In a display device, a first image processor outputs a first pretilt gray scale in response to a first external image signal during a first pretilt period and a second image processor outputs a second pretilt gray scale higher than the first pretilt gray scale in response to a second external image signal during a second pretilt period. A gamma reference voltage generator outputs a gamma reference voltage. A data driver outputs a first pretilt voltage by converting the first pretilt gray scale into the first pretilt voltage and outputs a second pretilt voltage identical to the first pretilt voltage by converting the second pretilt gray scale into the second pretilt voltage.
US07733313B2	Picture quality controlling system A picture quality control system can determine a location of a display panel defect. The system can calculate data used to compensate for the display defect and modulate the compensation data on a video signal to compensate for the defect. The defect may be associated with a pixel or with a display panel area. A picture quality system may include a memory and a compensation circuit. The memory may store compensation data that represents a panel defect location and/or a charge characteristic. The compensation circuit may process the compensation data to increase or decrease brightness information and/or component information of a video signal.
US07733306B2	SRAM core cell for light-emitting display A SRAM core cell for a light-emitting display applicable to a data driver of an organic electro-luminescence light-emitting display device includes thin film transistors as a data memory for a data driver of the light-emitting display. The SRAM core cell also includes switching transistors and data memory transistors. The switching transistors are coupled to a bit line and a word line to select data writing or reading. The data memory transistors are coupled to a power voltage or a ground voltage to enable data writing and reading. The bit line and the word line are formed in first and second directions. The channels of the switching transistors and the data memory transistors are formed in an oblique direction with respect to the first and second directions.
US07733298B2	Display device In various embodiments, a display device can include a number of pixel cells and a number of receptor cells. Each receptor cell can be coupled to a group of pixel cells within the number of pixel cells, and each receptor cell can receive encoded pixel data and decode the encoded pixel data.
US07733297B2	Image display apparatus, three-dimensional image display apparatus, and three-dimensional image display system An image display apparatus includes: a light modulation device having an electro-optic effect in which a refractive index changes according to electric field intensity; a plurality of control points provided on a surface of the light modulation device; and an electric field control section configured to control voltage values to be applied to the plurality of control points, and to form electric field displacement surfaces having a predetermined image pattern in the light modulation device.
US07733295B2	Bi-directional communication system, display apparatus, base apparatus and bi-directional communication method A bi-directional communication system comprising a base apparatus and a display apparatus. The display apparatus is a portable liquid crystal display for viewing video programs and browsing the internet. The base apparatus contains a television tuner for receiving broadcast signals and wirelessly transmits programming to the display apparatus. An infrared remote control device connected to the base apparatus is used to control various external input devices (e.g., a VCR or DVD player). Control menus for the base apparatus and the external input device can be displayed on the display apparatus. The display apparatus contains a touch screen, so that a user can select operational commands for controlling the base apparatus and external input devices. The display apparatus wirelessly transmits selected operational commands to the base apparatus, which then retransmits the commands to the appropriate external input device using the infrared remote control device.
US07733294B2	Method and system for wireless transmission Multimedia from a source can be wirelessly transmitted in an infrared system to a display. To support rapid reads of data written into a slave at the display by a master at the source in accordance with I2C protocol, a master simulator on the display side continually polls the slave for changes, and maintains a shadow memory in a slave simulator at the source side current, so that reads from the master may be immediately executed from the shadow memory in the slave simulator without transmitting the wireless link.
US07733293B2	Antenna for remote controlled toy, antenna cap and remote controlled toy An antenna for a remote controlled toy comprises a conductor made of a metal wire and a cap portion anchored in an end of the conductor, wherein said conductor has a hook portion with a U-shaped end, a first flared portion articulated with said hook portion and provided crookedly for projecting in the perpendicular direction to said hook portion, a second flared portion articulated with the first flared portion and provided crookedly for projecting in the opposite direction from said first flared portion with regard to said hook portion, said cap portion has a T-shaped groove comprised of a horizontal groove housing said first flared portion and said second flared portion, a perpendicular groove housing said hook portion, and a hook locking part is provided inside the T-shaped groove.
US07733291B2	Antenna radial systems and related methods According to various aspects, exemplary embodiments are provided of antenna radial systems. In one exemplary embodiment, an antenna radial system generally includes a washer having a channel disposed along a first side of the washer. A radial includes a locking portion configured to be received within the channel. The radial also includes elongate portions extending outwardly from the locking portion such that an angle is defined between each elongate portion and the locking portion. A bushing cooperates with the washer for sandwiching the radial's locking portion therebetween to thereby help retain the radial's locking portion within the channel.
US07733289B2	Electromagnetic compression apparatus, methods, and systems Apparatus, methods, and systems provide electromagnetic compression. In some approaches the electromagnetic compression is achieved with metamaterials. In some approaches the electromagnetic compression defines an electromagnetic distance between first and second locations substantially greater than a physical distance between the first and second locations, and the first and second locations may be occupied by first and second structures (such as antennas) having an inter-structure coupling (such as a near-field coupling) that is a function of the electromagnetic distance. In some approaches the electromagnetic compression reduces the spatial extent of an antenna near field.
US07733287B2	Systems and methods for high frequency parallel transmissions A plurality of high-frequency beam-forming RF antenna arrays are used to enable parallel data transmission at multi-Gigabit per second data rates. In one embodiment, the 60 GHz band is used for parallel transmission of data from an antenna array printed on the substrate or packaging of an integrated circuit.
US07733282B2	Reflector antenna A reflector antenna includes a feed configured to always point during operation in a direction that opposes ingress of water into the feed, and a reflector having a truncated spherical reflecting surface, wherein a relative orientation of the reflector and the feed is adjustable. Another reflector antenna includes a feed configured to always point during operation in a direction that opposes ingress of water into the feed, and a reflector spaced apart from the feed by a focal length at least as great as a diameter of the reflector. Another reflector antenna includes a feed and a reflector having a truncated spherical reflecting surface, wherein the reflector is spaced apart from the feed by a focal length at least as great as a diameter of the reflector.
US07733281B2	Combined satellite and broadband access antennas using common infrastructure A method of installing multiple over-the-air antennas is disclosed. The method includes the steps of mounting a satellite antenna to a installation surface, such that the mounting allows the satellite antenna to be aimed at a satellite, attaching a broadband access antenna to one of the installation surface and a portion of the satellite antenna, such that the attaching allows the broadband access antenna to be aimed at a broadband access source, connecting first wiring from the broadband access antenna to a first downconverter and second wiring from the satellite antenna to a second downconverter, providing outputs of the first and second downconverters to a cable in communication with at least a satellite receiver and positioning, on at least a coarse scale, the satellite antenna and the broadband access antenna such that they are approximately pointed at the satellite and the broadband access source, respectively.
US07733279B2	Multi-band or wide-band antenna including driven and parasitic top-loading elements A monopole-type antenna (10) for multi- or wide-band use to transmit or receive radio frequency electromagnetic energy. A feed point (12) provides energy into the antenna or receives energy from the antenna. A driven radiating section (16) includes a first top-loading element (22) and a feed conductor (20) that electrically connects the feed point linearly to the first top-loading element, yet with the driven radiating section not electrically connected to a grounding surface (14). A parasitic radiating section (18) includes a second top-loading element (26) and a bridge conductor (24) that electrically connects the second top-loading element linearly to the grounding surface When energy is then provided at the feed point and conducted to the driven radiating section, it produces a first resonance mode, coupling at least some of the energy into and exciting the parasitic radiating section to produce a second resonance mode.
US07733273B2	Radio frequency identification tag antenna for attaching to metal An antenna includes a polyhedral dielectric material, a feed loop, a polygonal radiating patch, and shorting plates. The feed loop is electrically connected with a radio frequency identification (RFID) tag chip for supplying power to the RFID tag chip. The polygonal radiating patch is magnetically coupled with the feed loop for radiating the electromagnetic waves. Each of the shorting plates disconnects the radiating patch and a ground surface and controls the magnetic coupling of the radiating patch and the feed loop. Accordingly, an RFID tag that can be attached to a metal material is provided.
US07733272B2	Antenna apparatus and method for fabricating the same An antenna apparatus is disclosed that includes an element member made of sheet metal, a ground member made of sheet metal, and a connection part that is integrally formed with the element member and the ground member.
US07733271B2	Dual-band planar inverted-F antenna An improved and more compact structure of a built-in antenna for handheld terminals, improving radiation pattern and efficiency. Provided is a planar inverted-F antenna having a radiation part having an inductive radiation portion and a parasitic radiation portion which are spaced in a certain distance apart from a ground surface, a power-supply part horizontally spaced apart from the ground surface and for directly supplying currents to the connected inductive radiation portion, and connection parts for connecting the radiation portions to the ground. The planar inverted-F antenna has an inductive antenna portion and a parasitic antenna portion, thereby reducing its volume compared to the conventional inverted-F antenna. Complicated manufacturing and processing procedures are simplified by connecting the power-supplying part and a PCB.
US07733266B2	Control target recognition system and vehicle object detection system There is provided a system in which when a gate having a reflection level of a threshold or higher and having been recognized as a control target by last time is not recognized as the control target this time, the gate is assumed to be actually detected, and extrapolation device extrapolates the gate (see ◯) up to a predetermined number of times (five times), wherein when the gate is a stationary object, and a reflection level of the gate at the next detection (Time 6) predicted from a reflection level at the previous detection (Time 4) and a reflection level at the current detection (Time 5) is lower than a detection threshold (see □), the limit of the number of extrapolations by the extrapolation device is reduced from five to two. Thus, the number of extrapolations is reduced of the gate whose reflection level is suddenly reduced as a subject vehicle approaches and that is estimated not to be a control target, and unnecessary vehicle control for the gate can be prevented to eliminate discomfort of a driver.
US07733264B1	System and method for generating weather radar information A weather radar system can be utilized on-board an aircraft. The weather radar system includes processing electronics for sensing weather. The processing electronics is configured to utilize sensed weather data to generate a vertical weather prediction for a given altitude in response to a range and an azimuth. The system can also include a display. The display provides visual indicia of the vertical weather prediction in response to the processing electronics.
US07733256B2	Analog signal generator The present invention provides an analog signal generator capable of simultaneously improving both items of the influence of noise on a peripheral circuit and the settling time for a desired voltage level. A D/A converter to which the analog signal generator is applied, is configured as follows. A controller supplies a fixed value to data generation units, which respectively generate data according to clock signals and output the same to a buffer unit. The buffer unit temporarily holds the data therein. Control signals generated from the controller are supplied to a selection unit or selector, which decodes the control signals and thereby generates selection signals to turn ON/OFF the output of the data held in the buffer unit in response to the selection signals, after which the corresponding data is supplied to a filter unit, where an analog signal is generated based on the data supplied to the filter unit.
US07733255B2	Digital-to-analog converter with logarithmic selectable response and methods Embodiments of a digital-to-analog converter (DAC) with a logarithmic response and methods for converting digital signals to analog are generally described herein. Other embodiments may be described and claimed. In some embodiments, the DAC includes a wedge-shaped resistive array having a plurality of linearly-spaced contact nodes and a switching array to selectively couple one of the contact nodes with an analog output based on a control signal. Each of the contact nodes may provide a corresponding reference voltage that varies logarithmically with respect to the linearly-spaced contact nodes.
US07733250B1	Microcontroller having in-situ autocalibrated integrating analog-to-digital converter (IADC) A microcontroller has an integrating analog-to-digital converter (IADC) with an in-situ autocalibrating functionality. On-chip autocalibrating circuitry supplies a first predetermined analog input voltage to the IADC and obtains a first data value from the IADC. The autocalibrating circuitry supplies a second predetermined analog input voltage to the IADC and obtains a second data value. The first and second data values are used to calibrate the IADC such that if the first input voltage is later supplied to the IADC, then the IADC will output a first predetermined desired digital output value and such that if the second input voltage is later supplied to the IADC, then the IADC will output a second predetermined desired digital output value. The first and second analog input voltages are generated on-chip so the calibration is performed automatically without having to supply external calibrating signals to the microcontroller. Other related methods and circuitry is disclosed.
US07733249B2	Method and system of compressing and decompressing data The present invention relates to a data compression and decompression system and method for lossless compressing digital data. In one preferred embodiment, the method for handling a data stream having a number of data objects comprising a step of performing a compressing process on a data object based on a compression based value to obtain at least one compressed data result, wherein the data object is considered as one numerical value. The device for handling the data stream comprising a compression means for compressing the data objects according to a compression base value. In another preferred embodiment, the method for handling data having a number of data objects comprising a step of performing a compressing process on a data object by obtaining a compression code for the data object according to a compression coding table, wherein the data object is considered as one numerical value. The device for handling a data stream comprising a compression means for compressing the data objects according to a compression coding table.
US07733246B2	A/D converter for wideband digital communication Circuitry for providing non-uniform analog-to-digital (“A/D”) signal conversion for wideband signals is provided. The circuitry of the invention is optimized for wideband signals because it does not sacrifice the small-scale resolution of high-probability signal amplitudes while preventing the clipping of low-probability signal amplitudes. The circuitry includes a nonlinear amplifier and an A/D converter that may be uniform or non-uniform. The digital output of the A/D converter may be further processed by circuitry that has an output function that is the inverse of that of the nonlinear amplifier, so as to maintain linear A/D conversion.
US07733242B2	System, method and apparatus for manual control of a traffic light An application for a traffic control system includes an enclosure for containing the traffic control system that has an access door with a lock for controlling access to the enclosure through the access door. The traffic control system has an automatic mode of operation and a manual mode of operation, whereas the traffic control system automatically transitions a state of a plurality of traffic lights when in the automatic mode of operation and cycles the state of the plurality of traffic lights in response to a change signal when in the manual mode of operation. An automatic mode activation switch is housed within the enclosure. Activation of the automatic mode activation switch changes the state of the traffic control system from the automatic mode of operation into the manual mode of operation. A watchdog timer is coupled to the traffic control system, The watchdog timer is reset when the automatic mode activation switch is operated and in response to the change signal. If the watchdog timer expires, the traffic control system switches to the automatic mode of operation.
US07733240B2	System for configuring hardware in a downhole tool A system for loading a hardware configuration into downhole configurable hardware includes a surface control unit in communication with a downhole tool string component over a downhole network. The surface control unit initially has the hardware configuration and transmits it through the downhole network to the configurable hardware. The hardware configuration is implemented in the configurable hardware. The configurable hardware is preferably an FPGA.
US07733239B2	Distance determining system and method A distance determining system includes a first transceiver and a second transceiver spaced a distance from the first transceiver and inductively coupled thereto. The first transceiver outputs a first electromagnetic wave. The second transceiver receives the first electromagnetic wave and outputs a second electromagnetic wave, which is received by the first transceiver. One of the first and second transceivers determines a distance therebetween based at least in part upon the elapsed time of travel of the first and second electromagnetic waves. An air spring assembly can include such a distance indicating system. A method of determining a distance is also included.
US07733237B2	Signaling device and method of controlling the device Method for controlling a signalling device inserted in an automatism of gates (G), movable barriers, doors or the like, and having at least one warning device (L, BZ), characterized in that it supplies power from the signalling device (LL) to at least one mechanical group (M) having a motor, detects in the signalling device (LL) the absorbed power from the at least one mechanical group (M) having a motor, and activates the at least one warning device (L, BZ) when the predefined absorbed power threshold has been exceeded.
US07733229B2	Ultra wideband radio frequency identification techniques Ultra wideband (UWB) techniques are applied to radio frequency identification (RFID). For instance, a reader generates a UWB IR interrogation signal, and receives a UWB IR reply signal from an RFID tag in response to the interrogation signal. In addition, the reader may generate from the UWB IR reply signal a baseband response sequence. This sequence includes at least a tag identifier. A reader may store at least a tag identifier. Upon receipt of a UWB IR interrogation signal, the tag obtains a plurality of clock pulses from the UWB IR interrogation signal. Based on the plurality of clock pulses, the reader transmits at least the tag identifier in a UWB IR response signal.
US07733228B2	Wireless system to detect presence of child in a baby car seat A wireless system that detects the presence of a child in a safety seat located in the passenger cabin of a vehicle includes a controller responsive to signals generated by sensors monitoring predefined functions of the vehicle, RFID tag device attached to the safety seat and RFID tag reader mounted in the cabin. The system generates control signals which activate an alarm, open the doors of the vehicle and roll down windows if the child is left in the safety seat of an unattended vehicle.
US07733224B2	Mesh network personal emergency response appliance A monitoring system includes one or more wireless nodes forming a wireless mesh network; a user activity sensor including a wireless mesh transceiver adapted to communicate with the one or more wireless nodes using the wireless mesh network; and a digital monitoring agent coupled to the wireless transceiver through the wireless mesh network to request assistance from a third party based on the user activity sensor.
US07733221B2	Apparatus and method for wireless network parameter logging and reporting within a portable device having wireless communication functionality An apparatus for logging and reporting network parameters within a portable communication device that includes a processor and a wireless module that may communicate with a wireless network such as a wireless telephone network, for example, via a wireless connection. The wireless module may determine characteristic information associated with the wireless connection and may provide the characteristic information to the processor. The processor may format the characteristic information for transmission and then transmit the formatted characteristic information to the wireless network. In addition, the processor may store the characteristic information within the portable communication device for future aggregation and transmission.
US07733214B2	System and methods for the remote measurement of a person's biometric data in a controlled state by way of synchronized music, video and lyrics A method enabling a user with an electronic communication device to establish and stabilize his mental, emotional and physical condition in response to stimulation data and then using biometric sensors applied to the user to provide for remote/local gathering of standardized biometric data into a remote database coordinated with remote server software via an electronic network. The method includes initiating a session and selecting a session type by the user. The method also includes loading a track with the stimulation data, establishing links to the biometric sensors, setting the timing tolerances and biometric parameters based on new or existing user rules, stimulating the user with at least one of visual, audio, lyrics, text and vibration tracks to elicit stimulation data from the user, recording time stamps corresponding to key/tap input, deriving sync relationship between the user and the stimulation data, waiting for the variance and biometric parameters to stabilize and displaying a depiction of the stabilized condition on a screen.
US07733212B2	Resistor Embodiments of a resistor are disclosed.
US07733210B2	Magnetic field detector and manufacturing method thereof A magnetic field detector includes: a magnet; a detecting magnetic resistance element having a layer structure containing a ferromagnetic layer, the resistance being changed when a direction of magnetization of the ferromagnetic layer is changed; and a reference magnetic resistance element having substantially the same layer structure as that of the detecting magnetic resistance element. A magnetic field, the magnetic intensity of which is higher than the saturation magnetic field, is impressed by the magnet in a direction which is sensed by the ferromagnetic layer of the reference magnetic resistance element.
US07733208B2	High voltage pulse type transformer with increased coupling coefficient through primary and secondary winding proximity The present invention provides a high voltage, step-up, high current DC pulse type transformer with increased coupling coefficient between the primary and secondary windings through close proximity of the primary winding turns and secondary winding turns by means of transformer construction that provides a plurality of winding bays for a high voltage secondary winding physically located in close proximity to the primary winding. The plurality of winding bays for the secondary winding are provided by means of a frame and separate thin insulation layer where the thin insulation layer provides the barrel for all or part of the secondary winding. The invention significantly increases the transformer's coupling coefficient in high voltage step-up transformer applications where the transformer's core is pushed beyond saturation due to the high peak current typically found in capacitive discharge type circuits such as those used in electric fence controllers, strobe circuits, and high performance ignition systems for automobile, marine, or motorcycle engines.
US07733207B2	Vertically formed inductor and electronic device having the same Provided are an inductor, which is vertically formed, and an electronic device having the inductor, and more particularly, an inductor capable of minimizing loss of a surface area and accomplishing high efficiency impedance by vertically forming the inductor in a plurality of insulating layers, and an electronic device having the same. The inductor includes a plurality of conductive lines disposed in the insulating layers; and vias vertically formed in the insulating layers to electrically connect the plurality of conductive lines. When a board or an electronic device including an inductor proposed by the present invention is manufactured, the inductor can occupy a minimum area in the electronic device or board while providing high inductance. In particular, the surface area of the electronic device or board occupied by the inductor can be remarkably decreased to reduce manufacturing costs.
US07733205B2	Electrically decoupled integrated transformer having at least one grounded electric shield An integrated circuit, such as a radio frequency integrated circuit (RFIC), has a first layer bearing first metallization patterned for defining a first inductive coil, a second layer bearing second metallization patterned for defining a second inductive coil that overlies the first inductive coil and that is magnetically coupled to the first inductive coil through a third layer interposed between the first layer and the second layer. The third layer bears third metallization for defining an electric shield or electrostatic shield. The third metallization is patterned into a plurality of structures having shapes intended to minimize eddy currents. The electric shield is connected to further metallization that carries a ground potential. The third layer may further bear other metallization for coupling together at least two components of the integrated circuit. The integrated circuit may be fabricated by a CMOS process, and the first and second coils may be a primary coil and a secondary coil, respectively, of a radio frequency transformer. An additional electric shield may also be included, and in this case one electric shield can be coupled to a ground potential associated with the primary coil, and the second electric shield can be coupled to a ground potential associated with the secondary coil.
US07733201B2	Starter including electromagnetic switch with protective cover for protecting terminals According to the invention, a starter includes a motor and an electromagnetic switch. The electromagnetic switch includes a switch case, a movable contact, a fixed contact, a contact cover, an excitation coil, an excitation coil terminal, a motor terminal, and a protective cover. The excitation coil terminal has a first end, which is located inside the contact cover and electrically connected to the excitation coil, and a second end that protrudes outside the contact cover so as to be electrically connected to a power source. The motor terminal has a first end, which is located inside the contact cover and electrically connected to the fixed contact, and a second end that protrudes outside the contact cover and is electrically connected to the motor. The protective cover covers both the second end of the excitation coil terminal and the second end of the motor terminal, thereby protecting both the second ends.
US07733197B2	Duplexer and communications equipment A duplexer includes a piezoelectric substrate, a transmitting filter, and a receiving filter. A transmitting filter includes a ladder filter having a first resonator group which has one or more resonators in one or more series arms and one or more resonators in one or more parallel arms. A receiving filter has a passband higher than that of the transmitting filter, and includes a second resonator group which has one or more resonators in one or more series arms and one or more resonators in one or more parallel arms. A node connects both the transmitting filter and the receiving filter. The receive-side closest resonator closest to the node in the parallel arm is closer to the node than a resonator which is closest to the node in the series arm, and a resonance frequency of the receive-side closest resonator is lower than the passband of the transmitting filter.
US07733196B2	Antenna sharing device An antenna duplexer includes a piezoelectric substrate having a surface, a grounding terminal to be grounded, first and second surface acoustic wave (SAW) filters mounted on the piezoelectric substrate, first and second terminals connected to the first and second SAW filters, respectively, and a line mounted on the surface of the piezoelectric substrate between the first SAW filter and the second SAW filter. A stray coupling path is produced between the first and second terminals. A first end of the line is connected to the grounding terminal. A second end of the line opens and is coupled capacitively to the stray coupling path. The antenna duplexer has a large isolation characteristic between the surface acoustic wave filters.
US07733192B2	Voltage controlled oscillator According to one aspect of the present invention, there is provided a voltage controlled oscillator controlling frequency of an output signal according to input voltage, the voltage controlled oscillator including a current controlled oscillator setting the frequency of the output signal based on control current, and a voltage-current converter including a transistor controlling a current amount of the control current according to the input voltage, in which the voltage-current converter is supplied with control voltage, and threshold value voltage of the transistor is controlled according to the control voltage.
US07733187B2	High frequency power amplifier A small, high performance high frequency power amplifier enables easily adjusting and switching the impedance. The high frequency power amplifier module includes a first semiconductor chip including one or a plurality of high frequency amplification devices, and a second semiconductor chip including one or more high frequency matching circuit devices and one or more switching devices. The second semiconductor chip includes the matching circuit for a high frequency amplifier device. The second semiconductor chip also includes a circuit composed of a capacitance and a switching device connected in series or parallel to the capacitance. The switching device switches on or off so that the capacitance is connected or is not connected as a part of the matching circuit.
US07733185B2	Distributed amplifier and integrated circuit A plurality of transistors operate as amplification elements. An input side coupling circuit comprises a plurality of distributed constant lines connected in series, one terminal of which is an input terminal and the other terminal of which is a bias input terminal. Each of the connection nodes between these distributed constant lines is connected to each of the inputs of the transistors. An output side coupling circuit comprises a plurality of distributed constant lines connected in series, one terminal of which is an output terminal and the other terminal of which is a bias input terminal. Each of the connection nodes between these distributed constant lines is connected to each of the outputs of the transistors. A termination circuit is provided at the input side coupling circuit or the output side coupling circuit. The termination circuit comprises: a first resistor connected between the bias input terminal and a power supply; and a second resistor connected between this bias input terminal and the ground voltage. The resistance value of the first resistor is equal to or less than that of the second resistor.
US07733184B2	Circuit arrangement and method for power regulation and amplifier arrangement A circuit arrangement and method for power regulation and an amplifier arrangement for power regulation are described.
US07733170B2	Switching amplifier and its modulation process The present invention discloses a switching amplifier and its modulations process, which belongs to the field of non-filters-type switching amplifier. The switching amplifier comprises: pulse-width modulation with dual comparator, multiple-loop feedback structure, only one integrating amplifier with dual-ends output needed for each loop, no less than two feedback loops set between the integrating amplifier and H-bridge, in addition, no any low-pass filters needed adding to the feedback path. Multiple feedback loops are adopted in the present invention, which can low the distortion of the switching amplifier to the extent. Furthermore, no any extra low-pass filters are needed adding to the feedback path, which making the products a higher cost effectiveness.
US07733168B2	Fully differential comparator and fully differential amplifier A first to a fourth sampling switch (1a to 1d), a first to a fourth sampling capacitance (4 to 7), and a first and a second charge redistribution switch (2a, 2b) are provided on the input side of a differential amplifier (8). A first and a second reset switch (3a, 3b) are provided between inputs and outputs of the differential amplifier (8). A positive-polarity input signal voltage (Vinp), a negative-polarity comparison reference voltage (Vrefn), a positive-polarity comparison reference voltage (Vrefp), and a negative-polarity input signal voltage (Vinn) are applied via the first to fourth sampling switches (1a to 1d) to one ends of the first to fourth sampling capacitances (4 to 7), respectively. During a reset period, the reset of the differential amplifier (8) is released after sampling of the voltages. During a comparison period, the first and second charge redistribution switches (2a, 2b) are caused to be in a conduction state.
US07733167B2	System and method for common mode bias for high frequency buffers Methods and systems for reducing parasitic capacitance of a buffer for an electric circuit are disclosed and may include coupling a gate of a first transistor to a first differential input of the buffer via a first capacitor, coupling a gate of a second transistor to a second differential input of the buffer via a second capacitor. The first and second transistors may be biased by a common mode output of a direct current (DC) voltage source for the buffer. The common mode output of the DC voltage source may be directly coupled to at least one differential output of the buffer via an inductor. The first transistor and the second transistor may comprise NMOS transistors and/or PMOS transistors. The DC voltage source may comprise a PMOS transistor and/or an NMOS transistor.
US07733164B2	Semiconductor device with decoupling capacitance controlled and control method for the same In a semiconductor device, a monitoring circuit monitors and detects a quantity of noise in the semiconductor device. A control circuit has capacitances and controls connections to the capacitances such a decoupling capacitance value provided between a first power supply and a second power supply is dynamically adjusted based on the detected noise quantity.
US07733158B2	Trim fuse circuit capable of disposing trim conducting pads on scribe lines of wafer A trim fuse circuit includes a metal fuse, a trim pad coupled to the first end of the metal fuse, a first transistor coupled to the first end of the metal fuse, a second transistor coupled to the second end of the metal fuse, an inverter coupled to the second end of the metal fuse, a switch coupled to the second end of the metal fuse, and a common trim pad coupled to the control end of the switch. The inverter outputs a data signal according to the status of the metal fuse. The trim pad can be disposed on the scribe line of a wafer. When the trim pad is cut and accordingly connects to the substrate of the wafer, the data signal is not affected.
US07733157B2	Noise-reducing transistor arrangement Noise-reducing transistor arrangement having first and second field effect transistors (FETs) having source terminals coupled together, drain terminals coupled together, and control terminals for application of a first or second signal. A clock generator unit is configured to provide the first and second signals alternately to the FETs with an alternating frequency which is at least as great as the cut-off frequency of the noise characteristic of the FETs, or with a reciprocal alternating frequency which is less than a mean lifetime of an occupation state of a defect in the boundary region between channel region and gate insulating layer of the FETs. The first signal is applied to the control terminal of the first FET and, simultaneously, the second signal to the control terminal of the second FET. The second signal is applied to the control terminal of the first FET and, simultaneously, the first signal to the control terminal of the second FET.
US07733151B1	Operating clock generation system and method for audio applications A clock signal generator (1) includes a phase locked loop (PLL) circuit (25) which requires a reference clock signal of at least a predetermined first frequency (fDIGCLK). A first clock signal (REFCLK) of a second frequency (fREF) that is substantially lower than the first frequency (fDIGCLK) is multiplied so as to produce a second clock signal (DIGCLK) which has a frequency at least as high as the first frequency (fDIGCLK) and which is phase-locked with respect to the first clock signal (REFCLK). The second clock signal (DIGCLK) is applied to a reference signal input of the PLL circuit (25), which produces an output clock signal (PLLCLK or CLKOUT).
US07733149B2	Variable-length digitally-controlled delay chain with interpolation-based tuning A programmable delay element, variable-length delay chain, and ring oscillator are disclosed. The programmable delay element performs phase interpolation of input signals in response to a control signal and can be used in combination with other delay elements to create a highly-modular, variable-length delay chain or ring oscillator. The ring oscillator can be used as part of a digitally-controlled oscillator (DCO) in a digital clock synthesizer to adjust the frequency and phase of a clock signal by fractional unit delay steps. Optionally, the programmable delay element utilizes current-mode logic (CML) and the control signal is a thermometer coded digital signal. Within the variable-length delay chain, some programmable delay elements can be configured to scale the delay-step of other programmable delay elements so that a plurality of step sizes can be implemented with identical delay elements. Also, variations of the delay chain generate in-phase and quadrature phase (I/Q) signals in either an end-tap or center-tap configuration.
US07733147B2	Delay circuit of delay locked loop having single and dual delay lines and control method of the same A delay circuit in a delay locked loop includes a first delay circuit unit for delaying an input signal using a single delay line in response to first control signals and then outputting a first delay signal and a second delay signal, and a second delay circuit unit for delaying the first delay signal and the second delay signal by delay time, which is correspondent to second control signals and third control signals, using a dual delay line and then outputting a third delay signal and a fourth delay signal.
US07733141B2	Semiconductor device and operating method thereof A delay locked loop (DLL) of a semiconductor device has a relatively small area and low current consumption while having a function of correcting a duty ratio. The semiconductor device includes a split unit configured to receive and split a reference clock to output a first clock corresponding to a first edge of the reference clock and a second clock corresponding to a second edge, a voltage generation unit configured to generate a first voltage corresponding to a duty ratio of the first clock and a second voltage corresponding to a duty ratio of the second clock, a voltage comparison unit configured to compare levels of the first and second voltages with each other, and a clock delay unit configured to receive one of the first and second clocks to delay the received clock of which delay amount is determined in response to an output signal of the voltage comparison unit.
US07733136B2	Frequency synthesizer A frequency synthesizer includes: a fractional-N synthesizer configured to provide, in a locked condition, an output signal with an output frequency based on an input signal with a reference frequency, the fractional-N synthesizer including a charge pump outputting a current to be calibrated; a lock detector coupled to the fractional-N synthesizer to detect the locked condition, the lock detector being configured to send a first signal indicating the detection; a calibration component coupled to the lock detector and the fractional-N synthesizer, the calibration component being configured to provide a second signal to calibrate the current after receiving the first signal, based on a voltage sampled from the fractional-N synthesizer; and a current source array coupled to the calibration component and the fractional N synthesizer, the current source array being configured to calibrate the current based on the second signal.
US07733132B2	Bulk bias voltage level detector in semiconductor memory device There is provided a bulk bias voltage VBB level detector in a semiconductor memory device capable of improving tWR fail generated at a low temperature by compensating a temperature variance. The VBB level detector includes A bulk bias voltage level detector in a semiconductor memory device, comprising: a voltage divider for generating detection voltage based on an inputted bulk voltage; and a CMOS circuit for generating a output signal having predetermined logic value determined by the detection voltage wherein the voltage divider includes a first transistor having a gate coupled to a ground voltage and a second transistor having a gate coupled to an internal power voltage and a bulk coupled to the inputted bulk voltage.
US07733130B2	Skew tolerant communication between ratioed synchronous clocks A data communications system is disclosed. The data communications system comprises two clock domains. Each of the clock domains are coupled to receive a source clock signal. The first clock domain includes a first clock signal and the second clock domain includes a second clock signal, each of the first clock signal and the second clock signal are derived from the source clock signal. The first clock signal has a frequency which is different from that of the second clock signal. The system includes circuitry configured to generate a pulse indicative of when data transferred between the first clock domain and the second clock domain may be latched. Data is only latched when the pulse is asserted and on a given edge of the first clock signal, and the circuitry is configured to generate the pulse such that the given edge occurs at approximately a position corresponding to a middle of a period of the second clock signal.
US07733126B1	Negative voltage generation A first logic state is at a first output voltage level at a first output of a level shifter that selects a first negative regulation voltage level in response to the first logic state. A negative supply voltage begins at first potential and decreases to the first negative regulation voltage level. The first output voltage level decreases as the negative supply voltage decreases. The first output of the level shifter is switched from the first logic state to a second logic state in response to the negative supply voltage reaching the first negative regulation voltage level. The second logic state is provided at a second output voltage level that selects a second negative regulation voltage level for the negative regulation voltage. The first output of the level shifter remains at the second logic state but is reduced in voltage.
US07733125B2	Programmable logic device with embedded switch fabric The invention in the simplest form is a programmable logic device consisting of gate arrays, external I/O endpoints, and an embedded switch fabric configurable for connecting gates to gates, endpoints to endpoints and gates to endpoints. The architecture may employ a fabric interface of non-blocking crossbar switches for making complex bus connections of multiple devices to facilitate high speed processing.
US07733114B2	Test handler including gripper-type test contactor A test handler is provided for testing electronic devices having light-emitting elements. Electronic devices are mounted at a loading position, optical measurements are conducted at a test contact position where a testing device is located for optical communication with the light-emitting elements and then tested electronic devices are removed at an unloading position. Multiple test contactors hold the electronic devices and move them to and through the loading position, test contact position and unloading position in sequence. Each test contactor comprises a device contact point including electrical conductors which are connected to electrical contacts of the electronic device when the electronic device is mounted at the device contact point, and a retaining mechanism grips the electronic device at the device contact point such that the retaining mechanism does not obstruct the optical communication between the testing device and the light-emitting element at the test contact position.
US07733112B2	Semiconductor testing circuit and semiconductor testing method A semiconductor testing circuit of the present invention includes a signal line which is connected to a terminal not to be tested and a plurality of terminals to be tested of a semiconductor device; switch circuits for controlling electrical connection/disconnection between the signal line and the terminals to be tested; and a resistor connected to one end of the signal line. With this configuration, in a test on the AC characteristics of an input signal, a test signal generated by an LSI tester can be inputted to the terminals to be tested through the terminal not to be tested and the signal line by turning on the switch circuits.
US07733110B2	Parallel scan distributors and collectors and process of testing integrated circuits An integrated circuit (70) having parallel scan paths (824-842, 924-942) includes a pair or pairs of scan distributor (800,900) and scan collector (844,944) circuits. The scan paths apply stimulus test data to functional circuits (702) on the integrated circuit and receive response test data from the functional circuits. A scan distributor circuit (800) receives serial test data from a peripheral bond pad (802) and distributes it to each parallel scan path. A scan collector circuit (844) collects test data from the parallel scan paths and applies it to a peripheral bond pad (866). This enables more parallel scan paths of shorter length to connect to the functional circuits. The scan distributor and collector circuits can be respectively connected in series to provide parallel connections to more parallel scan paths. Additionally multiplexer circuits (886,890) can selectively connect pairs of scan distributor and collector circuits together. The scan distributor and collector circuits can be formed in core circuits (704). The core circuits then can be connected to other core circuits and functional circuits with simple connections to the parallel scan circuits through the scan distributor and collector circuits.
US07733109B2	Test structure for resistive open detection using voltage contrast inspection and related methods A test structure for resistive open detection using voltage contrast (VC) inspection and method for using such structure are disclosed. The test structure may include a comparator within the IC chip for comparing a resistance value of a resistive element under test to a reference resistance and outputting a result of the comparing that indicates whether the resistive open exists in the resistive element under test, wherein the result is detectable by the voltage contrast inspection.
US07733106B2	Apparatus and method of testing singulated dies An exemplary die carrier is disclosed. In some embodiments, the die carrier can hold a plurality of singulated dies while the dies are tested. The dies can be arranged on the carrier in a pattern that facilities testing the dies. The carrier can be configured to allow interchangeable interfaces to different testers to be attached to and detached from the carrier. The carrier can also be configured as a shipping container for the dies.
US07733098B2	Saturation detection circuits This invention generally relates to saturation detection circuits, in embodiments for substantially lossless detection of saturation of power switches in power integrated circuits. We describe a saturation detection circuit for detecting saturation of a power semiconductor device, the circuit including a said power semiconductor device having an input terminal and an output terminal, a second semiconductor device connected across said input and output terminals of the power semiconductor device, and a circuit responsive to a current flowing through the second semiconductor device to detect the saturation of the power semiconductor device.
US07733096B2	Methods of testing fuse elements for memory devices A method of testing a fuse element for a memory device is provided. A first test probe is electrically connected to a program terminal of the memory device. A second test probe is electrically connected to a ground terminal. The fuse element is on an electrical circuit path between the program terminal and the ground terminal. The first and second test probes are electrically connected to a testing device. A first voltage is applied with the testing device between the program terminal and the ground terminal. At least part of a first current of the first voltage flows across the fuse element. The first voltage and the at least part of the first current that flows across the fuse element is not large enough to change the conductivity state of the fuse element. The first current is measured and used to evaluated the conductive state of the fuse element.
US07733093B2	Method of and apparatus for measuring tensor resistivity An induction or propagation apparatus for performing measuring the tensor resistivity of a sample of matter includes a non-conductive, generally cylindrical tubular member adapted to receive the matter therein, a triaxial transmitter, at least one triaxial receiver, and an electronic module. The electronic module is adapted to energize the triaxial transmitter, control acquisition of signals by the at least one triaxial receiver, and perform anisotropic measurements and analysis. The triaxial transmitter and the at least one triaxial receiver are disposed on the generally cylindrical tubular member in axial spaced relationship.
US07733092B2	Magnetic field coil and magnetic resonance imaging apparatus Provided is an RF coil which can highly efficiently and uniformly irradiate a RF magnetic field having two or more magnetic resonance frequencies close to each other, and receive magnetic resonance signals of two or more magnetic resonance frequencies close to each other with high sensitivity and uniform sensitivity profile in an MRI apparatus. Two or more frequencies to which the coil is tuned are adjusted so as to be between resonance frequencies of series resonant circuits constituting the RF coil.
US07733090B2	Magnetic field generator There is provided a magnetic field generator which is capable of generating a uniform magnetic field of a desired intensity easily and stably without increasing running cost. The magnetic field generator includes a pair of plate yokes. The plate yokes have opposed surfaces provided with magnetic pole respectively. The magnetic pole includes a permanent magnet group whereas the magnetic pole includes a permanent magnet group. Each of the permanent magnet groups is formed substantially in a disc like shape, as an integral body made of a plurality of permanent magnets and a plurality of heat conducting members. Tubular heaters, buried in the plate yokes, generate heat, which is conducted via the plate yokes to each permanent magnet and each heat conducting member which constitute the permanent magnet groups.
US07733088B2	MRI system RF coil assembly with a birdcage transmit only coil and a pseudo-chain-link receive only coil array There is provided an RF (radio frequency) coil assembly of a magnetic resonance imaging (MRI) system, which comprises a birdcage transmit-only coil using inhomogeneous modes. Further, a multi-channel receive-only phased array coil is provided. In one embodiment, the multi-channel receive-only phased array coil may include a plurality of ring-shaped receive-only coils, wherein the receive-only coils are connected to each other in a pseudo-chain-link configuration to form a ring shape. The multi-channel receive-only phased array coil may be located inside said transmit-only coil and spaced a predetermined distance apart therefrom. In accordance with the embodiments, emphasis images of the peripheral part of a human brain with high resolution and high signal to noise ratio may be obtained.
US07733087B2	Sealed component for an MRI scanner having an actuator for active noise control Sealed components for an MRI scanner, in particular carrying RF coils and gradient coils have actuators for active noise control that are a part of an actuator module having holding segments fastened rigidly to the opposite ends of the actuator. The holding segments are fastened by screws onto two actuator receiving elements that are embedded at a spacing from one another in the sealing compound, and so that each fastening segment protrudes into a recess in the compound.
US07733085B2	Flangeless canister for in-line inspection tool An in-line inspection tool comprising a sensor suite, a processor processing the signal generated by at least one sensor of the sensor suite, and a canister housing the processor is disclosed. The canister may comprise a canister body formed as a hollow cylinder extending along a central axis from a first end to a second end. The canister may further comprise a canister lid inserted within the first end of the canister body. An alignment mechanism may prevent rotation of the canister lid with respect to the canister body about the central axis. A retaining ring may threadedly engage the first end of the canister body to maintain the canister lid within the first end of the canister body.
US07733083B2	Sensor-incorporated bearing assembly for wheels A sensor-incorporated wheel support bearing assembly including double rows of rolling elements interposed between respective raceways of outer and inner members opposed to each other, a to-be-detected ring having an eccentric or multangular outer diametric shape provided in the inner member and displacement sensors provided on the outer member confronting the to-be-detected ring. In the bearing assembly, the displacement sensors have facing portion areas, variable and invariable, respectively, arranged with rotation of the to-be-detected ring.
US07733082B2	Signal transmission device The invention provides a signal transmission device that transmits a signal applied to a pair of input terminals to a pair of output terminals insulated electrically from the pair of input terminals while reducing the influence of an external noise magnetic field. The signal transmission device has a pair of coils, a pair of magnetic sensors and a signal output section. Each of the coils is connected between the pair of input terminals. Each of the coils generates a magnetic field respectively in response to the input signal applied between the pair of input terminals. A direction of the magnetic field generated by one of the coils is opposite to a direction of the magnetic field generated by the other of the coils. Each of the magnetic sensors corresponds to one of the coils exclusively. Each of the magnetic sensors detects the magnetic field generated by the corresponding coil, and outputs a detection signal in response to the detected magnetic field. The signal output section outputs an output signal to the pair of output terminals. The output signal corresponds to a difference between the pair of detection signals outputted by the pair of magnetic sensors. In the difference, the signal component caused by an external noise magnetic field is canceled. On the other hand, in the difference, the signal component caused by the input signal applied between the pair of input terminals are doubled with respect to the input signal. Thereby, the signal output section outputs the output signal with high S/N ratio.
US07733081B2	Automated test equipment interface An automated test equipment interface system, e.g., for attaching a handler to a test head, includes a device interface board assembly. The device interface board assembly includes a stiffener frame having a frame body that is configured for attachment to a test head, alignment brackets connected to the frame body, and cam followers connected to the alignment brackets. The system also includes a docking device. The docking device includes a docking plate that is configured for attachment to a handler, pull-down ramps connected to the docking plate and movable between a retracted position and an extended position, an actuator operable to initiate movement of the pull-down ramps, and a coupling that translates movement of the actuator to corresponding movements of the pull-down ramps. The pull-down ramps can include cam surfaces that are configured to engage the cam followers of the device interface board assembly during movement between the retracted and extended positions to pull the device interface board assembly towards the docking plate.
US07733079B2	Clock distribution circuit and test method A clock distribution circuit having plural stages of buffers disposed along branch paths for dividing up a clock signal and configured in a manner that outputs of a plurality of buffers in a final stage and/or a middle stage are short-circuited, includes in relation to at least one buffer of a plurality of buffers in the same stage on a branch path, a selector for receiving an output of an adjacent buffer located upstream in terms of chain-connection along which the plurality of buffers are connected in testing, and a signal at a branch node corresponding to the at least one buffer by a first input and a second input respectively, selecting one of the first input and the second input based on a select control signal, and supplying the selected input to the one buffer.
US07733075B1	Voltage sensing in a supply regulator for a suspend mode A voltage regulator for supplying power to volatile memory cells during a suspend mode of an integrated circuit is described. The integrated circuit in an awake mode generates a regulated voltage at an output node using a first supply voltage and in the suspend mode generates the regulated voltage at the output node using a second supply voltage, at less voltage than the first supply voltage. The second supply voltage is electrically decoupled from the output node for transitioning from the suspend mode to the awake mode, and the first supply voltage is electrically decoupled from the output node for transitioning from the awake mode to the suspend mode.
US07733071B2	Device for smoothing the load current supplied to a load The invention relates to smoothing a consumer electrical circuit supplied by a controllable current sink connected in parallel to the consumer. For this purpose, measuring voltage proportional to a load current supplied to the consumer is derived therefrom. A pick value measuring device makes it possible to determine a maximum value thereof. The difference between the maximum value and measuring voltage makes it possible to control the voltage-controlled current sink in such a way that the sum of a compensation current supplied by the current sink and the load current which runs by the consumer is substantially constant.
US07733070B2	Multi-output type DC/DC converter A multi-output type DC/DC converter including: a reactor connected to a direct-current power supply; a first switching circuit to apply a current to the reactor; a second switching to switch an output from the reactor to any one of output terminals; output voltage detection units to detect voltages of the output terminals; comparison circuits to compare outputs of the output voltage detection units with a waveform signal of a predetermined frequency; and an output selection unit to receive outputs of the comparison circuits as inputs, the output selection unit selecting an output of a comparison circuit, the output having an earlier rise or an earlier fall, to generate a plurality of control signals pertaining to on and off of the first switching circuit and/or the second switching circuit, the output selection unit treating the plurality of control signals in accordance with a predetermined priority order when the outputs of the plurality of comparison circuits change almost at the same time, wherein a current generated by a discharge of energy accumulated in the reactor is output to any one of the output terminals in accordance with the control signals generated by the output selection unit.
US07733069B2	Power converting apparatus and power generating apparatus AC module makers must prepare two types of AC modules for the 100-V and 200-V outputs only for domestic supply. For foreign countries, the makers must manufacture AC modules compatible with more system voltages. To solve these problems, the control circuit of an AC module controls the operation of an inverter circuit and/or the transformation ratio of a transforming circuit, and ON/OFF-controls a switch on the basis of the system voltage and connection state of an electric power system.
US07733065B2	Cooling system of battery pack for vehicle Disclosed herein is a cooling system for vehicle battery packs, which is constructed such that an intake duct for introducing a coolant, such as air, which cools a battery pack, into the battery pack from a predetermined region is not included, air existing inside a vehicle at a region around a battery pack isolated from a cabin of the vehicle is directly introduced into the battery pack, and the air having passed through the battery pack, which has been heated, is discharged through an exhaust duct connected to an internal space of the vehicle, in which a possibility of air to be recirculated to the region around the battery pack is low. The battery pack cooling system according to the present invention uses air existing inside the vehicle. Consequently, the control of temperature and humidity is easier than when external air is used, and generation of noise and backward flow of flames and toxic gas generated during a fire, which are problems caused when the air in the cabin is used, are prevented. Furthermore, it is possible to increase the cooling efficiency of the battery pack without the provision of the intake duct for introducing air into the battery pack.
US07733063B2	Apparatus for calculating quantity indicating charged state of on-vehicle battery An apparatus is provided to calculate a quantity indicating a charged state of an on-vehicle battery. The battery powers a starter starting up an on-vehicle engine. In the apparatus, a plurality of pairs of data consisting of current and voltage of the battery are acquired at predetermined sampling intervals during a cranking period of the engine in response to starting up the starter. At intervals, a value of an internal resistance of the battery is calculated based on the plurality of pairs of data of current and voltage. The internal resistance is one kind of the charged-state indicating quantity. An open voltage difference is calculated, which is a difference between a pseudo circuit-open voltage of the battery given before starting up the starter and a pseudo circuit-open voltage of the battery given after the cranking period. The value of the internal resistance is corrected using the open voltage difference.
US07733060B2	Charging IC, charging apparatus and electronic device The present invention relates to charging of rechargeable batteries built into electronic devices and is configured to constrain heat generation during the charging. A charging IC used for charging a rechargeable battery built into an electronic device is disclosed that comprises a power source unit which can be fed with power from an external power source with a drooping characteristic to pick up a constant current; and a control unit which applies a first constant current from the external power source to the rechargeable battery through a circuit element installed on a charging path of the rechargeable battery, the control unit applying a second constant current smaller than the first constant current from the power source unit to the rechargeable battery after the rechargeable battery is charged with the first constant current to a predetermined voltage.
US07733051B2	Model-based active electronic damping for stepper motors A method for damping vibrations in a stepper motor with micro-stepping control which comprises the steps of identifying the force amplitudes and phase shifts of multiple harmonic detent torques of the stepper motor, such as the first, second and fourth harmonic detent torques, and tuning the stepper motor with different current commands until minimum friction and resistive torque are obtained. Thereafter, a compensating harmonic current derived from said force amplitudes and phase shifts of the said multiple harmonic detent torques is injected into a current command during operation of the stepper motor to compensate for torque ripples.
US07733046B2	Motor controller and control method thereof A motor controller including a position control section that generates a speed command based on a position command and a motor position, a speed control section that generates a torque command based on the speed command and a motor speed, and a motor driving section that generates a motor current based on the torque command. The motor controller has a speed feed forward command generating section that generates a speed feed forward command by differentiating the position command. A model control section generates a model torque command based on the speed feed forward command and a model speed. An inertia identifying section identifies inertia based on the ratio of an integrated value of a motor torque command obtained by time-integrating the motor torque command in a prescribed section to an integrated value of the model torque command obtained by time-integrating the model torque command in a prescribed section, from a prescribed position command.
US07733044B2	IPM motor system and control method thereof An IPM (Interior Permanent Magnet) motor system is provided with an IPM motor provided with a stator having slots and a rotor having poles, and a control unit which controls the rotor to the stator. An estimation precision of an initial angle position of the rotor to the stator is selected such that it is substantially the same as an angle unit precision of stable positions of the rotor to the stator which is based on a combination of the number of poles and the number of slots. In this way, the cheap IPM motor system with a high drive efficiency and a control method of the IPM motor system are provided.
US07733043B2	Revolving door control system In a method and system for controlling a revolving door that has a plurality of chambers defined by wings of a revolver, at least one imaging sensor is provided for acquiring images of a first area where the plurality of chambers rotatably pass by or through. A drive causes the revolver to rotate in a first direction from a first position where a user can enter a first chamber via the first opening. Images are acquired by the one imaging sensor and signals are acquired from a position sensor that is operative for outputting signals indicative of the angular position of the revolver. Based on the signals acquired from the position sensor, each imaging sensor or its output is disabled and/or each image acquired by each imaging sensor is ignored when each door wing is in field-of-view of the imaging sensor.
US07733042B2	Rotor position detection circuit and motor driving device A rotor position detection circuit detects a position of a rotor in a motor from a detection signal of an induced voltage generated in a stator coil. The circuit includes: a first low pass filter having a first reference potential for filtering the detection signal; a comparator for comparing an output signal from the first low pass filter with a predetermined reference voltage and for outputting a rotation position signal; and a second low pass filter having a second reference potential for filtering a virtual neutral point potential of the motor. The first reference potential is the filtered virtual neutral point potential, and the second reference potential is a ground.
US07733041B2	Method and device for driving rotating-body, process cartridge, image forming apparatus, and computer program product A plurality of detection target portions are arranged around a rotating shaft of a rotating-body, one of which causes a detector to generate a first detection signal different from a second detection signal generated from the others. A first generating unit generates a reference signal indicating a reference rotational-position of the rotation-driving source or the rotating-body before one rotation from a timing of the first detection signal. A second generating unit reads periodic variation information from a storage unit based on the reference signal, and generates a rotation-velocity correction signal for the rotation-driving source.
US07733032B2	OLED driver and lighting apparatus equipped with the same An OLED driver for driving at least one organic electroluminescence element and lighting apparatus equipped with the driver. The driver has a direct-current power source and a dimmer. The source alternately applies first voltage and second voltage across the element. The first voltage is approximately equal to drive voltage of the element. The second voltage is lower than the first voltage and higher than barrier voltage of the element. The dimmer controls the source so as to change a ratio of a first term to a second term to dimm the element. The first term is a period of time for which the first voltage is applied across the element. The second term is a period of time for which the second voltage is applied across the element.
US07733030B2	Switching power converter with controlled startup mechanism A switching power converter with a controlled startup mechanism includes a switching stage which provides a voltage Vout at an output node in response to a switching control signal, with the output node adapted for connection to a non-linear load. A feedback network compares a signal which varies with the current conducted by the load (Iload) with a reference signal, and provides the switching control signal so as to maintain Iload at a desired value. A capacitor connected to the output node provides a current Ic to the feedback network which varies with dVout/dt. The feedback network is arranged to limit dVout/dt in response to current Ic when Iload is substantially zero. In this way, large inrush currents or damage that might otherwise occur during startup are avoided.
US07733025B2	Plasma display panel A plasma display panel (PDP) is disclosed in which a film type filter is coupled with a panel. The PDP includes the panel, a transparent conductive film and a metal film formed on the transparent conductive film, and further includes the film type filter coupled with the panel. Accordingly, electromagnetic waves can be effectively shielded and the optical transmittance of the filter can be improved.
US07733023B2	Process for the production of plasma displays with distributed getter material and displays thus obtained A manufacturing process for the production of plasma display panels is provided which allows obtaining in a simple way displays in which getter materials deposits are present in contact with the atmosphere present in channels or cells of the display. The process includes a step of forming the getter material deposits on a free surface of the magnesium oxide layer at positions essentially corresponding to contact areas between the front glass panel and the barriers on the rear glass panel of the display panel.
US07733017B2	Display apparatus with replaceable electroluminescent element An electroluminescent apparatus utilizes a replaceable electroluminescent element which is compressed between two electrodes that are positioned within a resealable housing which may be opened and closed so that a used electroluminescent element may be removed from between the electrodes and replaced at the end of its usable lifetime. The housing has front and rear panels associated with the respective electrodes, at least one of the panels being transparent. The apparatus may include an inflatable compressing structure, an alignment structure within the housing for alignment of the electroluminescent sheet, or transparent electrodes, and various drivers may be used allowing for monochrome or color displays. The housing may have an envelope configuration, or the electroluminescent element can have a configuration of a roll of sequential electroluminescent sheets or a tiled structure allowing for larger electroluminescent displays, within the scope of the present invention.
US07733016B2	Defining electrode regions of electroluminescent panel An electroluminescent panel includes a partial electroluminescent panel base, a layer of electrically isolated conductive areas next to the partial electroluminescent panel base, and an activatable conductive layer next to the layer of electrically isolated conductive areas. The activatable conductive layer is selectively activated to electrically connect selected electrically isolated conductive areas together to define one or more electrically isolated conductive electrode regions.
US07733014B2	Organic electro-luminescence diode An organic electro-luminescence diode comprises two electrodes and an organic electro-luminescence structure. The organic electro-luminescence structure is formed between the two electrodes, and includes a red light-generating unit, a green light-generating unit, a blue light-generating unit and a light-compensating unit stacked with each other. The light-compensating unit is selected from the group consisting of a white light-compensating unit, a red light-compensating unit, a green light-compensating unit, a blue light-compensating unit and a structure stacking together one light-compensating unit upon the other.
US07733011B2	Organic light-emitting diode with relief patterns The invention relates to an organic light-emitting diode comprising on a substrate, from the rear face to the front face, at least one rear electrode of a first type surmounted by an organic light-emitting layer, itself surmounted by at least one front electrode of a second type, the organic light-emitting layer producing light when holes and electrons are injected into it by a current flowing through the electrodes, the types corresponding to an anode and a cathode, at least one of the electrodes being substantially transparent for the produced light in order to allow it to escape through one of the faces of said diode, referred to as the exit face. According to the invention, said substantially transparent electrode comprises at least one transparent extraction zone and at least one reflective zone adapted to return the produced light through the light-emitting layer, and said diode also comprises reflector means which are arranged on the opposite side of said substantially transparent electrode from the organic light-emitting layer and are adapted to return the produced light to said substantially transparent electrode through the light-emitting layer. The diode may be configured by embossing, and various embodiments are described.
US07733010B2	Organic electroluminescent device and its method of manufacture An organic electroluminescent device includes: a substrate; a plurality of first electrodes arranged on the substrate; a plurality of banks arranged on the substrate and the first electrodes to define pixels on the first electrodes, the plurality of banks being of an inorganic material; a plurality of separators arranged in stripe shapes on the plurality of banks between the pixels, the plurality of separators being of an organic material; organic Emitting Material Layers (organic EMLs), each having a predetermined color, the organic EMLs being arranged within each of the pixels; and a plurality of second electrodes arranged on the organic EMLs, the plurality of banks, and the plurality of separators.
US07733004B2	Field emission display device for uniform dispersion of electrons A field emission device (FED) includes a top substrate having an anode electrode and a phosphor layer, a lower substrate, at least one cathode electrode having an opening-pattern with at least one opening, an insulating layer located on the cathode electrode, a gate layer located on the insulating layer, and an electron emitter located in the opening of the cathode electrode. The electron emitter is adjacent to the cathode electrode and is electrically connected therewith. The cathode electrode having the opening-pattern is located on a bottom panel. Through the structure illustrated above, uniformity of emitting electron density can be improved and brightness and contrast of color for the FED can be enhanced.
US07733002B2	Semiconductor light emitting device provided with an alkaline earth metal boric halide phosphor for luminescence conversion A light emitting device is provided that has a semiconductor light emitting element and a phosphor which converts a part of the luminescence spectrum emitted from the semiconductor light emitting element. The luminescence spectrum of the semiconductor light emitting element is located between a near ultraviolet region and a short-wavelength visible region, and the phosphor is made by adding a red luminescent activator to a base material of a blue luminescent phosphor. Thereby, improving the color shading generated by the dispersion of the spectra of the light emitting elements and obtaining the light emitting device having a high brightness and a good color rendering properties. With the light emitting device, it is possible to provide the light sources for the lighting apparatus of medical treatments, the flash plate of a copying machine, etc., in which a good color rendering property is required.
US07733001B2	Light source device To devise a light source device with a low price and from which a sufficient amount of light can be obtained, in a light source device having a reflector and a discharge lamp, a hermetically sealed portion of the lamp is directly joined to a part of a neck region of the reflector with a processed portion being formed for setting the positional relationship between the lamp and reflector.
US07732999B2	Direct acting capacitive transducer A capacitive transducer having a significantly increased actuation force and improved response time as compared to similar prior art capacitive transducers. In the capacitive transducer of the present invention it is not necessary to balance response time and actuation force or to provide pre-strain to the transducer in a direction of actuation. Additionally, buckling in the capacitive transducer is prevented, or at least substantially reduced, in a simple manner.
US07732990B2	Piezoelectric driven MEMS device A MEMS device includes: a first actuator having a first fixed end, including a stacked structure of a first lower electrode, a first piezoelectric film, and a first upper electrode, and being able to be operated by applying voltages to the first lower electrode and the first upper electrode; a second actuator having a second fixed end, being disposed in parallel with the first actuator, including a stacked structure of a second lower electrode, a second piezoelectric film, and a second upper electrode, and being able to be operated by applying voltages to the second lower electrode and the second upper electrode; and an electric circuit element having a first action part connected to the first actuator and a second action part connected to the second actuator.
US07732988B2	Fluid amplifiers and vibration damping and isolation systems Fluid amplifiers and vibration damping and isolation systems are provided. A fluid amplifier includes a housing assembly, a piezo-electric element, two amplification stages, and a rod. The piezo-electric element is disposed within the housing assembly and is capable of being energized to lengthen axially to provide an input stroke at an initial magnitude. The first amplification stage is disposed within the housing assembly adjacent to the piezo-electric element and is adapted to amplify the input stroke from the piezo-electric element to a first magnitude. The second amplification stage is disposed in series with the first amplification stage and is adapted to increase the input stroke from the first magnitude to a second magnitude that is greater than the first magnitude to yield an amplified input stroke. The rod extends through the second amplification stage and is coupled thereto to transmit the amplified input stroke having the second magnitude.
US07732984B2	Piezoelectric actuator, method of manufacturing piezoelectric actuator, and liquid ejection head The piezoelectric actuator comprises: a substrate; a constraint force buffering layer which is formed on the substrate and made of a hardness control material having low hardness; and a piezoelectric element which is formed directly on the constraint force buffering layer.
US07732982B2	Driving device capable of reducing height thereof A driving device includes an electro-mechanical transducer having first and second end portions opposite to each other in an expansion/contraction direction, a stationary member coupled to the first end portion of the electro-mechanical transducer, a vibration friction portion mounted to the second end portion of the electro-mechanical transducer, and a rod-shaped moving portion frictionally coupled to the vibration friction portion, whereby moving the moving portion in the expansion/contraction direction of the electro-mechanical transducer. A frictionally coupled portion has a height (a length of the vibration friction portion in a sliding direction in contact with the moving portion) which is not more than 1.15 mm.
US07732981B2	Ultrasonic motor having lightweight vibrating element An ultrasonic motor includes a vibrating element having a piezoelectric body attached thereto to produce a traveling wave when the piezoelectric body is supplied with an electric power, and a contacting element to come in friction contact with the vibrating element when the vibrating element is vibrated by the traveling wave. The vibrating element is formed of a Mg-based alloy having a Mg content of more than 85% by weight.
US07732980B2	Electromechanical conversion element, vibration actuator, vibration actuator driving device, lens barrel and camera To provide an electromechanical conversion element, a vibration actuator, a vibration actuator driving device, a lens barrel and a camera, which facilitate the achievement of the desired drive characteristics. An electromechanical conversion element comprising: a piezoelectric body having a polarization part polarized in a certain direction; and a plurality of separately formed electrodes on a continuous region of the polarization part.
US07732978B2	Piezoelectric element driving circuit and pump device A piezoelectric element driving circuit includes: a transformer; a switch circuit; a reactance element connected in parallel with the piezoelectric element on one of the primary side and the secondary side of the transformer, the reactance element forming a resonant circuit that performs parallel resonance at the driving frequency with a capacitance component in an equivalent circuit of the piezoelectric element and an inductance component of the transformer; a pulse generating circuit for generating a driving pulse for the switch circuit; and a duty ratio controlling circuit for being supplied with the driving pulse, limiting a duty ratio of the driving pulse such that a value of the driving voltage falls within a range equal to or lower than the specification voltage value on the load side, and outputting the driving pulse whose duty ratio is limited to the switch circuit.
US07732974B1	Electrostatic power generator cell and method of manufacture Electrostatic power generator cell architectures having high generator output and a method of manufacture. In one embodiment, parasitic capacitances are reduced by reducing overlap between walls of the chamber and electrodes of the generator cell. In another embodiment, generator component materials are selected to reduce triboelectric effects to improve the coupling of kinetic energy to electrical output, thereby increasing generator output. In a further embodiment, the high permittivity material is selected to increase the modulation of the variable capacitors in the power generator to increase generator output. In still another embodiment, the physical dimensions of the generator cell components are reduced to increase power density. In an additional embodiment, a physical dimension of the generator chamber is based on the dominant motion the generator will be exposed to in a particular application.
US07732972B2	Electrical machine including axial connector assemblies and related methods An electrical machine may include a plurality of stator coil ends each having a fluid passageway therein. The electrical machine may further include a plurality of rings and a plurality of axial connector assemblies for connecting the plurality of stator coil ends to the plurality of rings. Each axial connector assembly may include a header cap including an open end received on a respective stator coil end and a closed end opposite the open end, the closed end defining a coil spherical connector portion. The header cap may have a fluid port therein coupled to the fluid passageway of the respective stator coil end. A ring spherical connector portion may be carried by a respective ring, and a pair of connector members may receive therebetween the coil and ring spherical connector potions.
US07732967B2	Electrical machine comprising a winding system with coil groups Disclosed is an electric machine (1) comprising a stator (2) that encompasses a winding system (10) with three winding branches, and a certain number of effective pole pairs. Each winding branch is provided with at least one coil group, each of which contains an even number of serially connected individual coils (11) that generate an individual magnetic field, respectively. Two respective individual coils (11) of a coil group are offset relative to each other in a circumferential direction of the stator (2) in such a way that the associated individual magnetic fields are provided with an offset electrical angle relative to one another at the sixth harmonic of the number of effective pole pairs, said offset electrical angle being equal to an odd multiple of 180°.
US07732966B2	Superconducting homopolar inductor alternator for power applications A portable power system has a turbine engine generating mechanical energy. A homopolar electrical machine receives this energy. The homopolar electrical machine has a single stationary superconducting field coil configured to create a magnetic field. A homopolar rotor is configured to rotate within the magnetic field such that a rotating magnetic field is created in a stationary winding by interaction of the rotating permeance wave produced by the homopolar rotor and the magnetic field produced by the single stationary field coil. The homopolar electrical machine is configured as a generator and produces electrical power for the portable power system.
US07732964B2	Permanent magnet unit for an electrical machine, a method of installing permanent magnet units and a rotor of an electrical machine A permanent magnet unit is provided for an electrical machine. The electrical machine includes a stator and rotor. At least one permanent magnet is enclosed in a non-magnetic enclosure. The enclosure has means for connecting it to at least one other substantially similar enclosure containing a permanent magnet.
US07732963B2	Small-sized motor having ring-shaped field magnet A small-sized motor includes a field magnet attached to an inner circumferential surface of a metallic motor casing and having four or more magnetic poles. The field magnet is formed of a single ring-shaped magnet member having a predetermined thickness with respect to the radial direction and a predetermined length with respect to the thrust direction. At each of portions between the magnetic poles formed through magnetization, the magnet member has a thin portion having a reduced thickness with respect to the radial direction, the thin portion being formed by cutting the magnet member from the radially outward side. The magnetization is performed in the radial direction so as to alternately form S poles and N poles in the circumferential direction. At each of portions between the magnetic poles, the magnet member may have cut portions formed at opposite end portions of the magnet member with respect to the thrust direction.
US07732958B2	Turbogenerator A rotating shaft is required to have an overhang for the mounting of a generator for an AC-exciter, the shaft length being increased correspondingly. The overhang may become the cause of generating shaft vibrations. A turbogenerator has a rotor over which a field winding is disposed, a coupling co-cut from a rotor shaft, an AC exciter for supplying a DC current to the field winding through a rectifier, and a generator for the AC-exciter, the generator including a permanent magnet as a field generator and supplying a DC current to a field winding of the AC exciter through the rectifier. The AC exciter and the generator are disposed over the rotor shaft. The rotor is rotated through engagement between a turbine and the coupling. The generator for the AC-exciter is mounted in a position on the side nearer to the turbine than a stator of the turbogenerator.
US07732951B2	Moving-magnet type linear motor A moving-magnet type linear motor is provided with cooling blocks which are attached to each of stator bases alongside a coreless coil and which allow coolant to flow therethrough for cooling the coreless coil. Each of the cooling blocks has in a base end portion thereof a fluid passage for flowing coolant and at an extreme end portion thereof a plurality of sheet-like protrusions like fins which are arranged alongside a part of the circumferential surface of the coreless coil with a clearance between each protrusion and the next thereto. Each cooling block is thermally closely jointed with the coreless coil at the extreme ends of the sheet-like protrusions.
US07732950B2	Linear or curved mobile motor and its radiator A radiator for a linear or curved mobile motor for removing the thermal distortion of a mover and a transporting member of a linear or curved mobile motor, and a high-accuracy, high-reliability linear or curved mobile motor using it. The linear or curved mobile motor includes a field pole having a plurality of permanent magnets with different magnetic poles arranged alternately along a field yoke, and an armature arranged opposite to the field pole via a magnetic gap and formed by winding a single or a plurality of coils around a core. The field pole is used as a stator and the armature being used as a mover that is relatively moved along the longitudinal direction of the stator. A thin plate heat pipe having therein thin holes for passing a hydraulic fluid is bright in close contact with the coil surface of the mover in parallel to a surface facing via a magnetic gap to constitute a heat absorbing unit and an end or part of the thin plate heat pipe is allowed to project from the magnetic gap to constitute a heat radiating unit.
US07732946B2	Current source, control device and method for operating said control device A current source includes a first switching element configured to adjust an output current according to a control signal received at a control input. The current source also includes a reference resistance, which is electrically coupled to the first switching element such that the output current flows through the reference resistance. The latter includes first and second individual reference resistors, connected in series, and a diode connected in parallel to the first reference resistor. The first reference resistor has a higher impedance than the second reference resistor. A controller receives a predetermined reference potential and an actuating signal that constitutes the control signal of the first switching element. A second switching element supplies the controller with an actual value consisting of the voltage across the first and second individual reference resistors, when the element adopts a first switching position and consisting of the voltage drop across the second individual reference resistor, when the element adopts a second switching position.
US07732945B2	Rectifier circuit Disclosed is a rectifier circuit that realizes a low threshold voltage without using a process step to enable reduction in cost and in variation of devices. An NMOS transistor has a threshold voltage. In the transistor, a voltage to be rectified is inputted to a second node, and a rectified voltage is outputted to a first node. A threshold voltage generator is connected to a gate of the transistor and the first node. The generator generates a voltage and outputs it to the gate of the transistor. The voltage is a voltage which is elevated by the threshold voltage with respect to a voltage of the first node and is decreased by a microvoltage sufficiently small with respect to the threshold voltage. Thus, when the voltage of the second node is decreased by the microvoltage or more with respect to that of the first node, the transistor is turned on.
US07732943B2	Method and a device for selecting and dimensioning measures in a case of instability in an electrical power system A method for determining/dimensioning measures for restoring an electrical power system, which experiences or is heading for a voltage instability, to a steady-state condition, wherein there is no immediate risk of instability. An actual voltage/phase angle in the electrical power system is determined. The power unbalance within at least one sub-area in the electrical power system is determined. Suitable power-balancing measures are determined. The extent of the respective measures is determined. The power-balancing measures are carried out. Also, a device for carrying out the method.
US07732942B2	Flasher bulbs with shunt wiring for use in series connected light string with filament shunting in bulb sockets A string set of series-connected incandescent bulbs in which substantially all of the bulb filaments in the set are individually provided with a shunt in their respective socket. If flasher bulbs are used in the string, they will twinkle off and on when the operating potential is applied. The flasher bulbs are provided with internal shunts to prevent all of the bulbs of the string from flashing on and off in the event of a failure of the shunt in the socket of the flasher bulb.
US07732937B2	Semiconductor package with mold lock vent A semiconductor package including a leadframe having first and second major surfaces and a mold lock opening extending between the first and second major surfaces. The semiconductor package includes a semiconductor die coupled to the first major surface, and an encapsulating material formed about the semiconductor chip and a portion of the first major surface of the leadframe and filling all but a portion of the mold lock opening, the unfilled portion of the mold lock opening forming a vent extending from the second major surface to the first major surface, the vent providing a pathway for air to escape from between the second major surface and a surface to which the second major surface is to be attached.
US07732936B2	Buffer coating having a physical mixture of high toughness polymer and a low shrinkage polymer Embodiments of buffer coatings for semiconductor and integrated circuit manufacturing are presented herein, wherein the buffer coating is provided by mechanically blending a first polymer with at least a second polymer. The mechanically blended polymers producing a buffer coating that provides a barrier that is has an increased toughness and decreased shrinkage.
US07732935B2	Wiring board, electronic circuit board, electronic apparatus and manufacturing method of electronic circuit board A wiring board includes a substrate made of an insulation material and wired by a conductive material. A plurality of electrodes is formed on a surface of the substrate. A non-Au electrode not having an Au surface layer and an Au electrode having the Au surface layer are formed as the electrodes.
US07732934B2	Semiconductor device having conductive adhesive layer and method of fabricating the same In a semiconductor device, a semiconductor substrate may include a plurality of first conductive pads. An insulating isolation layer may be on the semiconductor substrate so as to separate the first conductive pads. A package substrate may include a plurality of second conductive pads. A conductive adhesive layer may connect the first conductive pads and the second conductive pads.
US07732930B2	Semiconductor device, relay chip, and method for producing relay chip A semiconductor device including a circuit substrate including n number of terminals; a semiconductor chip provided on the circuit substrate and including n number of terminals; and a relay chip including a triangular substrate having a first side, a second side and a third side which form triangle, n number of first terminals located along the first side, n number of second terminals located along the second side, and a plurality of wires connecting the first terminals and the second terminals respectively; a first wire connecting each of the n number of terminals of the circuit substrate to a corresponding first terminal among the n number of first terminals; and a second wire connecting each of the n number of terminals of the semiconductor chip to a corresponding second terminal among the n number of second terminals.
US07732928B2	Structure for protecting electronic packaging contacts from stress A structure for protecting electronic package contacts is provided. The structure includes at least an electronic contact mounted on a chip, a dielectric layer, a conductor trace line and a protective layer. The protective layer is used to prevent stresses from being gathered within electronic contacts on the chip through surroundingly covering the conductor trace line.
US07732921B2	Window type BGA semiconductor package and its substrate A window-type BGA semiconductor package is revealed, primarily comprising a substrate with a wire-bonding slot, a chip disposed on a top surface of the substrate, and a plurality of bonding wires passing through the wire-bonding slot. A plurality of plating line stubs are formed on a bottom surface of the substrate, connect the bonding fingers on the substrate and extend to the wire-bonding slot. The bonding wires electrically connect the bonding pads of the chip to the corresponding bonding fingers of the substrate. The plating line stubs are compliant to the wire-bonding paths of the bonding wires correspondingly connected at the bonding fingers, such as parallel to the overlapped arrangement, to avoid electrical short between the plating line stubs and the bonding wires with no corresponding relationship of electrical connections.
US07732916B2	Semiconductor package A semiconductor package is provided with a package main body including a base portion configured by joining thin plates integrally, and a semiconductor device accommodating portion provided on one surface of the base portion, electric terminals electrically connected to a semiconductor device in the accommodating portion and exposed to an outer surface of the accommodating portion, and a heat high-transfer element including at least one layer-like member provided in the base portion. The layer-like member is configured independent of the base portion by a material having a thermal conductivity higher than that of the base portion, and extends from a position corresponding to a heat-generation site of the semiconductor device to a position in an outside of the heat-generation site corresponding position.
US07732913B2	Semiconductor package substrate A semiconductor package substrate is provided, which includes a substrate body having a plurality of conductive through holes formed therein, wherein at least two adjacent conductive through holes are formed as a differential pair, each of which has a ball pad formed at an end thereof; and at least one electrically integrated layer formed in the substrate body, and having an opening corresponding to the two adjacent conductive through holes formed as the differential pair and the ball pads thereof. Thus, the spacing between the conductive through holes and the electrically integrated layer and the spacing between the ball pads can be enlarged by the opening, so as to balance the impedance match.
US07732910B2	Lead frame including suspending leads having trenches formed therein In a lead frame, through holes are formed outside suspending leads and trenches are formed on a back surface along the suspending leads so as to communicate with the through holes. When sealing resin is injected into cavities of a resin molding die, air enters the through holes through air vents and flows out from the through holes by a resin injection pressure in the trenches, making it easier for the sealing resin to enter the through holes. Since the sealing resin leaking to the air vents can be injected into the through holes, it is possible to enhance the bonding force between the sealing resin after curing and the lead frame in the vicinity of the air vents and effect release of the resin molding die, while allowing the sealing resin leaking to the air vents to remain on the lead frame side without remaining within the air vents.
US07732909B2	Method for embedding a component in a base A method, in which the semiconductor components forming part of an electronic circuit, or at least some of them, are embedded in a base, such as a circuit board, during the manufacture of the base, when part of the base structure is, as it were, manufactured around the semiconductor components. Through-holes for the semiconductor components are made in the base, in such a way that the holes extend between the first and second surface of the base. After the making of the holes, a polymer film is spread over the second surface of the base structure, in such a way that the polymer film also covers the through-holes made for the semiconductor components from the side of the second surface of the base structure. Before the hardening, or after the partial hardening of the polymer film, the semiconductor components are placed in the holes made in the base, from the direction of the first surface of the base. The semiconductor components are pressed against the polymer film in such a way that they adhere to the polymer film.
US07732905B2	Stack package and semiconductor module implementing the same The stack package may have a structure in which unit packages may be inserted into slots of a receiving substrate. The unit package may have a plurality of connecting pads. The receiving substrate may have substrate pads, which may be electrically connected to the connecting pads of the unit packages inserted in the slots by mechanical contact. The slots may be provided at regular vertical intervals so that the unit packages may be stacked in the vertical direction. A semiconductor module may include stack packages installed on at least one surface of a module substrate.
US07732903B2	High capacity memory module using flexible substrate A memory module includes a module substrate and a plurality of package units mounted to the module substrate such that they partially overlap each other. Each package unit has at least one memory semiconductor package attached thereto. Each package unit includes a flexible substrate, which has outer terminals provided over a lower surface adjacent to one edge thereof to form electrical connections with the module substrate, and the memory semiconductor package attached to one surface or each of both upper and lower surfaces of the flexible substrate.
US07732902B2	Semiconductor package with getter formed over an irregular structure A semiconductor package includes a substrate having a first surface portion in a cavity. The first surface portion includes an artificially formed grass structure. The package includes a getter film formed over the grass structure.
US07732897B2	Methods of die sawing and structures formed thereby A structure includes a substrate having a plurality of scribe line areas surrounding a plurality of die areas. Each of the die areas includes at least one first conductive structure formed over the substrate. Each of the scribe line areas includes at least one active region and at least one non-active region. The active region includes a second conductive structure formed therein. The structure further includes at least one first passivation layer formed over the first conductive structure and second conductive structure, wherein at least a portion of the first passivation layer within the non-active region is removed, whereby die-sawing damage is reduced.
US07732894B2	Electronic components on trenched substrates and method of forming same A method of mounting an electronic component on a substrate includes forming at least one trench in a surface of the substrate. The trenches formed in the substrate reduce a stiffness of the substrate, which provides less resistance to shear. Accordingly, the trenches reduce the amount of strain on the joints, which mount the electronic component to the substrate, which enhances the life of the joints.
US07732893B2	Electrical fuse structure for higher post-programming resistance The present invention provides an electrical fuse structure for achieving a post-programming resistance distribution with higher resistance values and to enhance the reliability of electrical fuse programming. A partly doped electrical fuse structure with undoped semiconductor material in the cathode combined with P-doped semiconductor material in the fuselink and anode is disclosed and the data supporting the superior performance of the disclosed electrical fuse is shown.
US07732892B2	Fuse structures and integrated circuit devices Fuse structures and integrated circuit devices are disclosed. An exemplary embodiment of a fuse structure comprises a first and second metal pads formed at different positions in a first dielectric layer and a conductive line formed in a second dielectric layer underlying the first dielectric layer, electrically connecting the first and second pad. The conductive line is formed with at least one first portion at an end thereof and a second portion connected with the first portion, wherein the width of the first portion is greater than the width of the second portion.
US07732886B2	Pin photodiode structure A PIN photodiode structure includes a substrate, a P-doped region disposed in the substrate, an N-doped region disposed in the substrate, and a first semiconductor material disposed in the substrate and between the P-doped region and the N-doped region.
US07732880B2	Semiconductor device and method of manufacturing the same A conventional semiconductor device, for example, a MOS transistor including an offset gate structure has a problem that it is difficult to reduce the device size. In a semiconductor device according to the present invention, for example, in a P-channel MOS transistor including an offset gate structure, a LOCOS oxide film is formed between a source region and a drain region in an N type epitaxial layer. A gate electrode is formed to be positioned on the LOCOS oxide layer. In addition, a P type diffusion layer as the drain region and a P type diffusion layer as the source region are formed with a high positional accuracy with respect to the gate electrode. This structure makes it possible to reduce the device size of the MOS transistor.
US07732878B2	MOS devices with continuous contact etch stop layer A semiconductor structure includes a substrate, a gate stack on the substrate, a source/drain region adjacent the gate stack, a source/drain silicide region on the source/drain region, a protection layer on the source/drain silicide region, wherein a region over the gate stack is substantially free from the protection layer, and a contact etch stop layer (CESL) having a stress over the protection layer and extending over the gate stack.
US07732874B2	FinFET structure using differing gate dielectric materials and gate electrode materials A semiconductor structure includes a first finFET and a second finFET. The first finFET and the second finFET may comprise an n-finFET and a p-finFET to provide a CMOS finFET structure. Within the semiconductor structure, at least one of: (1) a first gate dielectric within the first finFET and a second gate dielectric within the second finFET comprise different gate dielectric materials; and/or (2) a first gate electrode within the first finFET and a second gate electrode within the second finFET comprise different gate electrode materials.
US07732868B2	Semiconductor device A protecting element, comprising a first n+-type region, an insulating region, and a second n+-type region, is connected in parallel between two terminals of an FET. Since discharge across the first and second n+ regions is enabled, electrostatic energy that reaches the operating region of the FET can be attenuated without increasing the parasitic capacitance.
US07732867B2	Method for manufacturing SOQ substrate Hydrogen ions are implanted to a surface (main surface) of the single crystal Si substrate 10 to form the hydrogen ion implanted layer (ion-implanted damage layer) 11. As a result of the hydrogen ion implantation, the hydrogen ion implanted boundary 12 is formed. The single crystal Si substrate 10 is bonded to the quartz substrate 20 having a carbon concentration of 100 ppm or higher, and an external shock is applied near the ion-implanted damage layer 11 to delaminate the Si crystal film along the hydrogen ion implanted boundary 12 of the single crystal Si substrate 10 out of the bonded substrate. Then, the surface of the resultant silicon thin film 13 is polished to remove a damaged portion, so that an SOQ substrate can be fabricated. There can be provided an SOQ substrate highly adaptable to a semiconductor device manufacturing process.
US07732865B2	Epitaxial imprinting The present invention provides an epitaxial imprinting process for fabricating a hybrid substrate that includes a bottom semiconductor layer; a continuous buried insulating layer present atop said bottom semiconductor layer; and a top semiconductor layer present on said continuous buried insulating layer, wherein said top semiconductor layer includes separate planar semiconductor regions that have different crystal orientations, said separate planar semiconductor regions are isolated from each other. The epitaxial printing process of the present invention utilizing epitaxial growth, wafer bonding and a recrystallization anneal.
US07732856B2	Charge-trap type non-volatile memory devices and related methods Methods of forming a non-volatile memory device may include forming a tunnel insulating layer on a semiconductor substrate and forming a charge-trap layer on the tunnel insulating layer. A trench may then be formed extending through the tunnel insulating layer and the charge-trap layer and into the semiconductor substrate so that portions of the charge-trap layer and the tunnel insulating layers remain on opposite sides of the trench. A device isolation layer may be formed in the trench, and a blocking insulating layer may be formed on the device isolation layer and on remaining portions of the charge-trap layer. A gate electrode may be formed on the blocking insulating layer, and the blocking insulating layer and remaining portions of the charge-trap layer may be patterned to provide a blocking insulating pattern and a charge-trap pattern between the gate electrode and the semiconductor substrate. Related structures are also discussed.
US07732854B2	Nonvolatile semiconductor memory and fabrication method for the same A nonvolatile semiconductor memory includes a first and a second active area configured to extend in the column direction in parallel; an element isolating region configured to electrically separate the first and the second active area; a plurality of word lines configured to extend in the row direction and be constituted by respective main parts and respective ends; and a plurality of memory cell transistors configured to be disposed on intersections between the respective main parts of the plurality of word lines and the second active area. Each memory cell transistor comprises a gate insulating film, a floating gate electrode, an inter-gate insulating film, and a control gate electrode, constituting a memory cell array; a short-circuit region configured to electrically short circuit the ends of the plurality of word lines; and a trench configured to separate the ends from the main parts of the plurality of word lines.
US07732852B2	High-K dielectric materials and processes for manufacturing them High dielectric films of mixed transition metal oxides of titanium and tungsten, or titanium and tantalum, are formed by sequential chemical vapor deposition (CVD) of the respective nitrides and annealing in the presence of oxygen to densify and oxidize the nitrides. The resulting film is useful as a capacitative cell and resists oxygen diffusion to the underlying material, has high capacitance and low current leakage.
US07732851B2	Method for fabricating a three-dimensional capacitor A capacitor and a method of fabricating the capacitor are provided herein. The capacitor can be formed by forming two or more dielectric layers and a lower electrode, wherein at least one of the two or more dielectric layers is formed before the lower electrode is formed.
US07732850B2	Semiconductor device including an improved capacitor and method for manufacturing the same In a semiconductor device according to embodiments of the invention, a capacitor includes a storage electrode having a cylindrical storage conductive layer pattern and connecting members formed on the upper portion of the cylindrical storage conductive layer pattern. The connecting member connects to an adjacent connecting member of another storage electrode. A dielectric layer and a plate electrode are successively formed on the storage electrode. All of the capacitors are connected by one another by forming cylindrical storage electrodes so that the storage electrode does not fall down when the capacitors have an extremely large aspect ratio. Thus, the capacitance of the capacitors may be improved to the desired level. A semiconductor device that includes these capacitors may have improved reliability and the throughput of a semiconductor manufacturing process may be increased.
US07732849B2	Dynamic random access memory A dynamic random access memory (DRAM) is provided. The DRAM comprises a substrate, a vertical transistor, a deep trench capacitor and a buried strap. The substrate has a trench and a deep trench located on one side of the trench thereon. The vertical transistor is disposed in the trench, a portion of which is disposed on the substrate. The deep trench capacitor is disposed in the deep trench, and comprises a bottom electrode, a capacitor dielectric layer and a top electrode. The vertical transistor comprises a gate structure disposed in the trench and above the substrate, a first doped region disposed in the substrate on sidewalls and bottom of the trench, and a second doped region disposed in the substrate on top of the trench. The buried strap is disposed in the substrate below the vertical transistor, and is adjoined to the first doped region and the top electrode.
US07732847B2	Semiconductor memory device including a semiconductor film made of a material having a spontaneous polarization and method for fabricating the same A semiconductor memory device is composed of a field effect transistor using the interface between a ferroelectric film and a semiconductor film as the channel and including a gate electrode to which a voltage for controlling the polarization state of the ferroelectric film is applied and source/drain electrodes provided on both ends of the channel to detect a current flowing in the channel in accordance with the polarization state. The semiconductor film is made of a material having a spontaneous polarization and the direction of the spontaneous polarization is parallel with the interface between the ferroelectric film and the semiconductor film.
US07732846B2	Semiconductor device including solid state image pickup device, and portable electronic apparatus A semiconductor device includes: a plurality of pixel units disposed in a matrix shape, each of the plurality of pixel units including: a first photoelectric conversion element for converting incident light of a first color into signal charges; a second photoelectric conversion element for converting incident light of a second color into signal charges; a third photoelectric conversion element for converting incident light of a third color into signal charges; and a detector circuit shared by the first to third photoelectric conversion elements for detecting the signal charges converted by each of the first to third photoelectric conversion elements, wherein the plurality of pixel units are pixel units adjacently disposing a row (column) juxtaposing the first photoelectric conversion element and detector circuit and a row (column) juxtaposing the second and third photoelectric conversion elements.
US07732841B2	Pixel sensor cell for collecting electrons and holes The present invention is a pixel sensor cell and method of making the same. The pixel sensor cell approximately doubles the available signal for a given quanta of light. The device of the present invention utilizes the holes produced by impinging photons in a pixel sensor cell circuit. A pixel sensor cell having reduced complexity includes an n-type collection well region formed beneath a surface of a substrate for collecting electrons generated by electromagnetic radiation impinging on the pixel sensor cell and a p-type collection well region formed beneath the surface of the substrate for collecting holes generated by the impinging photons. A circuit structure having a first input is coupled to the n-type collection well region and a second input is coupled to the p-type collection well region, wherein an output signal of the pixel sensor cell is the magnitude of the difference of a signal of the first input and a signal of the second input.
US07732840B2	Semiconductor device A second-conductivity-type transistor includes a source and drain formed by a second-conductivity-type diffusion layer formed on a first-conductivity-type semiconductor layer; and a gate formed on the first-conductivity-type semiconductor layer sandwiched between the second-conductivity-type diffusion layer through an insulating film A first-conductivity-type transistor includes a source and drain formed by a first-conductivity-type diffusion layer formed on a second-conductivity-type semiconductor layer; and a gate formed on the second-conductivity-type semiconductor layer sandwiched between the first-conductivity-type diffusion layer through an insulating film. The second-conductivity-type diffusion layer for configuring the second-conductivity-type transistor is divided into a plurality of regions, each of which being separated by a device isolation region formed on the first-conductivity-type semiconductor layer. The first-conductivity-type diffusion layer for configuring the first-conductivity-type transistor is divided into a plurality of regions, each of which being separated by a device isolation region formed on the second-conductivity-type semiconductor layer.
US07732839B2	Semiconductor device and method for fabricating the same A MIS transistor includes a gate electrode portion, insulating sidewalls formed on side surfaces of the gate electrode portion, source/drain regions and a stress film formed so as to cover the gate electrode portion and the source/drain regions. A height of an upper surface of the gate electrode portion is smaller than a height of an upper edge of each of the insulating sidewalls. A thickness of first part of the stress film located on the gate electrode portion is larger than a thickness of second part of the stress film located on the source/drain regions.
US07732838B2	Semiconductor device and manufacturing method thereof A semiconductor device is provided. The semiconductor device includes a first gate line, a second gate line, a first contact electrode, first dummy gates, a second gate pad, and a second contact electrode. The first gate line is formed on a semiconductor substrate and the second gate line of a spacer shape is formed on the sidewalls of the first gate line with a thin insulating layer interposed therebetween. The first contact electrode is vertically connected with the first gate line. The first dummy gates are formed in array spaced a predetermined interval from the first gate line on the semiconductor substrate. The second gate pad of a spacer shape is formed on the sidewalls of the first dummy gates with a thin insulating layer interposed therebetween. The second gate pad is connected to the second gate line and is also gap-filled between the first dummy gates. The second contact electrode is vertically connected with the second gate pad.
US07732836B2	Compound semiconductor epitaxial substrate and method for manufacturing the same In a compound semiconductor epitaxial substrate used for a strain channel high electron mobility field effect transistor which comprises an InGaAs layer as a channel layer 9 and AlGaAs layers containing n-type impurities as electron supplying layers 6 and 12, the channel layer 9 has an electron mobility at room temperature of 8300 cm2/V·s or more by adjusting an In composition of the InGaAs layer composing the channel layer 9 to 0.25 or more and optimizing the In composition and the thickness of the channel layer 9. GaAs layers 8 and 10 having a thickness of 4 nm or more each may be laminated respectively in contact with a top surface and a bottom surface of the channel layer 9.
US07732831B2	Compound semiconductor light-emitting device with AlGaInP light-emitting layer formed within A pn-junction compound semiconductor light-emitting device is provided, which comprises a stacked structure including a light-emitting layer composed of an n-type or a p-type aluminum gallium indium phosphide and a light-permeable substrate for supporting the stacked structure, and the stacked structure and the light-permeable substrate being joined together, wherein the stacked structure includes an n-type or a p-type conductor layer, the conductor layer and the substrate are joined together, and the conductor layer is composed of a Group III-V compound semiconductor containing boron.
US07732829B2	Optoelectronic device submount A submount for an optoelectronic device includes a substrate, a first top pad on a top surface of the substrate, a first bottom pad on a bottom surface of the substrate and a first wrap-around contact in a sidewall recess of the substrate, in which the first wrap-around contact is coupled electrically to the first top pad and to the first bottom pad. Alternatively, or in addition, the submount includes a device mounting pad on the top surface of the substrate, a wire-bond pad on the top surface of the substrate, a contact pad on the bottom surface of the substrate and a feedthrough contact which extends through the substrate and electrically couples the wire-bond pad to the contact pad.
US07732828B2	Flat panel display A flat panel display is provided. The flat panel display includes a display panel. A light guide plate is disposed below the display panel. At least one optical film is disposed between the display panel and the light guide plate. At least one illuminating device package is disposed in proximity to the side of the light guide plate. The illuminating device package includes an illuminating semiconductor device and a lens encapsulating the illuminating semiconductor device. The lens includes two reflective surfaces disposed at either side of a central axis. A plurality of diffractive surfaces are disposed between the reflective surfaces. Each of the diffractive surfaces has a tilt angle respective to the central axis. A first portion of light beams incident to each of the reflective surfaces is reflected to at least one diffractive surface and then diffracted and collected into a first convergent angle.
US07732827B2	High efficient phosphor-converted light emitting diode A light-emitting device and manufacturing method thereof are disclosed. The light-emitting device includes a substrate, a semiconductor light-emitting structure, a filter layer, and a fluorescent conversion layer. The method comprises forming a semiconductor light-emitting structure over a substrate, forming a filter layer over the semiconductor light-emitting structure, and forming a fluorescent conversion layer over the filter layer.
US07732826B2	Semiconductor and method of semiconductor fabrication The present invention discloses a semiconductor, includes one or more luminescent layers; and one or more electron gas layers with two-dimensional electron gases that are distributed parallel to the luminescent layers.
US07732813B2	Image sensor and method for manufacturing the same An image sensor and a method of manufacturing the same are provided. A metal wiring layer is formed on a semiconductor substrate including a circuit region, and first conductive layers are formed on the metal layer separated by a pixel isolation layer. An intrinsic layer is formed on the first conductive layers, and a second conductive layer is formed on the intrinsic layer.
US07732809B2	Light emitting display providing with compensated cholesteric reflective polarizer for improved contrast even in high ambient light or large viewing angle The present invention provides light emitting displays which produce a bright image by efficiently emitting light radiated from a light-emitting thin-film layer to the viewer side, and also produces a high-quality image of high contrast ratio and changing in color to a limited extent over a wide viewing angle range even in a bright atmosphere. The light emitting displays are provided with a plurality of light-emitting devices 70, each device 70 having a light-emitting thin-film layer 100 and a light reflective surface 300 in this order on the back side, and a circularly polarized light reflective layer 500 which separates incident light into two types of circularly polarized components, one being reflected and the other transmitted by the reflective layer, an optical compensation layer 800, a quarter-wave plate 700 and a polarizer 600 on the front side, wherein the optical compensation layer 800 is composed of a transparent body working as an optical indicatrix having little refractive index distribution in the in-plane direction and having a refractive index in the thickness direction different from that in the in-plane direction.
US07732808B2	Light-emitting device and method for manufacturing the same A light-emitting element is disclosed that can drive at a low driving voltage and that has a longer lifetime than the conventional light-emitting element, and a method is disclosed for manufacturing the light-emitting element. The disclosed light-emitting element includes a plurality of layers between a pair of electrodes; and at least one layer among the plurality of layers contains one compound selected from the group consisting of oxide semiconductor and a metal oxide, and a compound having high hole transportation properties. Such the light-emitting element can suppress the crystallization of a layer containing one compound selected from the group consisting of oxide semiconductor and a metal oxide, and a compound having high hole transportation properties. As a result, a lifetime of the light-emitting element can be extended.
US07732807B2	Integrated circuit A fine vacuum tube element and other electronic elements are integrated and formed on a semiconductor substrate, and the fine vacuum tube element and the other electronic elements transmit signals to and from each other. When integrating the vacuum tube element with the other electronic elements, a quantum effect is realized in a room temperature environment by utilizing ballistic electrons (non-scattering electrons) traveling through the vacuum, and in the integrated circuit, an A/D converter is constructed by an interference system such as a Mach-Zehnder interferometer. Also an integrated circuit of an advanced function-integrated type is provided, comprising an interference system such as a Mach-Zehnder interferometer wherein weighting of the Mach-Zehnder interferometer is constituted for image processing and signal code conversion. A very high-speed light-receiving integrated circuit for optical communication is constructed by utilizing a very high-speed optical response characteristic of electron emission of the vacuum element, and a sensor such as a magnetic/electric field sensor is constructed by utilizing a quantum effect of ballistically traveling electrons.
US07732803B2	Light emitting device having stacked multiple LEDS A light emitting device and method of producing the same is disclosed. The light emitting device includes a heterostructure having a plurality of light emitting diodes (LEDs) stacked one on top of another.
US07732801B2	Phase change memory device A phase change memory device is provided. The phase change memory device includes a substrate with a first electrode layer formed thereon. A first phase change memory structure is on the first electrode layer and electrically connected to the first electrode layer. A second phase change memory structure is on the first phase change memory structure and electrically connected to the first phase change memory structure, wherein the first or second phase change memory structure includes a cup-shaped heating electrode. A first insulating layer covers a portion of the cup-shaped heating electrode along a first direction. A first electrode structure covers a portion of the first insulating layer and the cup-shaped heating electrode along a second direction. The first electrode structure includes a pair of phase change material sidewalls on a pair of sidewalls of the first electrode structure and covering a portion of the cup-shaped heating electrode.
US07732800B2	Resistor random access memory cell with L-shaped electrode A phase change random access memory PCRAM device is described suitable for use in large-scale integrated circuits. An exemplary memory device has a pipe-shaped first electrode formed from a first electrode layer on a sidewall of a sidewall support structure. A sidewall spacer insulating member is formed from a first oxide layer and a second, “L-shaped,” electrode is formed on the insulating member. An electrical contact is connected to the horizontal portion of the second electrode. A bridge of memory material extends from a top surface of the first electrode to a top surface of the second electrode across a top surface of the sidewall spacer insulating member.
US07732798B2	Programmable via structure for three dimensional integration technology A programmable link structure for use in three dimensional integration (3DI) semiconductor devices includes a via filled at least in part with a phase change material (PCM) and a heating device proximate the PCM. The heating device is configured to switch the conductivity of a transformable portion of the PCM between a lower resistance crystalline state and a higher resistance amorphous state. Thereby, the via defines a programmable link between an input connection located at one end thereof and an output connection located at another end thereof.
US07732794B2	Extreme ultra violet light source apparatus In an extreme ultra violet light source apparatus having a comparatively large output power for exposing, a solid target is supplied fast and continuously while heat dissipation for irradiation of a driver laser light is performed successfully. The extreme ultra violet light source apparatus includes: a chamber in which extreme ultra violet light is generated; a target material supplying unit which coats a wire with target material, a wire supplying unit which supplies the wire coated with the target material to a predetermined position within the chamber, a driver laser which applies a laser beam onto the wire coated with the target material to generate plasma; and a collector mirror which collects the extreme ultra violet light radiated from the plasma and outputting the extreme ultra violet light.
US07732787B2	Ion implantation ion source, system and method An ion source is disclosed that is capable of providing ions of decaborane in commercial ion current levels to the ion extraction system of an ion implanter is provided, the ion source comprising an ionization chamber defined by walls enclosing an ionization volume, there being an ion extraction aperture in a side wall of the ionization chamber, arranged to enable the ion current to be extracted from the ionization volume by an extraction system, an electron gun mounted on a support that is outside of and thermally isolated from the walls of the ionization chamber, the ion extraction aperture plate is biased to a negative voltage with respect to the ionization chamber to further increase the drift velocity of the ions, and hence the maximum obtainable current in the resulting ion beam.
US07732786B2	Coupling energy in a plasmon wave to an electron beam A device for coupling energy in a plasmon wave to an electron beam includes a metal transmission line having a pointed end; a generator mechanism constructed and adapted to generate a beam of charged particles; and a detector microcircuit disposed adjacent to the generator mechanism. The generator mechanism and the detector microcircuit are disposed adjacent the pointed end of the metal transmission line and wherein a beam of charged particles from the generator mechanism to the detector microcircuit electrically couples the plasmon wave traveling along the metal transmission line to the microcircuit.
US07732783B2	Ultraviolet light monitoring system An ultraviolet light monitoring system includes first and second electrodes, an evaluation subject film and a power source. The first and second electrodes are opposingly disposed and attract holes which are generated in accordance with irradiation of ultraviolet light. The evaluation subject film is formed in a vicinity of the first and second electrodes, and is a subject of evaluation of damage caused by the irradiation of ultraviolet light. The power source, at times of monitoring of the ultraviolet light, applies a predetermined bias to a series path formed by the first electrode, a gap between the first and second electrodes, and the second electrode.
US07732771B2	Monitoring apparatus An imaging apparatus includes a camera unit, a panorama-image generating section generating a panorama image of the entire area by combining a plurality of unit images obtained by the camera unit, a panorama-image storage/management section storing and managing the panorama image generated by the panorama-image generating section, an infrared camera photographing an object that has a temperature falling within a preset temperature range as an infrared image, a direction controller sequentially shifting the photographing direction of the infrared camera within the area being photographed, an infrared-image generating section combining a plurality of infrared images provided by the infrared camera, an image-synthesizing section synthesizing the panorama image generated by the panorama-image generating section, with the panorama infrared image generated by the infrared-image generating section, and a display displaying the synthesized image generated by the image-synthesizing section.
US07732770B2	Thin film multi-layered pyroelectric capacitor Aspects described herein provide for the design and fabrication of a device with an enhanced pyroelectric response signal comprised of multi-capacitors that are connected in series. These capacitors are fabricated using multi-layers of materials such as lead zirconate titanate (PZT), BaxSr1-xTiO3 (barium strontium titanate) and Bi4Ti3O12 (bismuth titanate) films that exhibit pyroelectric affect and belong to the class of polar materials. By controlling the poling direction of the multi-layer integrated structure, the pyroelectric voltage can be aligned in one direction, and as a result, the voltage output from the single element is the total contribution from each capacitor.
US07732767B2	Target marker having quantum cascade laser for thermally marking a target A handheld target marker is provided, wherein the target marker includes a housing retaining a quantum cascade laser, a collimating or focusing lens, a driver and a power supply. The quantum cascade laser produces a thermal infrared beam which can be selectively directed to impinge upon a target. The impinging beam is viewable by a thermal imager. The handheld target marker operates at ambient temperatures and incorporates the driver and power supply necessary for operation of the quantum cascade laser.
US07732763B2	Pattern inspection method, pattern inspection apparatus, semiconductor device manufacturing method, and program A pattern inspection method includes: irradiating a first region of a surface of a sample having a pattern to be inspected with a charged particle beam; acquiring a first two-dimensional image showing a state of the surface of the sample; searching for a pattern similar to a previously prepared reference image within the first two-dimensional image; when the pattern similar to the reference image is not detected in the first two-dimensional image, irradiating a second region of the surface of the sample that has not been irradiated with a charged particle beam; acquiring a second two-dimensional image showing a state of the surface of the sample; and searching a pattern similar to the reference image within the second two-dimensional image.
US07732759B2	Multi-plasma neutral beam source and method of operating Method and system for producing a neutral beam source is described. The neutral beam source comprises a plasma generation system for forming a first plasma in a first plasma region, a plasma heating system for heating electrons from the first plasma region in a second plasma region to form a second plasma, and a neutralizer grid for neutralizing ion species from the second plasma in the second plasma region. Furthermore, the neutral beam source comprises an electron acceleration member configured to accelerate the electrons from the first plasma region into the second plasma region. Further yet, the neutral beam source comprises a pumping system that enables use of the neutral beam source for semiconductor processing applications, such as etching processes.
US07732758B2	Optoelectronic tweezers An on-chip micro-fluidic device (10) fabricated using a semiconductor material. The device has a micro-fluidic channel or chamber (14) defined within the material and one or more monolithically integrated semiconductor lasers (12) operate to form an optical trap in the channel or chamber (14).
US07732756B2	User navigation device with a code wheel and an encoder A user navigational apparatus. The user navigational apparatus includes a code wheel and an encoder. The code wheel is coupled to a dial. The code wheel includes a track of alternating reflective and non-reflective sections. The optical reflective encoder includes an emitter and a detector. The emitter generates a light signal incident on the track of the code wheel. The detector detects a reflected light signal. The reflected light signal corresponds to a portion of the incident light signal that is reflected off of the reflective sections of the track. The detector also generates a channel signal corresponding to the reflected light signal. Embodiments of this type of user navigational apparatus achieve reduced thickness compared to conventional implementations of jog wheels.
US07732755B2	Absolute encoder utilizing light of different wavelengths to reduce cross talk An encoder having a code scale, an illumination system, and a plurality of photodetectors is disclosed. The code scale has a plurality of tracks that are illuminated by the illumination system. Each photodetector receives light from a corresponding one of the tracks and generates a signal indicative of a quantity of light received from that track. Each photodetector is limited to detecting light in a band of wavelengths corresponding to that track. Each track generates light in a band of wavelengths corresponding to that track, and the band of wavelengths corresponding to one of the tracks is different from the band of wavelengths corresponding to the tracks that are next to that track. The tracks can include alternating reflective and absorptive stripes, alternating transmissive and reflective stripes, or alternating luminescent and absorptive stripes.
US07732754B2	Optical encoder with amplitude correction According to one embodiment, there is provided an optical encoder having a photodetector array comprising motion detection photodetectors and at least one reference photodetector vertically offset from the motion detection photodetectors. The output signal generated by the at least one reference photodetectors is employed to correct undesired variations in the amplitudes of the output signals generated by the motion detection photodetectors. Such variations typically arise from various mechanical and optical misalignments in the optical encoder, and are compensated for by using the reference output signal to add to or subtract from, as required, the amplitudes of motion detection output signals.
US07732753B2	Illumination system having a light-transmissive plate with surface-modification structures The illumination system has a plurality of light sources (R, G, B), a light-transmissive light-sensing plate (5) and surface-modification structures (21, 22) provided at a limited number of pre-determined locations on a surface of the light-sensing plate (5). The surface-modification structures divert a portion of the light traveling through the light-sensing plate. The diverted light is guided towards an edge surface (15, 16) of the light-sensing plate, where at least one light sensor (11, 12) senses the diverted light. A first light sensor (11) preferably receives diverted light substantially exclusively from the first surface-modification structures (21), whereas the second light sensor (12) receives diverted light substantially exclusively from the second surface-modification structures (22). Alternatively, the illumination system further comprises a light-mixing chamber having a light-emission window for illuminating a display device, the light-sensing plate being arranged in the light-mixing chamber between the light source and the light-emission window.
US07732752B2	Continuous base beneath optical sensor and optical homodyning system A housing for a control device includes an enclosed cavity configured to secure an optical detection system, including a light source and a sensor, and a face of the enclosed cavity configured to include a window to allow light from the light source to scatter light off of a surface and configured to allow reception of the scattered light on the sensor. In this configuration the housing is structured to prevent exposure of the optical detection system to external elements such as the surface. Also disclosed is a homodyning system for use with a coherent light source optical pointing device.
US07732750B2	Wavefront coding interference contrast imaging systems An interference contrast imaging system images phase objects. The system includes an illumination source, illumination optics, polarizing optics for splitting the illumination into orthogonal polarizations and for recombining the polarizations, objective optics that form an image at a detector, a wavefront coding element and a post processor for processing the image by removing a phase shift imparted by the wavefront coding element. The wavefront coding element has an aperture, is between the phase object and the detector, and provides an altered optical transfer function of the imaging system by imparting the phase shift to the illumination transmitted through the wavefront coding element. The altered optical transfer function is insensitive to an object distance between the phase object and the objective optics over a greater range of object distances than would be provided by an optical transfer function of a corresponding interference contrast imaging system without the wavefront coding element.
US07732745B2	Imaging apparatus including a solid state imaging device including a plurality of photo diodes An imaging apparatus includes a solid state imaging device having a light receiving characteristic in which an amount of light received reaches a maximum when an angle of incidence of parallel light, radiated at continuously changing angle, is not vertical (angle θ of incident light in the range of 3° to 15°) to a light receiving surface. This characteristic changes the amount of light received greatly when an aperture stop is opened, and enhances an opening/closing effect of the aperture stop. The solid state imaging device includes a core/clad light guide path structure, whose core serves as a light guide path. This light guide path includes a columnar portion located above a photodiode, and a lens portion on the columnar portion.
US07732744B2	Image input apparatus, photodetection apparatus, and image synthesis method An image input apparatus includes an imaging optical system, a microlens array having a plurality of microlenses two-dimensionally arrayed with a predetermined pitch in the vicinity of a focal plane of the imaging optical system, and a photoreceptor array having a plurality of photoreceptors for each of the microlenses, each of the photoreceptors receiving bundles of rays passing through one of different exit-pupil regions of the imaging optical system. A power of the microlens and a gap between the microlens array and the photoreceptor array are determined so that a cross-sectional dimension of the bundles of rays for forming an image of each of the photoreceptors related to the microlens is equal to or smaller than the pitch of the microlens, within a range from the microlens array to a predetermined distance.
US07732742B2	Device and method for signal processing An analog real-time signal processing device and method are presented. The device is configured to perform electrical signal processing. The device comprises an electronic circuit including at least one basic unit of electrodes, the basic unit being configured to be sensitive to an external field, such as input photon flux, indicative of a first input signal to cause emission of charged particles and configured to define at least one electrical input for a second input signal and one electrical output, thereby providing the electrical output in the form of an approximation of a product of the first and second input signals.
US07732740B2	Casing for electric stoves A casing for electric stoves includes an annular frame and a bottom board that are detachably coupled through a plurality of connectors. The frame has at least one lateral side with an air convection means located thereon. The bottom board has an upper surface with a heat control means installed thereon. Through the detachable bottom board, the entire electric stoves need not to be disassembled or removed when malfunction occurs and needs repair. By separating the bottom board from the frame, the electric link between the heat control means and the electric stove can be disconnected to replace the heat control means. Thus the malfunction can be fixed quickly, and interruption or delay of cooking that might otherwise happen can be prevented.
US07732738B2	Banquet cart including heat retention material A banquet cart includes a heater received in an opening in the bottom panel of the banquet cart. Plates of food are loaded into the interior compartment of the banquet cart in the kitchen. The heater includes a central heater unit and two heat retention material heating panels. The central heater unit heats the interior compartment of the banquet cart for twenty minutes. The central heater unit is turned off, and smaller heaters are turned on to heat the heat retention material heating panels for forty minutes. The smaller heaters are turned off and the banquet cart is rolled from the kitchen to a hallway proximate to the dining area for serving the plates of food to guests. The heated heat retention material heating panels can maintain the temperature of the air in the interior compartment of the banquet cart warm for approximately two hours and forty minutes, keeping the food in the banquet cart warm.
US07732736B2	Hot melt adhesive hose assembly with thermal fuse link A hot melt adhesive hose assembly comprises a heater circuit wrapped around an external surface portion of the hose assembly, a temperature sensor, and an elongated thermal fuse which is likewise wrapped around an external surface portion of the hose assembly such that successive spiral turns of the thermal fuse are effectively interposed between successive spiral turns of the heater circuit. The thermal fuse may be electrically connected in series with the heater circuit so as to effectively terminate electrical power to the heater circuit as a result of the melting of the thermal fuse, or alternatively, the thermal fuse may be electrically connected in series with the temperature sensor, so as to detect abnormal temperature levels at substantially any location throughout the length of the hose assembly.
US07732735B2	Hot melt adhesive hose assembly having redundant components A new and improved hot melt adhesive hose assembly has a hot melt adhesive hose core, a pair of heater circuits wrapped around the external peripheral surface of the hose core, and a pair of temperature sensors also disposed in contact with the external peripheral surface of the hose core. A first one of the heater circuits is initially electrically connected to the hot melt adhesive hose assembly electrical circuitry, and in a similar manner, a first one of the temperature sensors is electrically connected to the hot melt adhesive hose assembly electrical circuitry. Should a failure occur within the first one of the heater circuits, or within the first one of the temperature sensors, electrical switch mechanisms, which are fixedly mounted upon the hose assembly, can be actuated so as to effectively remove the first, failed heater circuit, or the first, failed temperature sensor from the hot melt adhesive hose assembly electrical circuitry, and substantially simultaneously therewith, electrically connect the second one of the heater circuits, or temperature sensors, to the hot melt adhesive hose assembly electrical circuitry. The hot melt adhesive hose assembly, including the heater circuits, the temperature sensors, and the switch mechanisms, effectively comprises a self-contained, stand-alone, or independent operative component that can be utilized in conjunction with any adhesive supply unit (ASU) and its temperature controller.
US07732734B2	Metal forming apparatus and process with resistance heating An apparatus for forming a metal article includes a station which receives and supports a workpiece. The station has a source of electrical current and a source of a fluid. The station further includes a first and a second electrode clamp. Each clamp is in electrical communication with the source of current and in fluid communication with the source of fluid. The clamps engage a workpiece and deliver an electrical current and a fluid thereto. The system includes an actuator mechanically associated with at least one of the clamps. The actuator is operable in combination with a clamp to apply mechanical force to the workpiece. The system is operable to selectably control the temperature profile and/or ambient conditions of a workpiece during forming or processing steps. Disclosed are specific systems including modular systems. Also disclosed are methods for using the systems.
US07732732B2	Laser machining apparatus, and apparatus and method for manufacturing a multilayered printed wiring board There is provided a laser processing apparatus, a multilayer printed wiring board manufacturing apparatus, and a manufacturing method to form via holes of ultra-fine diameter. The laser beam from the CO2 laser oscillator (60) is converted to the shortened wavelength beam by a tellurium crystal (94) to control diffraction of the laser beam. Simultaneously, when the laser beam is condensed, a limit value of the condensation limit is reduced. Thereby, the spot diameter of laser beam is reduced and a hole for via hole is bored on the interlayer insulation resin on a substrate (10). Therefore, even when the laser beam output is raised to form a deeper hole, the hole diameter is not widened and thereby a hole for a small diameter via hole can be formed.
US07732730B2	Laser processing method and laser processing apparatus A laser beam machining method and a laser beam machining device capable of cutting a work without producing a fusing and a cracking out of a predetermined cutting line on the surface of the work, wherein a pulse laser beam is radiated on the predetermined cut line on the surface of the work under the conditions causing a multiple photon absorption and with a condensed point aligned to the inside of the work, and a modified area is formed inside the work along the predetermined determined cut line by moving the condensed point along the predetermined cut line, whereby the work can be cut with a rather small force by cracking the work along the predetermined cut line starting from the modified area and, because the pulse laser beam radiated is not almost absorbed onto the surface of the work, the surface is not fused even if the modified area is formed.
US07732729B2	Laser processing device A laser processing device capable of recognizing a failure of pulsed laser beam irradiation during a process of pulsed laser beam irradiation and taking appropriate measures. A first judgment section and a second judgment section monitor respectively whether a pulsed laser beam is actually irradiated by an oscillation of a laser oscillator at the timing when a pulse signal is output from a pulse signal output section and whether the pulse signal output section outputs the pulse signal as setting to the laser oscillator at the timing when the pulse signal is output based on the preset pulse number. When there is a failure of the pulsed laser beam irradiation during the processing, the occurrence of failure is recognized and it can be recognized whether the failure is caused by a laser beam irradiating unit or a controller including the pulse signal output section.
US07732727B2	Heavy-duty circuit-breaker with sealing against hot gas The heavy-duty circuit-breaker with arc blowing has an element which is sensitive to hot gas and/or to gas pressure and is protected by means of a seal against a hot-gas flow. The seal is advantageously a movable non-contacting seal. The seal has a channel entrance for production of a partial hot-gas flow of the hot-gas flow and, connected downstream from this, a channel in order to reduce the mass flow of the partial hot-gas flow, and an expansion chamber in order to expand the volume of the partial hot-gas flow. The expansion chamber is a pressure-relief area. The element may, for example, be a guide element, a contact-making element or a sealing element.
US07732725B2	Method and apparatus of classifying fine particles A method of classifying fine particles includes: introducing a fine particle dispersion containing the fine particles to a micro flow channel having an inlet part and a collection part from the inlet part; moving the fine particles to an inner upper side of the micro flow channel by an electric field applied in a gravitational direction; and delivering the fine particle dispersion in a laminar flow state to the collection part. The delivering step includes classifying the fine particles according to differences in settling velocity among the fine particles.
US07732724B2	Detent changeover switch apparatus A detent crest member is integrally rotatably mounted on a dial knob. On the other hand, on a peripheral surface of a plunger mounting member which is rotatably operated using a motor, a plurality of plunger members which generates clicks in a dial knob together with the detent crest member is mounted. In changing over click feeling, the motor is rotated thus selectively bringing one of the plunger members mounted on the plunger mounting member into resilient contact with concave/convex patterns of the detent crest member which form the pair with one plunger member.
US07732717B2	Combination weighing apparatus with dispersion unit for dispersing articles A combination weighing apparatus includes a dispersion unit, a plurality of weighing hoppers, and a combination unit. The dispersion unit circumferentially disperses articles that drop from above. The weighing hoppers are arranged generally circumferentially below the dispersion unit. The combination unit combines weight results obtained from each of the weighing hoppers. In addition, a state of a drop position of the articles in the dispersion unit changes during operation.
US07732716B2	Weighing device and method based on difference measurement The invention provides a weighing device for a production machine or installation and a method for weighing piece goods from a production machine or installation, which can be implemented in a space-saving manner and/or permit processing of piece goods within a large belt width in the format of the piece goods. According to the invention, this is achieved in that the weight of two or more piece goods (7′, 7″) and the weight which is varied by subsequent feeding or discharge of an individual piece good (7″) or a number of piece goods to be jointly weighed are detected from which the weight of an individual piece good (7″) or a number of piece goods to be jointly weighed is determined from the difference between the weights.
US07732715B2	Wall flush mount supporting device for electric or electronic components A wall flush mount supporting device for electric or electronic components. A wall recessed box with a collar has an external cover or finishing plate in perfectly co-planar position with the wall in which the supporting device is recessed. The external surface of the component and the external surface of the finishing plate do not protrude from the frontal edges of the collar.
US07732709B2	Housing for accommodating electrical components A housing is disclosed for accommodating electrical components having a housing lower part, having a conductor feed opening and having a housing cover for covering the housing lower part. In at least one embodiment, the housing is intended to provide the possibility of very convenient fitting and dismantling. The conductor feed opening is provided for the purpose of being delimited by the housing lower part and the housing cover in the closed state of the housing. This obviates the need for the careful threading-in operation when installing a cable on an electrical component in the interior of the housing. In addition, the housing cover delimiting the conductor feed opening is provided with first guide elements, which are provided for engaging in the housing lower part.
US07732708B1	Longitudinal load limiting devices for transmission lines and the like A device for limiting loads on towers that limits loads only in the longitudinal direction and does not affect the manner in which vertical and transverse loads are resisted by the structure. The device incorporates a shield to prevent ice buildup that could affect its operation. It also has optional antifriction bearings to provide a consistent release force independent of the amount of ice that may accumulate on the wires. The device is of simple construction. The device includes an optional energy absorber, such as that used in U.S. Pat. No. 3,211,260 that can provide a resisting force that is within the longitudinal strength of the tower. The device includes both a mechanical fuse and an energy absorbing mechanism that is used to arrest the wire movement. The energy absorber can extend as much as 50 ft to safely absorb the energy released by broken wires with heavy ice coatings.
US07732705B2	Reliable interconnection of solar cells including integral bypass diode A solar cell array including a first solar cell with an integral bypass diode and an adjacent second solar cell and two discrete metal interconnection members coupling the anode of the bypass diode of the first cell with the anode of the second solar cell.
US07732701B2	Electronic musical instrument The electronic musical system comprises a keyboard that has a plurality of keys to designate the pitch, a key operation detector for detecting the operating state of the keyboard, set operator that can switch to the parameter setting state, parameter value input port to input the parameter values, pressed key count detector to detect the number of pressed keys, parameter setting program for setting the parameter value according to the pressed keys detected by the key operation detector. If one key being pressed is detected, then the parameter values are set to the value of the pressed key. If, however, multiple keys being pressed are detected, then the parameter values are set to the value of the multiple pressed keys and parameter output port outputs the parameter values that were set by the parameter setting program. The electronic musical instrument allows the user to intuitively set the parameter values with a effortless operation.
US07732698B2	Electronic keyboard instrument having a key driver An electronic keyboard instrument with a key driver stores automatic performance data including a first event and first timing data and key-driving data including a second event and second timing data that precedes the first timing data for a predetermined time, and reproduces the automatic performance data and the key-driving data in parallel. An event which appears first is detected in the automatic performance data and the key-driving data when the reproduction is started. The automatic performance data and the key-driving data are reproduced rapidly until the detected event and at a normal speed after the detected event.
US07732697B1	Creating music and sound that varies from playback to playback A method and apparatus for the creation and playback of music and/or sound; such that each time a composition is played back, a different sound sequence may be generated. In one embodiment, during composition creation, artist(s) may define how the composition may vary from playback to playback using visually interactive display(s). The artist's definition may be embedded into a composition dataset. During playback, a composition data set may be processed by a playback device and/or a playback program, so that each time the composition is played-back a unique version may be generated. Variability during playback may include: the variable selection of alternative sound segment(s); variable editing of sound segment(s) during playback processing; variable placement of sound segment(s) during playback processing; the spawning of group(s) of alternative sound segments from initiating sound segment(s); and the combining and/or mixing of alternative sound segments in one or more sound channels. MIDI-like variable compositions and the variable use of sound segments comprised of MIDI-like command sequences are also disclosed.
US07732696B1	Instantly playable stringed instrument and method of use thereof An instantly playable stringed instrument having a body, neck and fret spaces is provided. The instrument includes a plurality of strings. The strings are tuned such that in combination the sound they produce is an open E minor chord. The instantly playable stringed instrument may further include a plurality of indicators, each indicator corresponding to one fret space. Each indicator indicates a minor chord to be played by depressing all the strings within the fret space the indicator is associated with. The stringed instrument may further include a minor third string that has a color identification to distinguish it from the rest of the plurality of strings. The minor third string may be depressed on an adjacent fret space thereby converting the minor chord associated with the fret space having all strings depressed to a major chord.
US07732693B2	Resin-formed body including wood powder production method of the same and black key for keyboard musical instrument In order to provide a resin-formed body including wood powder which is applicable to a material for a black key having a good external appearance and which has touch close to real wood with less difference in quality without using rare wood, the resin-formed body including wood powder (1) includes colored wood powder, resin and pigment. Moreover, with respect to the resin-formed body including wood powder (1), it is possible to use a mass ratio between the wood powder and the resin so as to be 90/10-60/40.
US07732692B2	Electronic percussion instrument stand An electronic percussion instrument stand includes a center pipe structure. The center pipe structure has at least one center pipe having a longitudinal axis. A center pipe structure with at least two center pipes provides increased stability. A crescent-shaped base structure supports the center pipe structure in an upright orientation. At least one first arm supports at least one electronic percussion instrument. At least one first joint connects first arm to the center pipe structure. Each joint is adjustable in a direction of the longitudinal axis of the center pipe and in a direction around the longitudinal axis of the center pipe, for adjusting the position of the first arm. Each joint is adjustable between a position for playing electronic percussion instruments supported on the at least one arm, to a retracted position for transportation.
US07732689B1	Foldable and height adjustable support for musical instrument used in seated position One embodiment of a foldable and height adjustable playing support for musical instrument that supports an instrument such as a guitar in the playing position while the musician is in the seated position. When in use it supports the instrument's bottom surface with its top instrument supporting surface and its bottom portion, the body contacting surface, rests on the performer's thigh. The support provides the performer various height adjustments to achieve the most comfortable playing position. When not in use it can be flattened to a form that is easy to carry and travel with.
US07732687B2	Stringed instrument fretboard for use with light-system A fingerboard (or fretboard) for use with a stringed instrument and light-system is disclosed and has a bottom surface adapted to mate or be attached to a neck of the instrument, and has wells extending from the bottom surface toward, but not through, a top surface. The wells are sized to receive a light-emitting device, such as LEDs, and are positioned along the fingerboard according to finger positions of the instrument. Illumination from the light-emitting devices is visible to a player of the instrument, however, when the devices are not illuminated, the fingerboard appears substantially as one made without the wells. The structure is useful for learning to play the instrument, while not appearing as a learning device.
US07732685B1	Plants and seeds of corn variety CV827360 According to the invention, there is provided seed and plants of the corn variety designated CV827360. The invention thus relates to the plants, seeds and tissue cultures of the variety CV827360, and to methods for producing a corn plant produced by crossing a corn plant of variety CV827360 with itself or with another corn plant, such as a plant of another variety. The invention further relates to corn seeds and plants produced by crossing plants of variety CV827360 with plants of another variety, such as another inbred line. The invention further relates to the inbred and hybrid genetic complements of plants of variety CV827360.
US07732684B2	Plants and seeds of corn variety CV886161 According to the invention, there is provided seed and plants of the corn variety designated CV886161. The invention thus relates to the plants, seeds and tissue cultures of the variety CV886161, and to methods for producing a corn plant produced by crossing a corn plant of variety CV886161 with itself or with another corn plant, such as a plant of another variety. The invention further relates to corn seeds and plants produced by crossing plants of variety CV886161 with plants of another variety, such as another inbred line. The invention further relates to the inbred and hybrid genetic complements of plants of variety CV886161.
US07732681B1	Inbred corn line G07-NPDI3004 Basically, this invention provides for an inbred corn line designated G07-NPDI3004, methods for producing a corn plant by crossing plants of the inbred line G07-NPDI3004 with plants of another corn plant. The invention relates to the various parts of inbred G07-NPDI3004 including culturable cells. This invention also relates to methods for introducing transgenic transgenes into inbred corn line G07-NPDI3004 and plants produced by said methods.
US07732676B2	Soybean variety D5236984 The invention relates to the soybean variety designated D5236984. Provided by the invention are the seeds, plants and derivatives of the soybean variety D5236984. Also provided by the invention are tissue cultures of the soybean variety D5236984 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety D5236984 with itself or another soybean variety and plants produced by such methods.
US07732670B1	Soybean cultivar S06-CL056534 The present invention is in the field of soybean variety S06-CL056534 breeding and development. The present invention particularly relates to the soybean variety S06-CL056534 and its progeny, and methods of making S06-CL056534.
US07732669B2	Regulatory sequences for regulation of gene expression in plants and other organisms, and compositions, products and methods related thereto The invention relates to regulatory sequences that regulate gene expression in the mesocarp and/or senescent leaves of certain plants. In certain embodiments, the invention is directed to abundant and selective expression of type 3 metallothionein-like genes in the mesocarp of a variety of plants including members of the Palme family. The invention also relates to methods of generating transgenic plants and plant tissues that comprise a nucleic acid of the invention. The invention further provides products derived from transgenic plants, plant materials or plant cells of the invention. Particular applications in oil palms are discussed. The invention further relates to nucleic acid constructs of the invention in cells of organisms other than plants.
US07732666B1	O-methyltransferase gene from sorghum cloning, expression, transformation and characterization This invention relates to an O-methyltransferase gene cloned from sorghum, the sorghum O-methyltransferase-3 gene, SbOMT3. Quantitative real-time RT-PCR and recombinant enzyme studies with putative O-methyltransferase sequences obtained from an EST data set from sorghum have led to the identification of the novel root hair-specific O-methyltransferase designated SbOMT3. Transgenic plants which express SbOMT3 can convert resveratrol into pterostilbene in planta. SbOMT3 is also involved in the biosynthesis of sorgoleone.
US07732665B2	Method for the preparation of transgenic plants characterised by geminivirus lasting resistance The present invention relates to a method for the preparation of transgenic plants, tissues or plant cells thereof having long-lasting resistant to the geminiviruses by a) “identification” or “selection” of a viral gene sequence encoding an amino acid sequence able to confer resistance against geminiviruses; b) mutagenesis or “choice” of the viral gene sequence so as to make it an ineffective target of the post-trascriptional silencing induced by infecting geminivirus; and c) insertion of the geminivirus mutated or chosen gene sequence obtained in step b) through a construct as described previously, in the plant, tissue or plant cell thereof.
US07732663B2	Cyclin-dependent kinase inhibitors as plant growth regulators Methods for using cyclin-dependent kinase (CDK) inhibitor genes, or anti-sense constructs complementary to such genes, to modify the growth and development of plant cells and organs are disclosed. Also provided are methods of modifying the development of plant cells and plants by transforming plant cells with nucleic acids encoding cyclin-dependent kinase inhibitor polypeptides, or anti-sense constructs complementary to such nucleic acids, to produce transformed plant cells, and then culturing the plant cells or regenerating a plant under conditions wherein the cyclin-dependent kinase inhibitor, or the anti-sense construct, is expressed. A variety of CDK inhibitor genes, and corresponding anti-sense constructs, are disclosed for use in a variety of plants. The nucleic acid encoding the cyclin-dependent kinase inhibitor may be operably linked to a tissue-specific promoter. Other provided aspects are modified transgenic plants and plant tissues. Also provided are methods of identifying nucleic acids that encode cyclin-dependent kinase inhibitors that are active in plants to modify the development of the plant.
US07732662B2	Method for the transformation of plant cell plastids Novel compositions and methods useful for genetic engineering of plant cells to provide a method of producing plastid transformed plants are provided in the instant invention. In particular, the present invention provides methods for obtaining plastid transformed plants on medium containing plastid lethal compounds.
US07732658B2	Composition and method for imaging cells The invention relates to compositions containing a polynucleotide encoding for a reporter gene, a selectable marker and a regulatory element, that provide a method for imaging cells in vivo.
US07732657B2	Absorbent article with lotion-containing topsheet A sanitary napkin comprising a topsheet having a body-facing side and comprising a plurality of discrete tufts of fibrous material. The topsheet has a lotion composition applied to at least a portion of the body-facing side thereof. An absorbent core is in fluid communication with the topsheet, the absorbent core having an average thickness of less than about 10 mm, and a free absorbent capacity of from about 4 to about 125 grams per gram.
US07732656B2	Minimal contact treatment device A tissue treatment device has a flexible treatment portion that includes one or more parts and holes arranged in an openwork. A treatment area is defined in the openwork. The treatment portion is deployed such that the treatment area is positioned over tissue to be treated. The openwork minimizes contact between the tissue treatment device and the tissue being treated. A flexible cover is secured against the flexible treatment portion to close the holes and form a treatment volume in the openwork. The minimal contact between the tissue treatment device and the tissue being treated promotes a desired clinical objective.
US07732655B2	Controlled release therapeutic wound dressings A wound dressing comprising: a therapeutic agent selected from the group consisting of antimicrobial substances, pain relieving substances, protease inhibitors, and mixtures thereof; and a barrier layer for initially separating the therapeutic agent from a wound fluid in use, wherein the barrier layer comprises a substrate for an enzyme selected from the group consisting of proteases, kallikrein and tissue-plasminogen activator. Preferably the substrate comprises a substrate for elastase or a collagenase. The barrier layer breaks down in infected or chronic wounds, thereby releasing the therapeutic substance selectively into such wounds.
US07732654B2	Oligomerizing and alkylating with an ionic liquid at a molar ratio of olefin to isoparaffin of at least 0.8 We provide a process for making a fuel or lubricant component, comprising: performing alkylation and oligomerization by contacting a stream comprising one or more olefins and one or more isoparaffins, wherein a molar ratio of the one or more olefins to the one or more isoparaffins in the stream is at least 0.8, an acidic chloroaluminate ionic liquid catalyst, and a halohalide; and recovering the fuel or lubricant component having a Bromine Number of less than 4. We provide a process comprising performing concurrent alkylation and oligomerization. We also provide a process for making a lubricant component having a kinematic viscosity at 100° C. of at least 6.9 mm2/s, a VI of at least 134, a cloud point less than or equal to −28° C., and a Bromine Number of less than or equal to 6.1.
US07732649B2	Process for the manufacturing of 1,2-dichloroethane Process for the manufacture of 1,2-dichloroethane starting with a hydrocarbon source according to which: a) the hydrocarbon source is subjected to cracking which produces a mixture of products containing ethylene and other constituents; b) the said mixture of products is separated into a fraction enriched with compounds which are lighter than ethylene, containing part of the ethylene (fraction A), into a fraction enriched with ethylene (fraction B) and into a heavy fraction (fraction C); c) fraction A is conveyed to a chlorination reactor and fraction B to an oxychlorination reactor, in which reactors most of the ethylene present in fractions A and B is converted to 1,2-dichloroethane; d) the 1,2-dichloroethane obtained is separated from the streams of products derived from the chlorination and oxychlorination reactors.
US07732644B2	Process for producing α,β-unsaturated aldehyde compounds The present invention relates to processes for producing α,β-unsaturated aldehyde compounds and unsaturated alcohols with a good yield. There is provided a process for producing and α,β-unsaturated aldehyde compound including the step of subjecting a raw aldehyde compound to an intermolecular condensation reaction in the presence of an amine and a protonic acid having 4 to 20 carbon atoms or a salt thereof; and a process for producing an unsaturated alcohol including the step of subjecting the α,β-unsaturated aldehyde compound to a reduction reaction.
US07732640B2	Process for urea production from ammonia and carbon dioxide A process for urea production comprises a first process step in which ammonia (7) and carbon dioxide (6) are obtained, subjecting natural gas (1) to reforming treatments (12, 14), and a second step of urea (8a) production from such ammonia (7) and from carbon dioxide, through a formation of a solution comprising urea and ammonium carbamate in a urea synthesis reactor (20) and a subsequent decomposition of the ammonium carbamate and. urea recovery, the process comprises the steps of:—treating combustion smokes (5) comprising carbon dioxide with an aqueous solution (9a) comprising a part (7b) of such ammonia (7), obtaining an aqueous ammonium carbamate solution (9c);—supplying the solution (9c) thus obtained to the second process step.
US07732637B2	Acylamide compounds having secretagogue or inducer activity of adiponectin The present invention provides an acylamide compound of the following formula (1), prodrugs thereof, or pharmaceutically acceptable salts thereof; and an adiponectin inducer or secretagogue, therapeutic agent of metabolic syndromes, therapeutic agent of hypoadiponectinemia, therapeutic agent of hyperlipemia, preventive/therapeutic agent of diabetes, improving agent of impaired glucose tolerance, improving agent of insulin resistance, enhancing agent of insulin sensitivity, therapeutic agent of hypertension, preventive/therapeutic agent of vascular disorders, an anti-inflammatory agent, therapeutic agent of hepatic inflammation, therapeutic agent of fatty liver, therapeutic agent of hepatic fibrosis, therapeutic agent of liver cirrhosis, preventive/therapeutic agent of non-alcoholic/nonviral steatohepatitis (NASH) or non-alcoholic/nonviral fatty liver disease (NAFLD), or therapeutic agent of obesity, each of which has the above compounds as an active ingredient.
US07732634B2	Hydrogenation processes The present invention is directed to a process for hydrogenating one or more organic compounds especially unsaturated organic compounds by bringing the compound into contact with a hydrogen-containing gas in the presence of a catalyst, which comprises one or more catalytically active metals applied to a porous catalyst support. The one or more catalytically active metals having been derived via a decomposed organic complex of the metal on the support, in particular amine complexes of the metal. The decomposed complex may be treated with hydrogen to activate the catalyst before use as a hydrogenation catalyst.
US07732631B2	Eco-friendly process for the preparation of 2-Chlorobenzylidene-Malononitrile (CS) An improved process for the preparation of 2-chlorobenzylidenemalononitrile (CS) comprising of the steps of: preparing malononitrile suspension by adding 5-20% (wt %) preferably 12-14% malononitrile to water while constantly stirring and then adding 0.05-0.5% (v/v) preferably 0.1-0% of a catalyst like piperidine, pyridine, 2-picoline, 3-picoline, 4-picoline or morpholine preferably piperidine piperidine with constant stirring at 20-30° C.; condensing the malononitrile suspension prepared in step (a) with 2-chlorobenzaldehyde by adding 10-15% (w/v) preferably 25-30%, of 2-chlorobenzaldehyde cover a period at 30-45 minutes so that the temperature of the reaction mixture remains below 50° C., constantly stirring for 20-40 minutes, then filtering the CS and drying it at 20-30° C. under water vacuum for 3-5 hrs.
US07732630B2	Process for the preparation of an alkanediol and a dialkyl carbonate An alkanediol and a dialkyl carbonate are prepared in a process comprising: (a) reacting an alkylene carbonate and an alkanol feedstock in a reaction zone under transesterification conditions to obtain a product mixture of dialkyl carbonate, unconverted alkanol, the alkanediol, and unconverted alkylene carbonate; (b) separating dialkyl carbonate and unconverted alkanol from the product mixture to obtain a bottom product stream containing alkanediol and unconverted alkylene carbonate; (c) recovering the dialkyl carbonate; and (d) separating alkanediol from the bottom product stream to leave a recycle stream comprising unconverted alkylene carbonate, wherein the recycle stream comprising unconverted alkylene carbonate is split in at least two portions, and at least one portion is recycled to the reaction zone and another portion is subjected to hydrolysis to yield alkanediol and carbon dioxide.
US07732629B2	Process for the preparation of diaryl carbonate The invention relates to a process for the preparation of a diaryl carbonate by transesterification of an aromatic alcohol with a dialkyl carbonate in the presence of a transesterification catalyst during a period of time [ta], in which the aryl moiety is selected from unsubstituted phenyl and mono-, di- and trisubstituted phenyl groups, in which the alkyl moiety is selected from C2 to C4 linear and branched alkyl groups, in which the catalyst concentration is designated [ca], expressed as gram catalyst per gram of aromatic alcohol and dialkyl carbonate, in which the period of time [tm] and catalyst concentration [cm] are determined to arrive at a pre-set approach to the equilibrium for the transesterification of the aromatic alcohol with dimethyl carbonate to methyl aryl carbonate and methanol, in which the product [ca]ta is at least 1.5[cm]*tm under otherwise the same reaction conditions.
US07732625B2	Colorant compounds Rhodamine, thio-rhodamine, acridine, and carbopyronin compounds of the formula wherein M is either (1) a metal ion having a positive charge of +y wherein y is an integer which is at least 2, said metal ion being capable of forming a compound with at least two chromogen moieties, or (2) a metal-containing moiety capable of forming a compound with at least two chromogen moieties, z is an integer representing the number of chromogen moieties associated with the metal and is at least 2, R1, R2, R3, R4, R5, R6, R7, a, b, c, d, Y, and z are as defined herein, Q− is a COO− group or a SO3− group, A is an organic anion, and CA is either a hydrogen atom or a cation associated with all but one of the Q− groups.
US07732624B2	Process for operating a continuous removal of a target product X in the form of fine crystals A process for continuously removing a target product X in the form of fine crystals from a liquid phase P comprising the target product X and constituents other than the target product X by cooling suspension crystallization in an indirect heat transferer, in which the crystal suspension formed is conducted out of the heat transferer first into a mixed buffer tank and, from there, fed to an apparatus for separating the crystal suspension into crystals and liquid phase, and wherein external measures dissipade the oversaturation of the crystal suspension fed to the buffer vessel with target product X.
US07732623B2	Polymorphic form of atorvastatin calcium The present invention relates to atorvastatin calcium, a useful agent for lowering serum cholesterol levels. New atorvastatin calcium Form V, processes for preparing the new form, and pharmaceutical compositions and dosage forms containing the new form are disclosed.
US07732620B2	Process for crystallization of Ramipril and preparation of a hydrated form thereof The present invention relates to a novel method for obtaining (2S,3aS,6aS)-1-[(S)-2-[[(S)-1-(ethoxycarbonyl)-3-phenylpropyl]-amino]propanoyl]octahydro cyclopenta[b]pyrrole-2-carboxylic acid, viz. Ramipril(I) in high optical purity, free of other stereoisomers, and in high bulk density. The present invention also relates to a novel hydrated form of Ramipril(I) and a process for preparation thereof.
US07732618B2	Benzimidazole acetic acids exhibiting CRTH2 receptor antagonism and uses thereof The invention relates to benzimidazole acetic acid compounds which function as antagonists of the Chemoattractant Receptor-homologous molecule expressed on T-Helper type 2 cells (CRTH2) receptor. The invention also relates to the use of these compounds to inhibit the binding of prostaglandin D2 and its metabolites or certain thromboxane metabolites to the CRTH2 receptor and to treat disorders responsive to such inhibition.
US07732617B2	Tocopherol derivatives and uses thereof Tocopherol derivatives having the general formula: wherein n is an integer of 6 to 13, R1 is hydrogen, a silyl ether or acetate, R2 is an optionally substituted nitrogen-containing heterocycle or a polycyclic nitrogen-containing heterocycle; and pharmaceutically acceptable salts thereof are provided. A method for synthesizing the compounds is also provided. The tocopherol derivatives are capable of inhibiting the primary enzyme responsible for the metabolism of the tocopherols and tocotrienols compounds of vitamin E, namely tocopherol-ω-hydroxylase, and thus increase the amount and prolong the availability of these compounds in plasma and tissue.
US07732616B2	Dihydropyridine and dihydropyridazine derivatives as inhibitors of MEK and methods of use thereof Disclosed are compounds of the Formulas I and V and pharmaceutically acceptable salts and prodrugs thereof, wherein R1, R2, R7, R8 and R9, W, X and Y are as defined in the specification. Such compounds are MEK inhibitors and useful in the treatment of hyperproliferative diseases, such as cancer and inflammation, in mammals, and inflammatory conditions. Also disclosed are methods of using such compounds in the treatment of hyperproliferative diseases in mammals and pharmaceutical compositions containing such compounds.
US07732615B2	N-(4-fluorobenzyl)-N-(1-methylpiperidin-4-yl)-N′-(4-(2-methylpropyloxy)phenylmethyl)carbamide and its tartrate salt and crystalline forms Disclosed herein are methods for synthesizing N-(4-fluorobenzyl)-N-(1-methylpiperidin-4-yl)-N′-(4-(2-methylpropyloxy)-phenylmethyl)carbamide. Also disclosed herein is the hemi-tartrate salt of N-(4-fluorobenzyl)-N-(1-methylpiperidin-4-yl)-N′-(4-(2 -methylpropyloxy)-phenylmethyl)carbamide and methods for obtaining the salt. Further disclosed are various crystalline forms of N-(4-fluorobenzyl)-N-(1-methylpiperidin-4-yl)-N′-(4-(2-methylpropyloxy)-phenylmethyl)carbamide and its hemi-tartrate salt including various polymorphs and solvates.
US07732609B2	5-(arylsulfonyl)-pyrazolopiperidines The invention provides N-cyclic sulfonamido compounds of Formula I wherein A, B, R1, R1a, R2, R2a, R3 and R3a are as described in the specification. Compounds of Formula I are useful in treating or preventing cognitive disorders, such as Alzheimer's disease. The invention also encompasses pharmaceutical compositions comprising compounds of Formula I, methods of preparing compounds of formula I, and methods of treating cognitive disorders, such as Alzheimer's disease.
US07732608B2	Salts of clopidogrel and process for preparation Disclosed are salts of Clopidogrel viz. Clopidegrel mesylate, Clopidegrel besylate and Clopidogrel tosylate, methods for their preparation and pharmaceutical compositions containing them and their use in medicine.
US07732606B2	Light-emitting device An organic electroluminescent device having a pair of electrodes and at least one organic layer including a light-emitting layer interposed between the pair of electrodes, in which the organic layer contains at least one platinum complex compound having a quadridentate ligand containing a partial structure represented by formula (I): wherein Z1 represents a nitrogen-containing heterocycle coordinated to the platinum through a nitrogen atom; L1 represents a single bond or a linking group; R1, R3 and R4 each independently represent a hydrogen atom or a substituent; and R2 represents a substituent.
US07732604B2	Triazolopyrazine derivatives The invention relates to compounds of the formula I or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3 and R4 are as defined herein. The invention also relates to pharmaceutical compositions containing the compounds of formula I and to methods of treating hyperproliferative disorders in a mammal by administering the compounds of formula I.
US07732603B2	Organic compounds as agents for the treatment of aldosterone mediated conditions Compounds of formula I provide pharmacological agents which are inhibitors of the P450 enzyme, aldosterone synthase, and thus may be employed for the treatment of aldosterone mediated conditions. Accordingly, the compounds of formula I may be employed for prevention, delay of progression, or treatment of hypokalemia, hypertension, congestive heart failure, renal failure, in particular, chronic renal failure, restenosis, atherosclerosis, syndrome X, obesity, nephropathy, post myocardial infarction, coronary heart diseases, increased formation of collagen, fibrosis, and remodeling following hypertension and endothelial dysfunction. Preferred are the compounds of formula I which are selective inhibitors of aldosterone synthase devoid of undesirable side effects due to general inhibition of cytochrome P450 enzymes.
US07732602B2	Herbicide composition The present invention relates to an herbicide composition comprising, as active ingredients, a uracil compound represented by the following formula (I): wherein Z represents halogen or cyano; A represents oxygen, sulfur or NH; R1 represents hydroxyl, C1-C7 alkoxy or others, and R2 represents hydrogen or methyl, and one or more organophosphorus compounds selected from the group consisting of N-(phosphonomethyl)glycine, agriculturally acceptable salts of Glyphosate and ammonium DL-homoalanine-4-yl(methyl)phosphinate; and a method for controlling weeds which comprises applying an effective amount of said herbicide composition to weeds. According to the invention, particularly weeds in orchards, cornfields, soybean fields, cotton fields and non-crop lands can be effectively controlled.
US07732601B2	Crystalline polymorphs of methanesulfonic acid addition salts of Imatinib This invention relates to the methanesulfonic acid addition salts of Imatinib and to the synthesis thereof. In particular, this invention relates to the synthesis of crystalline α-form of Imatinib methanesulfonate. Furthermore, the invention is directed to a novel acid addition salt of 4-(4-methylpiperazin-1-ylmethyl)-N-[4-methyl-3-[(4-pyridin-3-yl)pyrimidin-2-ylamino)phenyl]benzamide with two molecules of methanesulfonic acid and to the polymorphic forms thereof, as well as to their pharmaceutical compositions.
US07732600B2	Quinoline and quinazoline derivatives having affinity for 5HT1-type receptors Disclosed are methods for the preparation of compounds of formula (I): wherein R1, m, X, R2, n, W, p, Y, Z, R3, R4, R5 and q have the meanings as defined in the description.
US07732599B2	Process for preparing tetrahydrobiopterin and analogs of tetrahydrobiopterin Process for the preparation of tetrahydrobiopterin from neopterin and/or 6-substituted pterins with an improved yield and a high stereoselectivity. Also disclosed herein are novel individual intermediates prepared in the preparation of tetrahydrobiopterin, such as selectively protected neopterin useful for the preparation of tetrahydrobiopterin.
US07732586B2	Modified bacteriocins and methods for their use Modified forms of naturally occurring bacteriocins, such as the R-type pyocins of Pseudomonas aeruginosa, are disclosed. The bacteriocins are modified at the ends of their tail fibers in a region responsible for binding specificity and affinity to their cognate binding partners, or receptors, such as those on the surface of bacteria. Methods for the use of the modified bacteriocins, such as to bind receptors, including virulence or fitness factors, on the surfaces of bacteria, are also described.
US07732581B2	Colorant compounds Disclosed is a compound of the formula and dimers thereof, wherein R, R′, X, (Y)m, and (Z)n are as defined herein. The compounds are useful as colorants, particularly in applications such as phase change inks.
US07732579B2	High-affinity monoclonal antibodies for botulinum toxin type A High affinity antibodies for binding epitopes of BoNT/Aand hybridomas that produce such antibodies are described. The antibodies may be used in a kit for detecting BoNT/A in a sample.
US07732577B2	Isolated antibody specific for a mammalian MDM2 binding protein comprising SEQ ID No. 2 or 4 Isolated nucleic acid sequences encoding mammalian MDM2 binding protein and polypeptide sequences for the mammalian MDM2 binding protein are provided. Also provided are vectors containing these nucleic acid sequences, host cells which express these proteins and antibodies targeted to these proteins. In addition, methods and compositions for modulating the G1 phase of the cell cycle via altering expression and/or activity of a mammalian MDM2 binding protein are provided.
US07732576B2	Tumor suppressor designated TS10Q23.3 A specific region of chromosome 10 (10q23.3) has been implicated by series of studies to contain a tumor suppressor gene involved in gliomas, as well as a number of other human cancers. One gene within this region was identified, and the corresponding coding region of the gene represents a novel 47 kD protein. A domain of this product has an exact match to the conserved catalytic domain of protein tyrosine phosphatases, indicating a possible functional role in phosphorylation events. Sequence analyses demonstrated the a number of exons of the gene were deleted in tumor cell lines used to define the 10q23.3 region, leading to the classification of this gene as a tumor suppressor. Further analyses have demonstrated the presence of a number of mutations in the gene in both glioma and prostate carcinoma cells. Methods for diagnosing and treating cancers related to this tumor suppressor, designated as TS10q23.3, also are disclosed.
US07732569B2	Zein-based peptide tags for the expression and purification of bioactive peptides Zein-based peptide tags, referred to here as inclusion body tags (IBTs), are disclosed useful for the generation of insoluble fusion peptides. The fusion peptides comprise at least one inclusion body tag operably linked to a peptide of interest. Expression of the fusion peptide in a host cell results in a product that is insoluble and contained within inclusion bodies in the cell and/or cell lysate. The inclusion bodies may then be purified and the protein of interest may be isolated after cleavage from the inclusion body tag.
US07732567B2	Methods and compositions for modulating and detecting wisp activity Methods and compositions for use in modulating the activity(s) of WISP-1 polypeptide are provided. WISP-1 antagonists include anti-WISP-1 antibodies, WISP-1 immunoadhesins and WISP-1 variants (and fusion proteins thereof) which inhibit or neutralize induction or secretion of HAS2, HA, CD44 or RHAMM by native human WISP-1 polypeptide in at least one type of mammalian cell. The invention also provides methods for in vitro, in situ, and/or in vivo diagnosis and/or treatment of mammalian cells or pathological conditions associated with native WISP-1 polypeptides.
US07732564B2	Serum tumor marker in rodent prostate cancer models The present invention relates to a rodent serum marker for prostate cancer comprising b-microseminoprotein (PSP94) and diagnostic methods thereof. The present invention also relates to a recombinant sequence to raise a ligand of a specific binding affinity to a rodent serum marker for prostate cancer, which comprises the following amino acid sequence: (SEQ ID NO: 1) MGGSHHHHHHGMASMTGGGGMGRNTRYDDDDKDRWGSWVCSIENREIFPN QMSDDCMDADGNKHFLNTPKKNCTWCSCDKTSITCCTNATPLSYDKDNCD VQFHPENCTYSVVDRKNPGKTCRVDSWTM.
US07732558B2	Dendritic compound and use thereof A dendritic compound of the following structure: PDn-Z-L is disclosed. In the structure above, P is X—(CH2CH2—O)r—, r is an integer ranging from 1000 to 4000, X is OH, NH2, or OR, R is C1 to C10alkyl, Dn is a residue of branched C3 to C30 polyol compounds, n is the quantity of layers of the residue of branched compounds and is an integer equal to or greater than 1, L is a metal cation, Z is the residue of a C3 to C30 compound with multi functional groups. The functional groups illustrated above can be carboxylic groups, amino groups, amide groups, or chelating groups. The carboxylic groups, ester groups, amino groups, or amide groups bind to Dn, and the chelating groups bind to the metal cations.
US07732554B2	Process for preparing a curable silylated polyurethane resin The present invention relates to a process for the production of silylated polyurethane resins free of unreacted residual isocyanate possessing consistent viscosity and stability and products therefrom.
US07732551B2	Post-treatment for polymer pellets A continuous process for minimizing the agglomeration of freshly manufactured polyolefin pellets comprising the steps of: feeding an aqueous stream containing polyolefin pellets to a tower, cooling said polyolefin pellets during their upward flow along said tower by means of a downward flow of a cooling agent having a density higher than said polyolefin, collecting the cooled pellets from the top of said tower after a residence time in the tower comprised between 2 and 20 minutes.
US07732549B2	Multi-branched polymer The aim of the present invention is to provide a multi-branched polymer, in which branch terminals can be easily modified and which have a high degree of branching and narrow dispersion. By polymerizing a compound having 2 or more polymerization-initiation sites and polymerizable unsaturated bonds with a living radical polymerization method using a metal catalyst, it is possible to produce a multi-branched polymer with narrow dispersion and a high degree of branching and having repeating units represented by the formula (I): wherein R1 to R3 each independently represents hydrogen or a hydrocarbon group, R1 may be bonded to R3 to form a ring; X represents a connecting group having a valence of 3 or higher; Y may be the same or different and each represents a functional group which may have a halogen atom at a terminal thereof; and a is an integer of 2 or larger.
US07732548B2	Water-soluble sulfonic group-containing copolymers and terpolymers the production thereof and water-based painting and coating systems Water-soluble copolymers and terpolymers as stabilizers for aqueous building material systems and water-based paint and coating systems are described. Advantages of the copolymers and terpolymers used according to the invention compared to conventional products are firstly the very good stabilizing properties of the building material systems or water-based paint and coating systems produced correspondingly and secondly the fact that the viscosity of the systems is barely increased, so that these have excellent processability.
US07732544B2	Titanium compound and process for producing optically active cyanohydrins The present invention relates to a titanium compound produced from a reaction mixture of a titanium tetraalkoxide compound with water and an optically active ligand represented by the following general formula (1), or a titanium oxoalkoxide compound and an optically active ligand represented by the following general formula (1), wherein, in the formula, R2, R3 and R4 independently represent a hydrogen atom, an alkyl group or the like, and A* represents a hydrocarbon-containing group with three or more carbon atoms having an asymmetric carbon atom or axial asymmetry. The invention further relates to a process for producing optically active cyanohydrins which is characterized by reacting a carbonyl compound with a cyanating agent in the presence of such a titanium compound.
US07732543B2	Siloxanes and silanes cured by organoborane amine complexes Curable compositions contain (i) a free radical polymerizable organosilicon monomer, oligomer or polymer; (ii) an organoborane amine complex; optionally (iii) an amine reactive compound having amine reactive groups; and optionally (iv) a component capable of generating a gas when mixed with a compound bearing active hydrogen and a catalyst. The curable compositions can be used as a rubber, tape, adhesive, foam, pressure sensitive adhesive, protective coating, thin film, thermoplastic monolithic molded part, thermosetting monolithic molded part, sealant, gasket, seal, or o-ring, die attachment adhesive, lid sealant, encapsulant, potting compound, or conformal coating. The compositions can also be used in composite articles of manufacture such as integrally bonded device including electrical and electronic connectors and scuba diving masks, in which substrates are coated or bonded together with the composition and cured.
US07732541B2	Polymers comprising in their skeleton an endo ethylenic unsaturation, and preparation processes therefor The invention relates to polymers comprising a sequence of units comprising an ethylenic unsaturation, the unsaturation being located every 3 carbon atoms between two successive units.The invention also relates to processes for preparing such polymers.
US07732537B2	Methods addressing aging in flocculated molecular sieve catalysts for hydrocarbon conversion processes One aspect of the invention relates to a method for formulating a molecular sieve catalyst composition, the method comprising the steps of: (a) providing a synthesized molecular sieve having been recovered in the presence of a flocculant; (b) thermally treating the synthesized molecular sieve at a temperature from about 50° C. to about 250° C. and under other conditions sufficient to form a thermally treated synthesized molecular sieve having a first LOI less than 26% and a first micropore surface area; (c) aging the thermally treated synthesized molecular sieve for at least one year; (d) analyzing the aged, thermally treated molecular sieve to determine a second micropore surface area, wherein the second micropore surface area is 3% or less lower than the first micropore surface area; and (e) combining the aged, thermally treated synthesized molecular sieve, a binder, and optionally a matrix material to produce an aged, formulated molecular sieve catalyst composition.
US07732535B2	Coating for controlled release of drugs from implantable medical devices A coating for an implantable medical device comprising modified poly(ethylene-co-vinyl alcohol).
US07732534B2	Polymers functionalized with nitro compounds A method for preparing a functionalized polymer, the method comprising the steps of (i) polymerizing conjugated diene monomer by employing a lanthanide-based catalyst to form a reactive polymer, and (ii) reacting the reactive polymer with a nitro compound.
US07732531B2	Molded object process for producing the same product for high-frequency signal transmission and high-frequency transmission cable The present invention provides a molded article comprising a polytetrafluoroethylene resin (A) and a thermoplastic resin (B) having a melting point of not lower than 100° C. but lower than 322° C., wherein the maximum peak temperature of the endothermic curve appearing on the crystal melting curve of the above polytetrafluoroethylene resin (A) as measured by a differential scanning calorimeter is higher by at least 3° C. than the maximum peak temperature of the endothermic curve appearing on the crystal melting curve of the above polytetrafluoroethylene resin (A) after heating to a temperature of not lower than 340° C. as measured by the differential scanning calorimeter.
US07732529B2	Thermoplastic elastomer composition and molded article The present invention provides an acrylic block copolymer composition improving melt flowability at molding and being excellent in heat resistance in addition to keep weather resistance, chemical resistance, adhesion property, flexibility and abrasion resistance which are the characteristics of the acrylic block copolymer. It is attained by a thermoplastic elastomer composition comprising an acrylic block copolymer (A) which comprises a methacrylic polymer block (a) and an acrylic polymer block (b), wherein at least one of polymer blocks among the methacrylic polymer block (a) and the acrylic polymer block (b) has an acid anhydride group and/or a carboxyl group, and an acrylic polymer (B) having 1.1 or more of epoxy groups in one molecule.
US07732528B2	Water-absorbent crosslinked polymers Water-absorbent crosslinked polymers bearing acid groups, some or all of the acid groups being present as carboxylate groups having at least two different types of cations as counterions, processes for their preparation and mixtures of water-absorbent crosslinked polymers.
US07732527B2	Water-soluble polymers reduced in molecular weight, process for production thereof and usage thereof The invention relates to water-soluble polymers reduced in molecular weight, a process for production of the same, and usage thereof. It makes it possible to obtain water-soluble polymers reduced in molecular weight by a simple procedure and in an economical and simple manner by subjecting either an aqueous solution admixed with an aqueous solution of an oxidizing agent and containing an amount within the range of 10-60% by mass of a water-soluble polymer and having a viscosity of not lower than 3000 mPa·s or a granular composition admixed or impregnated with an aqueous solution of an oxidizing agent and containing an amount within the range of 10-60% by mass of a water-soluble polymer to oxidation reaction, not by the method of polymerization at elevated temperatures, which is an energy-consuming method, or by the method of polymerization using large amounts of a chain transfer agent and/or an initiator, which is one of the raw materials, and these water-soluble polymer reduced in molecular weight can be used fixing agents for improving the water resistance and/or light fastness of printed matters and, further, the solution viscosity of this water-soluble polymer reduced in molecular weight can be adjusted, hence the handleability thereof, among others, can be adjusted, by incorporating a water-soluble salt and/or a polymer additive in these water-soluble polymers reduced in molecular weight to give compositions comprising the water-soluble polymer reduced in molecular weight.
US07732526B2	Silicone binders for investment casting A green product for use in fabricating a ceramic article comprises a ceramic powder immobilized within a silicone matrix, wherein the silicone matrix comprises one or more cross linked or polymerized silicone monomers and/or oligomers, wherein the one or more cross linked or polymerized silicone monomers and/or oligomers have a alkenyl reactive functional group and a hydride reactive functional group. Processes for forming a green product and a ceramic core with the silicone monomers and/or oligomers are also disclosed.
US07732524B2	Elastomer composition, method for producing the same, and eraser using the same An elastomer composition is provided which contains a matrix of biomass plastic and crosslinked natural rubber particles dispersed like islands in the matrix. An eraser using the elastomer composition is also provided. The present invention is capable of providing an elastomer composition and eraser using the same, which can be recycled, are friendly to the environment, and corresponds to the recycling society, without relying on fossil resources.
US07732522B2	Silica containing black sidewall compounds and tires comprising same Reduced hysteresis silica-containing black sidewall compounds having increased toughness properties are provided, as are methods for preparing the same. Tires comprising the black sidewall compounds prepared according to the present embodiments are also provided.
US07732520B2	Resin composition It is an object of the present invention that a resin composition which has high chemical resistance while retaining high fluidity, is excellent in impact resistance, heat resistance, stiffness and heat stability and comprises an aromatic polycarbonate and polyethylene terephthalate, a molded product thereof and a process of manufacturing a car exterior material.This invention provides the resin composition which comprises 50 to 100 wt % of a resin component and 0 to 50 wt % of an inorganic filler (component D), wherein the resin component is composed of (i) an aromatic polycarbonate (component A) having a specific viscosity average molecular weight and (ii) polyethylene terephthalate (component B) having a specific intrinsic viscosity (IV), a specific terminal carboxyl group content and a specific ratio (Mw/Mn) of weight average molecular weight (Mw) to number average molecular weight (Mn), and (iii) the weight ratio {(A+D)/B} of the total of the components A and D to the component B is 60/40 to 85/15, and a molded product thereof and a process of manufacturing a car exterior material.
US07732518B2	Method for producing polyolefin composition A method for producing a polyolefin composition, which comprises melt-kneading a particulate composition (A) containing a compound represented by formula (1): wherein R1 represents an alkyl group having 1 to 8 carbon atoms, X represents an n-hydric alcohol residue having 1 to 18 carbon atoms which may include a heteroatom and/or a cyclic group, and n is the integer 2 or 4, and a metal soap, and a particulate polyolefin (B), wherein the ratio (a/b) of the average particle diameter (a) of the particulate composition (A) and the an average particle diameter (b) of the particulate polyolefin (B) is adjusted to 3/1 to 1/3, and wherein average particle diameter means the central cumulative value determined from a weight-based particle diameter cumulative distribution for residue on a sieve measured in accordance with JIS K 0069.
US07732517B2	Organosilicon compounds and rubber compositions made by using the same An organosilicon compound having a structure represented by following general formula: R1: methyl group or ethyl group, R2: a branched or linear, saturated or unsaturated aliphatic hydrocarbon group having 3 to 8 carbon atoms, n: 0.5˜2.5 (an average composition), R3: a divalent hydrocarbon group of —CH2—, —CH2CH2—, —CH2CH2CH2—, —CH2CH2CH2CH2—, —CH2CH2CH2CH2CH2—, —CH(CH3)—, —CH2CH(CH3)—, —C(CH3)2—, —CH(C2H5)—, —CH2CH2CH(CH3)— or —CH2CH(CH3)CH2—, X: S, S(C═O)—R4, SH or NH(3−p), and R4: a branched or linear, saturated or unsaturated aliphatic hydrocarbon group having 1 to 30 carbon atoms. When X═S, p=2 and m=1˜10. When X═S(C═O)—R4, p=1 and m=1. When X═SH, p=1 and m=1. When X═NH(3−p), p=1˜3 and m=1. The organosilicon compound simultaneously suppresses discharge of volatile alcohols generated during the reaction with an inorganic filler and exhibits great reactivity with the inorganic filler.
US07732516B2	Flame retardant polyimide/polyester-polycarbonate compositions, methods of manufacture, and articles formed therefrom A composition is disclosed, comprising, based on the total weight of the composition, from 20 to 60 wt. % of a polyimide having a glass transition temperature above 180° C.; from 10 to 30 wt. % a polyester-polycarbonate copolymer; from 30 to 60 wt. % of a reinforcing filler; and at least two flame retardant additives selected from the group consisting of from 0.01 to 0.5 wt. % of a first sulfonate salt, from 0.01 to 0.5 wt. % of a second sulfonate salt, from 0.5 to 5 wt. % of a siloxane copolymer, and combinations thereof. An article molded from the composition attains an improved UL94 rating, as compared to an article molded from the same composition without the at least two flame retardant additives.
US07732515B2	Scratch-resistant flameproof thermoplastic resin composition Disclosed herein is a flame retardant thermoplastic resin composition that has superior scratch resistance and mechanical properties, satisfying requirements for the appearance of housing materials resulting from a recent increase in volume of electrical and electronic products, and that contains a phosphorus-based flame-retarding agent, satisfying requirements for fire safety and prevention of environmental problems. The resin composition with scratch resistance comprises a base resin comprising (A) about 30 to about 90 parts by weight of a polycarbonate resin, (B) about 15 to about 50 parts by weight of a polymethylmethacrylate resin and (C) about 5 to about 50 parts by weight of a polyethylene terephthalate-based resin, and (D) about 5 to about 30 parts by weight of a phosphorus-based flame-retarding agent based on 100 parts by weight of the base resin. The composition may further comprise about 1 to about 30 parts by weight of an impact modifier based on 100 parts by weight of the base resin.
US07732514B2	Filler composites A composition comprising a plastics material, an inorganic particulate solid such as aluminium trihydrate and a coupling modified of formula A-(X—Y—CO)m(O—B—CO)nOH wherein A is a moiety containing a terminating ethylenic group with one or two adjacent carbonyl groups; X is a direct bond, O or N; Y is C1-18-alkylene or C2-18-alkenylene; B is C2-6-alkylene; m is from 1 to 4 and n is from 0 to 5 provided that when A contains two carbonyl groups adjacent to the ethylenic group then X is N. Specific examples of coupling modifiers are β-carboxyl ethylacrylate and 5-carboxy pentyl maleimide.
US07732512B2	Laser light transmitting colored polyolefin resin compositions and process for laser welding Laser ray transmitting colored polyolefin resin composition containing an anthraquinone salt forming dye below; and method of laser welding wherein welding a portion of contact of a laser ray transmitting material of said resin composition and a laser ray absorbing material by irradiating laser ray so that the laser ray transmitting material transmits the laser ray and the laser ray is absorbed in the laser ray absorbing material with the laser ray transmitting material and the laser ray absorbing material in contact with each other: A, B: —NH— or —O—; R1-R3: hydrogen, amino, hydroxy, halogen; R4-R13: hydrogen, alkyl, nitro, sulfonic group; Kin+: organic ammonium ion; m: 1 or 2; n: 1 or 2; the sulfonic group is —SO3 or SO3M, the number of —SO3 being m, M representing hydrogen or an alkali metal.
US07732505B2	Energy ray-curable ink composition An active energy ray-curable ink composition comprising a colorant, a monomer and a photopolymerization initiator, in which the monomer contains an acrylamide derivative in an amount of 10 to 90% by weight based on the whole weight of the ink composition, and the ink composition has a viscosity of 3 to 35 mPa·s at 25° C. The ink composition has a low viscosity without dilution by a diluent solvent, good storage stability, good pigment dispersibility when a pigment is used as a colorant and also good continuous ejection stability to a printing medium, has a good curing property at a low energy level such as a cumulative amount of light of 150 mJ/cm2 or less, and it can attain good printing quality on nonabsorbable printing medium and achieves good adhesion of printed images to the printing medium.
US07732504B2	Functionalized photoinitiators The invention relates to novel photoinitiators of formula (I) wherein each of the substituents is given the definition as set forth in the Specification and the claims. The photoinitiators can be used to prepare multifunctional photoinitiators.
US07732501B2	Fullerene based proton conductive materials A fullerene-based proton conductor including a proton conductive functional group connected to the fullerene by an at least partially fluorinated spacer molecule. Also, a polymer including at least two of the proton conductors that are connected by a linking molecule. Further, an electrochemical device employing the polymer as a proton exchange membrane, whereby the device is able to achieve a self-humidifying characteristic.
US07732495B2	Silica-based sols and their production and use The invention relates to a process for producing aqueous silica-based sols which comprises providing a cationic ion exchange resin having at least part of its ion exchange capacity in hydrogen form; bringing said ion exchange resin in contact with an aqueous alkali metal silicate to form an aqueous slurry; adjusting the pH of the aqueous slurry and separating the ion exchange resin from the aqueous slurry, as well as the silica-based sols obtained by the process.The invention also relates to silica-based sols obtained by the process, as well as a process for producing paper which comprises providing an aqueous suspension comprising cellulosic fibres; adding to the suspension one or more drainage and retention aids comprising a silica-based sol according to the invention; and dewatering the obtained suspension to provide a sheet or web of paper.
US07732493B2	2-substituted D-homo-estra-1,3,5(10)-trienes as inhibitors of 17β-hydroxy steroid dehydrogenase type 1 The invention relates to new 2-substituted D-homo-estra-1,3,5(10)-trienes of general formula I in which R2 means a C1-C8-alkyl group, a C1-C8-alkyloxy group or a halogen atom, R13 means a hydrogen atom or a methyl group, R17 means a hydrogen atom or a fluorine atom, as well as their pharmaceutically acceptable salts, their manufacture and use as medicaments for prophylaxis and therapy of estrogen-dependent diseases that can be influenced by inhibition of 17β-hydroxy steroid dehydro-genase type 1.
US07732491B2	Treatment of breast cancer with a PARP inhibitor alone or in combination with anti-tumor agents In one aspect, the present invention provides a method of treating breast cancer that is negative for at least one of ER, PR, or HER2, comprising administering to a subject at least one PARP inhibitor. In another aspect, the present invention provides a method of treating breast cancer comprising administering to a subject at least one PARP inhibitor in combination with at least one anti-tumor agent.
US07732489B2	Topical emulsion-gel composition comprising diclofenac sodium The invention relates to beneficial topical pharmaceutical compositions comprising diclofenac sodium salt in unusually low amounts. The compositions represent opaque emulsion-gels, in which diclofenac is kept fully dissolved.
US07732487B2	Method for treating a disease or condition responsive to opening of C1C-2 channel Disclosed is a method for prophylactic or therapeutic treatment of a condition or disease responsive to opening of ClC-2 channel, which comprises the step of administrating an effective amount of a ClC-2 channel opener to a subject in need of said treatment. According to the invention, a tissue or organ to be transplanted can also be treated with the ClC-2 channel opener.
US07732486B2	Anhydrous silver dihydrogen citrate compositions Anhydrous silver dihydrogen citrate compositions comprise silver dihydrogen citrate and citric acid. The anhydrous compositions can be prepared by freeze-drying. The anhydrous compositions can be reconstituted with a suitable diluent to form silver dihydrogen citrate compositions. The anhydrous compositions can be reconstituted and applied to a variety of substrates to impart an antimicrobial effect on the substrates.
US07732482B2	Compound from Antrodia camphorata and the use thereof The present invention relates to novel compounds from Antrodia camphorata and the use thereof.
US07732478B2	Methods for facilitating metabolic control The present invention provides methods for facilitating metabolic control in a subject by decreasing the level of Il-1β in the GCF. The present invention further provides methods for decreasing the level of circulating TNF in a subject. Also provided are uses of anti-inflammatory agents in these methods.
US07732477B2	2-heteroarylcarboxylic acid amides The invention relates to novel 2-heteroarylcarboxamides, processes for their preparation, and their use for producing medicaments for the treatment and/or prophylaxis of diseases and for improving perception, concentration, learning and/or memory.
US07732476B2	Leukemia treatment method and composition A method of inducing high anti-leukemia activity responsive to the combination of hydroxamic acid analogue histone deacetylase inhibitors and PKC412 against human acute leukemia characterized as expressing phosphorylated (p)FLT3 kinase by a novel flow cytometry-based assay.
US07732474B2	Pharmaceutical preparation containing a benzimidazole compound mixed with microcrystalline cellulose and a method for its preparation The present invention relates to oral pharmaceutical preparations in the form of pellets in which a benzimidazole compound is stabilized by combining it with microcrystalline cellulose.
US07732472B2	Mitotic kinesin inhibitors The present invention relates to dihydroisoxazoles that are useful for treating cellular proliferative diseases, for treating disorders associated with KSP kinesin activity, and for inhibiting KSP kinesin. The invention also relates to compositions which comprise these compounds, and methods of using them to treat cancer in mammals.
US07732471B2	6-oxazol-4-ylmetholmethoxy-alko-alkoxymethyl substituted benzoic acid derivatives forming peroxisome proliferator—activated receptor (PPAR) ligands, process for their preparation and methods of use thereof The present invention comprises compounds and compositions for the treatment of metabolic disorders and more particularly, those insulin-related metabolic disorders of the blood such as hyperlipidemia, diabetes, insulin-resistance and the like comprising acetic acid derivatives with cyclohexylmethoxy substituents and their salts. Known as peroxisome proliferator-activated receptor (PPAR) agonists/antagonists, the invention relates to compounds of formula I wherein R1-R6 are further defined herein.
US07732470B2	Compositions and methods for the treatment of renal and cardiovascular disease Derivative compounds of 11-nonyloxy-undec-8(Z)-eonic acid that mimic epoxide metabolites are provided. Also provided are compositions comprising a therapeutically effective amount of the derivative compounds. The present invention further provides methods for the use of such compositions for the treatment of renal or cardiovascular disease and/or related conditions.
US07732469B2	Heterocyclic amide derivatives useful as microbiocides The invention relates to a fungicidally active compound of formula (I): where Het is a 5- or 6-membered heterocyclic ring containing one to three heteroatoms, each independently selected from oxygen, nitrogen and sulphur, the ring being substituted by the groups R6, R7 and R8; R1 is hydrogen, C1-4 alkyl, C1-4 haloalkyl, C1-4 alkoxy, C1-4 haloalkoxy, CH2 C≡CR9, CH2 CR10═CHR11, CH═C═CH2 or COR12; R2 and R3 are each, independently, hydrogen, halo, C1-4 alkyl, C1-4 alkoxy, C1-4 haloalkyl or C1-4 haloalkoxy; R4 and R5 are each independently selected from halo, cyano and nitro; or one of R4 and R5 is hydrogen and the other is selected from halo, cyano and nitro; R6, R7 and R8 are each, independently, hydrogen, halo, cyano, nitro, C1-4 alkyl, C1-4 haloalkyl, C1-4 alkoxy(C1-4)alkyl, C1-4 haloalkoxy(C1-4)alkyl or C1-4 haloalkoxy, provided that at least one of R6, R7 and R8 is not hydrogen; R9, R10 and R11 are each, independently, hydrogen, halo, C1-4 alkyl, C1-4 haloalkyl or C1-4 alkoxy(C1-4)alkyl; and R12 is hydrogen, C1-6 alkyl, C1-6 haloalkyl, C1-4 alkoxy(C1-4)alkyl, C1-4 alkylthio(C1-4)-alkyl, C1-4 alkoxy or aryl; to the preparation of these compounds, to novel intermediates used in the preparation of these compounds, to agrochemical compositions which comprise at least one of the novel compounds as active ingredient, to the preparation of the compositions mentioned and to the use of the active ingredients or compositions in agriculture or horticulture for controlling or preventing infestation of plants by phytopathogenic microorganisms, preferably fungi.
US07732467B2	Method for reducing amyloid deposition, amyloid neurotoxicity and microgliosis The present invention provides methods for reducing β-amyloid deposition, β-amyloid neurotoxicity and microgliosis in animals or humans afflicted with a cerebral amyloidogenic disease, such as Alzheimer's disease (AD), by administering therapeutically effective amounts of the dihydropyridine calcium channel antagonist, nilvadipine. The present invention also provides methods for diagnosing cerebral amyloidogenic diseases in animals or humans. Further provided are methods for reducing the risk of β-amyloid deposition, β-amyloid neurotoxicity and microgliosis in animals or humans suffering from traumatic brain injury by administering nilvadipine immediately after the traumatic brain injury and continuing treatment for a prescribed period of time thereafter. Finally, methods are provided for treating transplantable neuronal stem cells by administering nilvadipine to the neuronal stem cells prior to transplantation in the central nervous system of an animal or human afflicted with a cerebral amyloidogenic disease, such as AD.
US07732465B2	Substituted benzimidazoles and methods of their use New substituted benzimidazole compounds, compositions, and methods of inhibition of kinase activity associated with tumorigenesis in a human or animal subject are provided. In certain embodiments, the compounds and compositions are effective to inhibit the activity of at least one serine/threonine kinase or receptor tyrosine kinase. The new compounds and compositions may be used either alone or in combination with at least one additional agent for the treatment of a serine/threonine kinase- or receptor tyrosine kinase-mediated disorder, such as cancer.
US07732462B2	Selective serotonin 2A/2C receptor inverse agonists as therapeutics for neurodegenerative diseases Behavioral pharmacological data with the compound of formula (I), a novel and selective 5HT2A/2C receptor inverse agonist, demonstrate in vivo efficacy in models of psychosis and dyskinesias. This includes activity in reversing MK-801 induced locomotor behaviors, suggesting that this compound may be an efficacious anti-psychotic, and activity in an MPTP primate model of dyskinesias, suggesting efficacy as an anti-dyskinesia agent. These data support the hypothesis that 5HT2A/2C receptor inverse agonism may confer antipsychotic and anti-dyskinetic efficacy in humans, and indicate a use of the compound of formula (I) and related agents as novel therapeutics for Parkinson's Disease, related human neurodegenerative diseases, and psychosis.
US07732456B2	Pyridone derivative The invention provides pyridone derivatives represented by a general formula (I) [in the formula, R1 and R2 may be same or different and stands for H, etc., or R1 and R2 may form an aliphatic nitrogen-containing heterocyclic group together with the N to which they bind; X1-X3 may be same or different and stand for methine or N, provided not all of them simultaneously stand for nitrogen; X4-X7 may be same or different and stand for methine or N, provided that three or more of them do not simultaneously stand for N; Y1 and Y3 may be same or different and stand for single bond, —O—, —NR—, —S—, etc; Y2 stands for lower lkylene, etc.; R stands for H, etc., L stands for methylene; Z1 and Z2 may be same or different and stand for single bond or lower alkylene; or R1, L and Z2 may form an aliphatic nitrogen-containing heterocyclic group with the N to which R1 binds; and Ar stands for aromatic carbocyclic group, etc.].
US07732455B2	Substituted 8-heteroaryl xanthines Selective antagonists of A2B adenosine receptors like those of formula I are provided. These compounds and compositions are useful as pharmaceutical agents.
US07732454B2	Inhibitors of Bruton's tyrosine kinase Disclosed herein are imidazo[1,5-f][1,2,4]triazine compounds that form covalent bonds with Bruton's tyrosine kinase (Btk). The imidazo[1,5-f][1,2,4]triazine compounds described are irreversible inhibitors of Btk. Methods for the preparation of the imidazo[1,5-f][1,2,4]triazine compounds are disclosed. Also disclosed are pharmaceutical compositions that include the imidazo[1,5-f][1,2,4]triazine compounds. Methods of using the imidazo[1,5-f][1,2,4]triazine Btk inhibitors are disclosed, alone or in combination with other therapeutic agents, for the treatment of autoimmune diseases or conditions, heteroimmune diseases or conditions; cancer, including lymphoma, and inflammatory diseases or conditions.
US07732453B2	Pyrido[2,3-B] pyrazin-3(4H)-ones for use as stearoyl CoA desaturase inhibitors The present invention discloses pyrido[2,3-B]pyrazin-3(4h)-ones for use as inhibitors of stearoyl-CoA desaturase. The compounds are useful in treating and/or preventing various human diseases, mediated by stearoyl-CoA desaturase (SCD) enzymes, especially diseases related to abnormal lipid levels, cardiovascular disease, diabetes, obesity, oily skin conditions, metabolic syndrome, and the like.
US07732452B2	Thiophene derivatives which are HM74A agonists The invention is concerned with novel substituted thiophene derivatives of formula (I) wherein R1 to R8, X, m and n are as defined in the description and in the claims, as well as physiologically acceptable salts and esters thereof. These compounds are HM74A agonists and can be used as medicaments.
US07732451B2	Naphthalene-containing melanocortin receptor-specific small molecule A method of modulating energy homeostasis in a mammal without eliciting a sexual response by administration of a therapeutically effective amount of a pharmaceutical composition including a melanocortin receptor compound of the formula: where R1 is a bond or a linker unit including from one to six backbone atoms and an unsubstituted naphthalene group, and L, R2, R3 and Rx are as defined in the specification.
US07732448B2	Pyrimidine compounds and pests controlling composition containing the same The present invention relates to a pyrimidine compound of the formula (I): wherein R1 represents a hydrogen atom, halogen atom or C1-C4 alkyl; R2 represents C3-C7 alkynyloxy; R3 represents a hydrogen atom, halogen atom or C1-C3 alkyl; X represents C4-C7 polymethylene, in which a CH2—CH2 may be replaced with a CH═CH, optionally substituted with at least one substituent selected from the group consisting of halogen atoms, trifluoromethyl and C1-C4 alkyls. This pyrimidine compound has an excellent activity of controlling pests.
US07732447B2	Fused [d]pyridazin-7-ones The present invention is directed to fused [d]pyridazin-7-ones. The invention is also directed to methods for making and using the fused [d]pyridazin-7-ones. In particular, the compounds of the present invention may be effective in the treatment of diseases or disease states related to the activity of VEGFR2, MLK1 and CDK5 enzymes, including, for example, angiogenic disorders and neurodegenerative diseases.
US07732446B1	Dipeptidyl peptidase inhibitors Compounds, pharmaceuticals, kits and methods are provided for use with DPP-IV inhibitors comprising Formulae: where the substituents are as described herein.
US07732445B2	Myosin light chain kinase inhibitor compounds, compostions and related methods of use Pyridazinyl compounds, compositions and related methods of use.
US07732444B2	2-(amino-substituted)-4-aryl pyrimidines and related compounds useful for treating inflammatory diseases A heterocyclic inhibitor having the formula I, with the variables defined herein, which is useful for treating inflammatory and other physiological disorders in which PKC-theta isoform plays a role:
US07732442B2	Chemokine receptor antagonist and medical use thereof The present invention relates to a compound represented by formula (I), a salt thereof, an N-oxide thereof, a solvate thereof or a prodrug thereof, and medical use thereof (the symbols in the formula are as described in the specification). The compound represented by formula (I) has chemokine receptor (especially in CCR4 and/or CCR5) antagonistic activity. Therefore it is useful for prevention and/or treatment of a chemokine receptor-mediated disease such as inflammatory and/or allergic diseases [systemic inflammatory response syndrome (SIRS), anaphylaxis, anaphylactoid reaction, allergic angiitis, transplant rejection reaction, hepatitis, nephritis, nephropathy, pancreatitis, rhinitis, arthritis, inflammatory ocular disease, inflammatory bowel disease, disease in cerebro and/or circulatory system, respiratory disease, dermatosis, autoimmune disease, and the like], infection [viral disease (human immunodeficiency virus infection, acquired immunodeficiency syndrome, SARS, etc.), and the like], and the like.
US07732437B2	Use of anti-histaminics for acute reduction of elevated intracranial pressure The invention concerns a novel histamine receptor antagonist and the use of an histamine receptor antagonist for the reduction of intracranial pressure (ICP), in particular for the prevention and treatment of elevated intracranial pressure and/or secondary ischaemida, in particular caused by brain injury, more in particular caused by traumatic (TBI) and non-traumatic brain injury. The novel compounds comprise compounds according to the general Formula (I) the pharmaceutically acceptable acid or base addition salts thereof, the stereochemically isomeric forms thereof and the N-oxide form thereof. In particular, the preferred compound is 3-[2-[4-(11,12-dihydro-6H-benzimidazo[2,1-b][3]benzazepin-6-yl)-2-(phenyl-methyl)-1-piperidinyl]ethyl]-2,10-dimethyl pyrimido[1,2-α]benzimidazol-4(10H)-one, the pharmaceutically acceptable acid or base addition salts thereof, the stereochemically isomeric forms thereof and the N-oxide form thereof. Also claimed is the novel use of commercially available histamine H1-and H2-receptor antagonists for the reduction of intracranial pressure (ICP).
US07732430B2	Drug delivery system comprising a tetrahydroxilated estrogen for use in hormonal contraception A method of contraception in mammalian females, which method comprises the oral administration of an estrogenic component and a progestogenic component to a female of childbearing capability in an amount effective to inhibit ovulation, wherein the estrogenic component is selected from the group consisting of substances represented by the following formula (1) in which R1, R2, R3, R4 independently are a hydrogen atom, a hydroxyl group or an alkoxy group with 1-5 carbon atoms; each of R5, R6, R7 is a hydroxyl group; and no more than 3 of R1, R2, R3, R4 are hydrogen atoms; precursors capable of liberating a substance according to the aforementioned formula when used in the present method; and mixtures of one or more of the aforementioned substances and/or precursors. Another aspect of the invention concerns a pharmaceutical kit comprising oral dosage units that contain the aforementioned estrogenic component and/or a progestogenic component.
US07732428B1	Surgical compositions and methods of using the same A method of preventing or reducing the incidence of post-operative adhesions in or associated with a body cavity, which comprises introducing into the body cavity a composition containing an aqueous solution or suspension or gel formulation containing the polysaccharide dextrin.
US07732427B2	Multifunctional and biologically active matrices from multicomponent polymeric solutions The present invention relates to a biologically active functionalized electrospun matrix to permit immobilization and long-term delivery of biologically active agents. In particular the invention relates to a functionalized polymer matrix comprising a matrix polymer, a compatibilizing polymer and a biomolecule or other small functioning molecule. In certain aspects the electrospun polymer fibers comprise at least one biologically active molecule functionalized with low molecular weight heparin. Examples of active molecules that may be used with the multicomponent polymer of the invention include, for example, a drug, a biopolymer, for example a growth factor, a protein, a peptide, a nucleotide, a polysaccharide, a biological macromolecule or the like. The invention is further directed to the formation of functionalized crosslinked matrices, such as hydrogels, that include at least one functionalized compatibilizing polymer capable of assembly.
US07732425B2	Pharmaceutical composition for ophthalmic use An ophthalmic pharmaceutical composition comprising trehalose as an effective ingredient and a pharmaceutically-acceptable carrier. The pharmaceutical composition is a safe, long-term continuously-administrable, therapeutic and/or prophylactic agent for the ophthalmologic clinical symptoms and signs in Sjögren syndrome.
US07732423B2	Nucleotide vector, composition containing such vector, and vaccine for immunization against hepatitis Nucleotide composition containing a vector and vaccine for immunization against hepatitis. Nucleotide vector comprising at least one gene or one complementary DNA coding for at least a portion of a virus, and a promoter providing for the expression of the gene in muscle cells. The gene may be the S gene of the hepatitis B virus. A nucleotide vector composition when administered to even chronic HBV carriers is capable of breaking T cell tolerance to the surface antigens of hepatitis B virus. A vaccine preparation containing bare DNA is injected into the host previously treated with a substance capable of inducing a coagulating necrosis of the muscle fibers.
US07732422B2	TRPM-2 antisense therapy Antisense therapy which reduces the expression of TRPM-2 provides therapeutic benefits in the treatment of cancer. Seq ID No. 4 (cagcagcagagtcttcatcat) is an antisense oligonucleotide which inhibits expression of TRPM-2 by tumor cells, and which can be combined with a pharmaceutically acceptable carrier suitable for human administration.
US07732420B2	Combinations of transfection lipids exhibiting increased transfection efficiencies The present invention provides optimized transfection reagents comprising mixtures of cationiclipoids. In particular, the present invention provides DNA delivery vehicles based on identifying the optimal hydrophobicity of novel cationic phospholipid derivatives that, alone or in combination, form complexes with DNA (lipoplexes) and exhibit enhanced transfection activity.
US07732413B2	Substituted azetidinone compounds, processes for preparing the same, formulations and uses thereof The present invention provides compounds represented by the structural formula (I): or pharmaceutically acceptable isomers, salts, solvates or esters of the compound of Formula (I), wherein each of the substituents is as specified herein, formulations including the above compounds, processes for preparing the same and methods for treating atherosclerosis, hypercholesterolemia, or sitosterolemia, and for lowering plasma levels of sterols and/or stanols.
US07732409B2	EspFU nucleic acids and proteins and uses thereof Disclosed are EspFU (EspF-like polypeptide encoded by a gene of the cryptic prophage CP-933U of enterohemorrhagic E. coli) polypeptides, fragments thereof, nucleic acids that encode EspFU polypeptides, or fragments thereof, and cells including the polypeptides, fragments, and/or nucleic acids. Also disclosed are model systems, kits, and methods for screening that use, for example, EspFU polypeptides and nucleic acids. Also included are pharmaceutical and diagnostic compositions and methods of diagnosis and treatment of EHEC infections.
US07732404B2	Pro-nanodispersion for the delivery of cyclosporin A novel cyclosporine formulation, which is a pro-nanodispersion at room temperature, featuring solid particles of a relatively large particle size (at least about 150 nm) and yet which is a nanodispersion at body temperature.
US07732403B2	Treatment of T-cell mediated diseases The invention provides a method of treating T-cell mediated diseases and a method of inhibiting the activation of T-cells using certain diketopiperazines. The invention also provides methods of synthesizing diketopiperazines and pharmaceutical compositions comprising certain diketopiperazines. The invention further provides methods of making improved pharmaceutical compositions of proteins and peptides by either increasing or decreasing the content of diketopiperazines in the compositions and the resultant improved pharmaceutical compositions.
US07732400B2	Method for inhibiting new tissue growth in blood vessels in a patient subjected to blood vessel injury This invention provides for a method for inhibiting new tissue growth in blood vessels in a subject, wherein the subject experienced blood vessel injury, which comprises administering to the subject a pharmaceutically effective amount of an inhibitor of receptor for advanced glycation endproduct (RAGE) so as to inhibit new tissue growth in the subject's blood vessels. The invention also provides for method for inhibiting neointimal formation in blood vessels in a subject, wherein the subject experienced blood vessel injury, which comprises administering to the subject a pharmaceutically effective amount of an inhibitor of receptor for advanced glycation endproduct (RAGE) so as to inhibit neointimal formation in the subject's blood vessels. The invention also provides a method for preventing exaggerated restenosis in a diabetic subject which comprises administering to the subject a pharmaceutically effective amount of an inhibitor of receptor for advanced glycation endproduct (RAGE) so as to prevent exaggerated restenosis in the subject.
US07732396B2	Process for producing a granular anionic surfactant The invention provides a granular anionic surfactant and a detergent composition blended with the same. Disclosed are a process for producing a granular anionic surfactant, which including stirring particles containing 50 to 100 wt % of an anionic surfactant at a temperature at which the anionic surfactant exhibits thermoplasticity at a stirring Froude number as defined below by equation (i) of 0.1 or more and less than 2.0; a granular anionic surfactant obtained by the process; a granular anionic surfactant having a surface roughness (Ra) of 1.0 μm or less; and a detergent composition comprising the granular anionic surfactant. Fr=V/[(R×g)0.5] (i) wherein Fr is Froude number, V is the peripheral speed at the top of a stirring blade [m/s], R is the radius of gyration of a stirring blade [m], and g is the acceleration of gravity [m/s2].
US07732393B2	Oxidation-stabilized CMP compositions and methods The present invention provides a chemical-mechanical polishing (CMP) composition comprising an amino compound, a radical-forming oxidizing agent, a radical trapping agent capable of inhibiting radical-induced oxidation of the amino compound, and an aqueous carrier therefore. The radical trapping agent is a hydroxyl-substituted polyunsaturated cyclic compound, a nitrogenous compound, or a combination thereof. Optionally, the composition comprises a metal oxide abrasive (e.g., silica, alumina, titania, ceria, zirconia, or a combination of two or more of the foregoing abrasives). The invention further provides a method of chemically-mechanically polishing a substrate with the CMP compositions, as well as a method of enhancing the shelf-life of CMP compositions containing an amine and a radical-forming oxidizing agent, in which a radical trapping agent is added to the CMP composition.
US07732391B1	Manual transmission fluid made with lubricating base oil having high monocycloparaffins and low multicycloparaffins A manual transmission fluid having a VI greater than 160 and a Brookfield viscosity at −40° C. less than 30,000 cP. It comprises: 1) a base oil (made from a waxy feed) having less than 0.06 wt % aromatics, greater than 5 wt % total molecules with cycloparaffinic functionality, and a ratio of molecules with monocycloparaffinic functionality to molecules with multicycloparaffinic functionality greater than 20; and a manual transmission fluid additive package. In another embodiment, the manual transmission fluid comprises: 1) a base oil having a high VI and a kinematic viscosity at 100° C. greater than 5.5 cSt, 2) less than 0.01 wt % pour point depressant, and 3) a manual transmission fluid additive package. This invention is also directed to a process to make the manual transmission fluid, comprising the steps of hydroisomerization dewaxing, selecting base oil fractions having a high VI, and blending the fractions with an additive package.
US07732387B2	Preparation of aromatic polysulfonic acid compositions from light cat cycle oil A method for the preparation of a stream rich in aromatic polysulfonic acid compounds from light catalytic cycle oil. The preparation involves the polysulfonation of the light catalytic cycle oil using more than a stoichiometric amount of sulfuric acid. The aromatic polysulfonic acid compositions are preferably aromatic polynuclear compositions.
US07732386B2	Rust inhibitor for highly paraffinic lubricating base oil A rust inhibitor providing a pass in the TORT B rust test, comprising a solubility improver, a mixture of amine phosphates, and an alkenyl succinic compound. A finished lubricant comprising the rust inhibitor and a lubricating base oil. A finished lubricant having a kinematic viscosity at 40° C. between about 90 and 1700 cSt that passes the TORT B rust test, comprising a highly paraffinic base oil and a solubility improver having an aniline point less than 50° C. A finished lubricant that passes the TORT B rust test, comprising a Fischer-Tropsch wax, oligomerized olefins, or mixture thereof; and a solubility improver. A process for making a lubricant, comprising blending together: a) a mixture of amine phosphates, b) an alkenyl succinic compound, and c) a highly paraffinic lubricating base oil. A method of improving the rust inhibition of a lubricating oil by incorporating a solubility improver having an aniline point <10° C.
US07732383B2	Process for stabilized zirconium triethanolamine complex and uses in oil field applications A process for preparing a stable zirconium triethanolamine cross-linking agent comprises contacting a solution of a zirconium triethanolamine complex with water at a temperature of 50° C. to 90° C. at a mole ratio of triethanolamine:zirconium in the range of 3.5:5.5 and at a mole ratio of water:zirconium in the range of 20:1 to 1:1. The stable zirconium triethanolamine complex can be used in a cross-linking composition. Further disclosed are methods to use the composition in oil field applications for hydraulic fracturing and plugging of permeable zones and leaks in subterranean formations.
US07732382B2	Cross-linking composition and method of use A cross-linking composition comprises (a) an aqueous liquid, (b) a pH buffer, (c) a cross-linkable organic polymer, (d) a cross-linking agent which comprises an organic titanate, an organic zirconate, or combinations thereof, and (e) a delay agent which is a hydroxyalkylaminocarboxylic acid. The composition provides flexibility in rate of cross-linking and can be used over a wide range of pH. Further disclosed are methods to use the composition in oil field applications for hydraulic fracturing and plugging of permeable zones and leaks in subterranean formations.
US07732378B2	Mass labels Provided is a set of two or more mass labels, each label in the set comprising a mass marker moiety attached via a cleavable linker having at least one amide bond to a mass normalization moiety, wherein the aggregate mass of each label in the set may be the same or different and the mass of the mass marker moiety of each label in the set may be the same or different, and wherein in any group of labels within the set having a mass marker moiety of a common mass each label has an aggregate mass different from all other labels in that group, and wherein in any group of labels within the set having a common aggregate mass each label has a mass marker moiety having a mass different from that of all other mass marker moieties in that group, such that all of the mass labels in the set are distinguishable from each other by mass spectrometry, and wherein the mass marker moiety comprises an amino acid and the mass normalization moiety comprises an amino acid.
US07732370B2	Catalysts A catalyst including cobalt, zinc oxide and aluminium is described, having a total cobalt content of 15-75% by weight (on reduced catalyst), an aluminium content ≧10% by weight (based on ZnO) and which when reduced at 425° C., has a cobalt surface area as measured by hydrogen chemisorption at 150° C. of at least 20 m2/g cobalt. A method for preparing the catalyst is also described including combining a solution of cobalt, zinc and aluminium with an alkaline solution to effect co-precipitation of a cobalt-zinc-aluminium composition from the combined solutions, separating of the co-precipitated composition form the combined solutions, heating the composition to form an oxide composition, and optionally reducing at least a portion of the cobalt to cobalt metal. The catalysts may be used for hydrogenation reactions and for the Fischer-Tropsch synthesis of hydrocarbons.
US07732369B2	Method and device for catalytic oxidation and reduction of gases and vapours by crystalline compounds of heavy metals and rare earths The invention describes the production of a catalyst for use in the oxidation and selective reduction with properties resembling the catalytic property of the noble metal catalysts, by formation of a crystal surface on catalyst supports from a synthesis crystal of the elements of the rare earths and the metal components cobalt and/or lanthanum produced in multiple stages.
US07732364B2	Process for ionic liquid catalyst regeneration A regeneration process for re-activating an ionic liquid catalyst, which is useful in a variety of reactions, especially alkylation reactions, and which has been deactivated by conjunct polymers. The process includes a reaction step and a solvent extraction step. The process comprises (a) providing the ionic liquid catalyst, wherein at least a portion of the ionic liquid catalyst is bound to conjunct polymers; and (b) reacting the ionic liquid catalyst with aluminum metal to free the conjunct polymers from the ionic liquid catalyst in a stirred reactor or a fixed reactor. The conjunct polymer is then separated from the catalyst phase by solvent extraction in a stirred extraction or packed column.
US07732360B2	Colorless glass composition The invention is a colorless glass composition having a base glass composition, comprising, in weight percentage, from about 0.01 to 0.03 wt % of Fe2O3; about 20-30% reduction (% Fe+2) and about 0.05 to 1 wt % of TiO2, the glass having a visible light transmission of at least 89%, a ultraviolet radiation transmittance of no more than 81%; a solar direct transmission of no more than 90%; a dominant wavelength from 600 nm to 490 nm; and a purity of less than 2%.
US07732355B2	Water-vapor permeable films and textiles A water-vapor permeable film. The film includes 90˜99 wt % polyurethane (PU) and 1˜10 wt % polyethylene (PE). The invention also provides a textile including the film.
US07732353B2	Methods of forming a denuded zone in a semiconductor wafer using rapid laser annealing Methods for forming a denuded zone in an oxygen-containing semiconductor wafer using rapid laser annealing (RLA) are disclosed. The method includes scanning an intense beam of laser radiation over the surface of the wafer to raise the temperature of each point on the wafer surface to be at or near the wafer's melting temperature for a time period on the order of a millisecond or so. This rapid heating and cooling causes oxygen in the wafer near the wafer surface to diffuse out from the wafer surface. Oxygen in the body of the wafer remains unheated and thus does not diffuse toward the wafer surface. The result is an oxygen-depleted zone—called a “denuded zone”—formed immediately adjacent the wafer surface. The methods further include forming a semiconductor device feature in the denuded zone such as by implanting the wafer with dopants.
US07732351B2	Manufacturing method of semiconductor device and laser processing apparatus In a manufacturing process of a semiconductor device, a manufacturing technique and a manufacturing apparatus of a semiconductor device which simplify a lithography step using a photoresist is provided, so that the manufacturing cost is reduced, and the throughput is improved. An irradiated object, in which a light absorbing layer and an insulating layer are stacked over a substrate, is irradiated with a multi-mode laser beam and a single-mode laser beam so that both the laser beams overlap with each other, and an opening is formed by ablation in part of the irradiated object the irradiation of which is performed so that both the laser beams overlap with each other.
US07732346B2	Wet cleaning process and method for fabricating semiconductor device using the same A wet cleaning process is provided. The wet cleaning process includes at least one first rinse process and a second rinse step. The first rinse step includes rinsing a substrate using deionized water containing CO2, and then draining the water containing CO2 to expose the substrate in an atmosphere of CO2. The second rinse step includes rinsing the substrate using deionized water containing CO2.
US07732343B2	Simplified pitch doubling process flow A method for fabricating a semiconductor device comprises patterning a layer of photoresist material to form a plurality of mandrels. The method further comprises depositing an oxide material over the plurality of mandrels by an atomic layer deposition (ALD) process. The method further comprises anisotropically etching the oxide material from exposed horizontal surfaces. The method further comprises selectively etching photoresist material.
US07732338B2	Method of fabricating semiconductor device with reduced pitch A method of fabricating a semiconductor device includes depositing a first film on a workpiece film so that a resist is formed on the first film, processing the first film with the resist serving as a mask, depositing a second film along the first film, processing the second film so that the second film is left only on a sidewall of the first film, depositing a third film on the substrate, exposing a sidewall of the second film, depositing a fourth film along the sidewall and an upper surface of the third film, removing the fourth film except for only its part on the sidewall of the second film, depositing a fifth film on the substrate, planarizing the second to fifth films so that the upper surfaces of the films are exposed, and processing the workpiece film while the second and fifth films serve as a mask.
US07732337B2	Method for manufacturing the shallow trench isolation structure A method for manufacturing a shallow trench isolation (STI) structure is provided. In the method, a substrate is initially provided. Then, a patterned pad layer and a patterned mask layer are successively formed in order on the substrate. After that, a portion of the substrate is removed by using the patterned mask layer and the patterned pad layer as a mask to form trenches in the substrate. Next, a first insulation layer is formed in the trenches. Afterwards, a protection layer is conformally formed on the substrate. Then, a second insulation layer is formed on the protection layer above the first insulation layer. Next, the patterned mask layer and the patterned pad layer are removed. Finally, a portion of the protection layer and the second insulation layer are removed.
US07732335B2	Method for forming pattern in semiconductor device A method for forming a semiconductor device includes forming an etch target layer, forming a sacrificial hard mask layer having a metal layer and a carbon-based material layer on the etch target layer, forming a photoresist pattern on the carbon-based material layer, etching the carbon-based material layer by the photoresist pattern until a remaining carbon-based material portion has a predetermined thickness, etching the remaining carbon-based material portion until a corresponding metal layer portion is exposed to form a carbon-based material pattern, and etching the metal layer by using the carbon-based material pattern to form a hard mask pattern for forming the pattern.
US07732334B2	Method for manufacturing semiconductor device It is an object of the present invention to provide a method for manufacturing a substrate having film patterns such as an insulating film, a semiconductor film, and a conductive film in simple processes. It is another object of the invention to provide a method for manufacturing a semiconductor device with high throughput and high yield at low cost. A method for manufacturing a semiconductor device including the steps of: forming a first film over a substrate; discharging a solution containing a mask material to the first film thereby forming a mask over the first film; patterning the first film with the use of the mask thereby forming low wettability regions and a high wettability region over the substrate; removing the mask; and discharging a solution containing a material of an insulating film, a semiconductor film, or a conductive film to the high wettability region provided between the low wettability regions thereby forming a pattern of the insulating film, the semiconductor film, or the conductive film.
US07732331B2	Copper interconnect structure having stuffed diffusion barrier The present invention provides a method of fabricating a semiconductor device, which could advance the commercialization of semiconductor devices with a copper interconnect. In a process of metal interconnect line fabrication, a TiN thin film combined with an Al intermediate layer is used as a diffusion barrier on trench or via walls. For the formation, Al is deposited on the TiN thin film followed by copper filling the trench. Al diffuses to TiN layer and reacts with oxygen or nitrogen, which will stuff grain boundaries efficiently, thereby blocking the diffusion of copper successfully.
US07732330B2	Semiconductor device and manufacturing method using an ink-jet method of the same The manufacturing method of the present invention includes steps of selectively forming a photocatalyst material or a material including an amino group by discharging a composition including the photocatalyst material or the material including an amino group; immersing the photocatalyst material or the material including an amino group in a solution including a plating catalyst material so as to adsorb or deposit the plating catalyst material onto the photocatalyst material or the material including an amino group; and immersing the plating catalyst material in a plating solution including a metal material so as to form a metal film on a surface of the photocatalyst material or the material including an amino group adsorbing or depositing the plating catalyst material, thereby manufacturing a semiconductor device. The pH of the solution including the plating catalyst material is adjusted in a range of 3 to 6.
US07732329B2	Method and apparatus for workpiece surface modification for selective material deposition In some embodiments, a workpiece-surface-influencing device preferentially contacts the top surface of the workpiece, to chemically modify the surface at desired field areas of the workpiece without affecting the surfaces of cavities or recesses in the field areas. The device includes a substance which is chemically reactive with material forming the workpiece surface. The substance can be in the form of a thin film or coating which contacts the surface of the workpiece to chemically modify that surface. The workpiece-surface-influencing device can be in the form of a solid state applicator such as a roller or a semi-permeable membrane. In some other embodiments, the cavities are filled with material that prevents surface modification of the cavity surfaces while allowing modification of the field areas, or which encourages surface modification of the cavity surfaces while preventing modification of the field areas. The modified surface facilitates selective deposition of materials on the workpiece.
US07732328B2	Method of fabricating semiconductor package structure A semiconductor package structure and a method of fabricating the same are disclosed. A method of fabricating the semiconductor package structure can be characterized as including forming semiconductor chips on a semiconductor substrate. Each of the semiconductor chips includes chip pads. Through-vias are formed through the semiconductor chips. Redistribution structures and a chip selection interconnection layer are formed on the semiconductor chips, which connect the through-vias with the chip pads. The chip selection interconnection layers are patterned to form chip selection interconnection lines having different structures on at least one of the semiconductor chips. The semiconductor chips are stacked and electrically connected using the through-vias.
US07732325B2	Plasma-enhanced cyclic layer deposition process for barrier layers In one embodiment, a method for depositing materials on a substrate is provided which includes forming a titanium nitride barrier layer on the substrate by sequentially exposing the substrate to a titanium precursor containing a titanium organic compound and a nitrogen plasma formed from a mixture of nitrogen gas and hydrogen gas. In another embodiment, the method includes exposing the substrate to the deposition gas containing the titanium organic compound to form a titanium-containing layer on the substrate, and exposing the titanium-containing layer disposed on the substrate to a nitrogen plasma formed from a mixture of nitrogen gas and hydrogen gas. The method further provides depositing a conductive material containing tungsten or copper over the substrate during a vapor deposition process. In some examples, the titanium organic compound may contain methylamido or ethylamido, such as tetrakis(dimethylamido)titanium, tetrakis(diethylamido)titanium, or derivatives thereof.
US07732324B2	Semiconductor device having improved adhesion and reduced blistering between etch stop layer and dielectric layer One aspect of the invention provides a method of forming a semiconductor device (100). One aspect includes forming transistors (120, 125) on a semiconductor substrate (105), forming a first interlevel dielectric layer (165) over the transistors (120, 125), and forming metal interconnects (170, 175) within the first interlevel dielectric layer (165). A carbon-containing gas is used to form a silicon carbon nitride (SiCN) layer (180) over the metal interconnects (170, 175) and the first interlevel dielectric layer (165) within a deposition tool. An adhesion layer (185) is formed on the SiCN layer (180), within the deposition tool, by discontinuing a flow of the carbon-containing gas within the deposition chamber. A second interlevel dielectric layer (190) is formed over the adhesion layer (185).
US07732319B2	Interconnection structure of integrated circuit chip An interconnection structure includes an integrated circuit (IC) chip having internal circuitry and a terminal to electrically connect the internal circuitry to an external circuit, a passivation layer disposed on a top surface of the IC chip, the passivation layer configured to protect the internal circuitry and to expose the terminal, an input/output (I/O) pad, where the I/O pad includes a first portion in contact with the terminal and a second portion that extends over the passivation layer, and an electroless plating layer disposed on the I/O pad.
US07732316B2	Method for manufacturing a semiconductor device In accordance with an embodiment of the invention the method of manufacturing a semiconductor device is capable of forming a semiconductor substrate having an embossing structure. The method includes forming a layer having a plurality of hemispherical single crystal silicon elements, and forming one or more carbon nano tubes between adjacent hemispherical single crystal silicon elements, thereby, increasing a length of an effective channel of a transistor.
US07732315B2	Methods of fabricating semiconductor devices and structures thereof Methods of fabricating semiconductor devices and structures thereof are disclosed. In a preferred embodiment, a method of manufacturing a semiconductor device includes providing a semiconductor wafer, forming a first insulating material over the semiconductor wafer, and forming a plurality of first features and a plurality of second features in the first insulating material. The plurality of first features is removed, leaving an unfilled pattern in the first insulating material. The unfilled pattern in the first insulating material is filled with a second insulating material.
US07732307B2	Method of forming amorphous TiN by thermal chemical vapor deposition (CVD) A modified TDEAT (tetrakisdiethylamino titanium) based MOCVD precursor for deposition of thin amorphous TiN:Si diffusion barrier layers. The TDEAT is doped with 10 at % Si using TDMAS (trisdimethlyaminosilane); the two liquids are found to form a stable solution when mixed together. Deposition occurs via pyrolysis of the vaporised precursor and NH3 on a heated substrate surface. Experimental results show that we have modified the precursor in such a way to reduce gas phase component of the deposition when compared to the unmodified TDEAT-NH3 reaction. Deposition temperatures were the range of 250-450° C. and under a range of process conditions the modified precursor shows improvements in coating conformality, a reduction in resistivity and an amorphous structure, as shown by TEM and XRD analysis. SIMS and scanning AES have shown that the film is essentially stoichiometric in Ti:N ratio and contains low levels of C (˜0.4 at %) and trace levels of incorporated Si (0.01
US07732306B2	Methods for producing improved epitaxial materials This invention provides methods for fabricating substantially continuous layers of group III nitride semiconductor materials having low defect densities. The methods include epitaxial growth of nucleation layers on a base substrate, thermally treatment of said nucleation layer and epitaxial growth of a discontinuous masking layer. The methods outlined promote defect reduction through masking, annihilation and coalescence, therefore producing semiconductor structures with low defect densities. The invention can be applied to a wide range of semiconductor materials, both elemental semiconductors, e.g., combinations of Si (silicon) with strained Si (sSi) and/or Ge (germanium), and compound semiconductors, e.g., group II-VI and group III-V compound semiconductor materials.
US07732298B2	Metal salicide formation having nitride liner to reduce silicide stringer and encroachment Disclosed herein are various embodiments of techniques for preventing silicide stringer or encroachment formation during metal salicide formation in semiconductor devices. The disclosed technique involves depositing a protective layer, such as a nitride or other dielectric layer, over areas of the semiconductor device where metal silicide formation is not desired because such formation detrimentally affects device performance. For example, silicon particles that may remain in device features that are formed through silicon oxidation, such as under the gate sidewall spacers and proximate to the perimeter of shallow trench isolation structures, are protected from reacting with metal deposited to form metal silicide in certain areas of the device. As a result, silicide stringers or encroachment in undesired areas is reduced or eliminated by the protective layer.
US07732297B2	Method of manufacturing an insulating layer and method of manufacturing a semiconductor device using the insulating layer A method of forming an insulating layer and a method of manufacturing a semiconductor device using insulating layer are disclosed. A preliminary insulating layer including a material having a relatively low dielectric constant is formed on an object. An upper portion of the preliminary insulating layer is provided with an ozone gas to transform the preliminary insulating layer into an insulating layer having an upper insulating film including an oxide and a lower insulating film including the material having the relatively low dielectric constant. The upper insulating film may further be located on the lower insulating film.
US07732296B2	Method of fabricating metal-insulator-metal capacitor and metal-insulator-metal capacitor manufactured by the method In a method of fabricating a metal-insulator-metal (MIM) capacitor and a metal-insulator-metal (MIM) capacitor fabricated according to the method, the method comprises: forming an insulating-layer pattern on a semiconductor substrate, the insulating-layer pattern having a plurality of openings that respectively define areas where capacitor cells are to be formed; forming a lower electrode conductive layer on the insulating-layer pattern and on the semiconductor substrate; forming a first sacrificial layer that fills the openings on the lower electrode conductive layer; forming a second sacrificial layer on of the first sacrificial layer; planarizing the second sacrificial layer; exposing an upper surface of the lower electrode conductive layer; removing the exposed lower electrode conductive layer to form a plurality of lower electrodes that are separated from each other, each corresponding to a capacitor cell; and forming dielectric layers and upper electrodes, that are separated from each other, each corresponding to a capacitor cell, on each of the lower electrodes to provide a plurality of MIM capacitor cells constituting one capacitor to which the same electric signal is applied.
US07732295B2	Post last wiring level inductor using patterned plate process A method of forming a semiconductor substrate. A substrate is provided. At least one metal wiring level is within the substrate. A first insulative layer is deposited on a surface of the substrate. A portion of a wire bond pad is formed within the first insulative layer. A second insulative layer is deposited on the first insulative layer. An inductor is within the second insulative layer using a patterned plate process. A remaining portion of the wire bond pad is formed within the second insulative layer, wherein at least a portion of the wire bond pad is substantially co-planar with the inductor.
US07732291B2	Semiconductor device having stressed etch stop layers of different intrinsic stress in combination with PN junctions of different design in different device regions By selectively performing a pre-amorphization implantation process in logic areas and memory areas, the negative effect of the interaction between stressed overlayers and dislocation defects may be avoided or at least significantly reduced in the memory areas, thereby increasing production yield and stability of the memory areas.
US07732277B2	Semiconductor device and method of fabricating the same A semiconductor device according to an embodiment of the present invention includes: a semiconductor substrate; an isolation structure formed in a trench, formed in the semiconductor substrate, through a semiconductor oxide film; a floating gate formed on the semiconductor substrate between the isolation structures through an insulating film; a gate oxidation protection film formed on a side surface, on the isolation structure side, of the floating gate so that each of a part of a side surface and a bottom surface of the gate oxidation protection film contacts the insulating film; and a control gate formed on the floating gate through an inter-gate insulating film.
US07732273B2	Semiconductor device manufacturing method and semiconductor device A manufacturing method of a semiconductor device having a highly reliable capacitor, and the semiconductor device are provided. The semiconductor device manufacturing method according to the present invention includes: a first step of forming a first electrode of a capacitor on a semiconductor substrate; a second step of forming a capacitor insulating film on the whole surface including a side surface and an upper surface of the first electrode; a third step of forming a protection insulating film made of a material different from that of the capacitor insulating film, on the capacitor insulating film; a fourth step of removing the protection insulating film and the capacitor insulating film from the upper surface of the first electrode, by anisotropically etching the protection insulating film and the capacitor insulating film; a fifth step of removing the protection insulating film that remains on the side surface of the first electrode; and a sixth step of forming a second electrode of the capacitor on the capacitor insulating film, after removing the protection insulating film.
US07732266B2	Thin film array panel and manufacturing method thereof A thin film array panel is provided, which includes: a plurality of signal lines including contact parts for contact with an external device; a plurality of thin film transistors connected to the signal lines; an insulating layer formed on the signal lines and the thin film transistors; and a plurality of pixel electrodes formed on the insulating layer and connected to the thin film transistors, wherein the insulating layer includes a contact portion disposed on the contact parts of the signal lines and having a thickness smaller than other portions and the contact portion of the insulating layer includes an inclined portion having an inclination angle smaller than about 45 degrees.
US07732265B2	Thin film transistor, method for manufacturing the same and film formation apparatus One embodiment of the present invention is a method for manufacturing a bottom gate type thin film transistor having a gate electrode, a gate insulating film, an oxide semiconductor active layer, a source electrode and a drain electrode on a flexible plastic substrate of a supporting substrate, the method including continuously forming the gate insulating film and the oxide semiconductor active layer on the flexible plastic substrate with the gate electrode inside a vacuum film formation chamber of a film formation apparatus, the apparatus being a type of winding up continuously the roll-shaped substrate, and the gate insulating film and the oxide semiconductor active layer formed without being exposed to air.
US07732262B2	Semiconductor device and method of manufacturing the same To provide a method for manufacturing a semiconductor device including a transfer step that is capable of controlling the adhesiveness of a substrate and an element-formed layer in the case of separating the element-formed layer including a semiconductor element or an integrated circuit formed over the substrate from the substrate and bonding it to another substrate. An adhesive agent made of a good adhesiveness material is formed between the semiconductor element or the integrated circuit comprising plural semiconductor elements formed over the substrate (a first substrate) and the substrate, and thus it is possible to prevent a semiconductor element from peeling off a substrate in manufacturing the semiconductor element, and further, to make it easier to separate the semiconductor element from the substrate by removing the adhesive agent after forming the semiconductor element.
US07732261B2	Semiconductor device and a method of manufacturing the same In a memory cell array on a main surface of a semiconductor substrate, a floating gate electrode for accumulating charges for information is arranged. The floating gate electrode is covered with a cap insulating film and a pattern of a first insulating film formed thereon. Further, over the entire main surface of the semiconductor substrate, a second insulating film is deposited so that it covers the pattern of the first insulating film and a gate electrode. The second insulating film is formed by a silicon nitride film formed by a plasma CVD method. The first insulating film is formed by a silicon nitride film formed by a low-pressure CVD method. By the provision of such a first insulating film, it is possible to suppress or prevent water or hydrogen ions from diffusing to the floating gate electrode, and therefore, the data retention characteristics of a flash memory can be improved.
US07732259B2	Non-leaded semiconductor package and a method to assemble the same A method to assemble a non-leaded semiconductor package is disclosed. In one embodiment, a carrier tape is attached to a metal foil. A plurality of leadframes are formed in the metal foil, each leadframe including a die pad laterally surrounded by a plurality of contact leads. A semiconductor die, including an active surface with a plurality of die contact pads, is attached to each die attach pad and electrically connected to the leadframe by a plurality of bond wires connecting the die contact pads and the lead contact areas of the contact leads. A plurality of leadframes, each including a wire bonded semiconductor die, are encapsulated with mold material. The carrier tape is removed and the non-leaded semiconductor packages separated.
US07732254B2	Semiconductor multi-package module having package stacked over die-up flip chip ball grid array package and having wire bond interconnect between stacked packages A semiconductor multi-package module having stacked second and first packages, each package including a die attached to a substrate, in which the first and second package substrates are interconnected by wire bonding, and in which the first package is a flip chip ball grid array package in a die-up configuration. Also, a method for making a semiconductor multi-package module, by providing a first package including a first package substrate and having a die-up flip chip configuration, affixing a second package including a second package substrate an upper surface of the first package, and forming z-interconnects between the first and second package substrates.
US07732253B1	Flip-chip assembly with improved interconnect The present invention provides a unique way of connecting a flip-chip die to a substrate. Initially, metallic posts are formed on the flip-chip die and solder bumps are placed on the substrate where the metallic post will ultimately connect to the substrate. The tip layer of flash gold, tin, or other wettable electroplated material is applied to the tips of the metallic posts to prevent oxidation and enhance wettability. The sides of the metallic posts are allowed to oxidize to reduce wettability. To attach the flip-chip die to the substrate, the flip-chip die is initially positioned over the substrate, such that the metallic posts align with and come into contact with the solder bumps. Once the flip-chip die is in place over the substrate, the substrate and the flip-chip are heated to cause the solder bumps to reflow and bond to the tip layers of the metallic posts.
US07732252B2	Multi-chip package system incorporating an internal stacking module with support protrusions The present invention provides a multi-chip package system that includes: providing a package substrate; attaching a base semiconductor die to the package substrate; connecting an interconnect between the base semiconductor die and the package substrate; and encapsulating at least portions of the package substrate, the base semiconductor die, and the interconnect with an encapsulant defining a support protrusion adjacent to the interconnect and substantially perpendicular to the package substrate, a cavity bounded by the support protrusion, and a gap linking the cavity to the edge of the encapsulant.
US07732248B2	Manufacturing method of semiconductor device In view of the problem that an organic semiconductor layer of an organic TFT is likely to deteriorate due to water, light, oxygen, or the like, it is an object of the present invention to simplify a manufacturing step and to provide a method for manufacturing a semiconductor device having an organic TFT with high reliability. According to the invention, a semiconductor layer containing an organic material is formed by patterning using a mask, and thus an organic TFT is completed in the state where the mask is not removed but to remain over the semiconductor layer. In addition, a semiconductor layer can be protected from deterioration due to water, light, oxygen, or the like by using the remaining mask.
US07732247B2	Isolation techniques for reducing dark current in CMOS image sensors Isolation methods and devices for isolating regions of a semiconductor device. The isolation method and structure include forming an isolating trench in an active area and filling the trench with a doped conductive material containing silicon. Suitable conductive materials containing silicon include polysilicon and silicon-germanium. There is also provided a method and structure for isolating the regions by providing a trench in an active area of a substrate, growing an epitaxial layer in the trench to fill the trench or to partially fill the trench and depositing an insulating material over the epitaxial layer and within the trench to completely fill the trench.
US07732246B2	Method for fabricating vertical CMOS image sensor A method of fabricating a vertical CMOS image sensor is disclosed, to improve the integration with the decrease in size of pixel by minimizing the lateral diffusion, in which phosphorous and arsenic ions are implanted while controlling the dose and energy, the method including forming a first photodiode in a semiconductor substrate; forming a first epitaxial layer on the semiconductor substrate; forming a first plug by sequentially implanting first and second ions in the first epitaxial layer; forming a second photodiode in the first epitaxial layer; forming a second epitaxial layer in the first epitaxial layer; forming an isolation area in the second epitaxial layer; and forming a third photodiode and a second plug in the second epitaxial layer.
US07732245B2	Photodiode of CMOS image sensor and method for manufacturing the same A photodiode of a CMOS image sensor and a method for manufacturing the same are provided, in which ions implanted in the vicinity of a device isolation film are prevented from being diffused into a photodiode region to reduce a dark current. The photodiode of a CMOS image sensor includes a heavily doped P-type semiconductor substrate, a lightly doped P-type epitaxial layer formed on the semiconductor substrate, a gate electrode formed on the epitaxial layer, a device isolation film and an N-type photodiode region formed in the epitaxial layer, an insulating film formed on the epitaxial layer to open a portion between the device isolation film and the photodiode region, and a heavily doped P-type diffusion region formed in the epitaxial layer between the device isolation film and the photodiode region.
US07732244B2	Method for forming light-transmitting regions A method for forming a light-transmitting region comprises providing a support feature. A sacrificial layer is formed over a portion of the support feature, wherein the sacrificial layer comprises an energy-induced swelling material. A light-blocking layer is conformably formed over the support feature to cover the sacrificial layer and the support feature. The support feature, the sacrificial layer, and the light-blocking layer are subjected to an energy source to swell the sacrificial layer until bursting to thereby delaminate a portion of the light-blocking layer from the support feature and leave a light-transmitting region exposed with a portion of the support feature in the light-blocking layer. A gas flow or scrub cleaning force is provided to clean up the light-transmitting region and a top surface of the light-blocking layer remains over the support feature.
US07732243B2	Substrate structures for integrated series connected photovoltaic arrays and process of manufacture of such arrays This invention comprises manufacture of photovoltaic cells by deposition of thin film photovoltaic junctions on metal foil substrates. The photovoltaic junctions may be heat treated if appropriate following deposition in a continuous fashion without deterioration of the metal support structure. In a separate operation, an interconnection substrate structure is provided, optionally in a continuous fashion. Multiple photovoltaic cells are then laminated to the interconnection substrate structure and conductive joining methods are employed to complete the array. In this way the interconnection substrate structure can be uniquely formulated from polymer-based materials employing optimal processing unique to polymeric materials. Furthermore, the photovoltaic junction and its metal foil support can be produced in bulk without the need to use the expensive and intricate material removal operations currently taught in the art to achieve series interconnections.
US07732242B2	Composite board with semiconductor chips and plastic housing composition and method One aspect is a composite board including semiconductor chips in semiconductor device positions and a plastic housing composition partly embedding the semiconductor chips. A mould is provided for surrounding the semiconductor chips with plastic housing composition, the mould having a lower part and an upper part and a moldings cavity and the molding cavity having an upper contact area, which forms an interface with the top side of the plastic housing composition to be applied. The upper contact area is covered with a parting layer having essentially the same surface constitution and the same thermal conductivity as an adhesive film forming an interface with the underside of the plastic housing composition, with the result that a warpage of the composite board of less than 1% is obtained.
US07732239B2	Method for manufacturing solid-state image sensor A method using a divided exposure technology is provided for restraining deterioration in the performance of a solid-state image sensor. A photoresist is formed over a semiconductor substrate and subjected to divided exposure. A dividing line for divided exposure is located at least over a region of a semiconductor substrate in which an active region in which a pixel is to be formed is defined. The photoresist is then developed and patterned. By utilizing the patterned photoresist, an element isolation structure for defining the active region in the semiconductor substrate is formed in the semiconductor substrate.
US07732238B2	Method of manufacturing an image sensing apparatus in which two members are bonded together A solid-state image sensing apparatus having a three-dimensional structure whose manufacturing process can be simplified is provided. A solid-state image sensing apparatus formed by bonding a first member and a second member is provided. The first member has a first surface on the side of the bonding interface between the first member and the second member and a second surface on the opposite side of the bonding interface. The second member has a third surface on the bonding interface side and a fourth surface on the opposite side of the bonding interface. The first member includes photoelectric conversion elements which are formed on the first surface before the first member is bonded to the second member. The second member includes circuit elements which are formed on the third surface before bonding.
US07732233B2	Method for making light emitting diode chip package The LED chip package of the present invention uses a semiconductor substrate as package substrate, which improves heat dissipation. Also, the LED chip package is incorporated with a planarization structure, which renders the LED chip and the substrate a substantially planar surface, thereby making formation of a planar patterned conductive layer possible. Accordingly, serial/parallel electrical connections between light emitting diode chips can be easily implemented by virtue of the planar patterned conductive layer.
US07732225B2	Method for measuring contamination in liquids at PPQ levels A method of manufacturing a semiconductor device includes placing a sample of a liquid chemical containing a contaminant on a substantially impurity-free surface of a substrate. The liquid chemical is evaporated, leaving the contaminant on the surface. The contaminant is concentrated in a scanning solution, which is then evaporated to form a residue. A concentration of the contaminant in the residue is determined.
US07732224B2	Metal line pattern of semiconductor device and method of forming the same A method of forming a metal line pattern for a semiconductor device is provided. The method includes forming a preliminary structure on a semiconductor substrate, having a lower barrier metal layer, a metal layer, and an upper barrier and/or passivation layer having a first thickness; removing a top surface of the passivation layer so that the passivation layer has a second thickness; forming a sub-passivation layer on the passivation layer; forming an adhesion promoter and a photoresist pattern on the sub-passivation layer; and forming a metal line pattern by etching the preliminary structure using the photoresist pattern as an etching mask.
US07732222B2	Magnetic memory device and method of fabricating the same There is provided a magnetic memory device and a method of forming the same. The magnetic memory device includes an invariable pinning pattern and a variable pinning pattern on a substrate. A tunnel barrier pattern is interposed between the invariable pinning pattern and the variable pinning pattern, and the pinned pattern is interposed between the invariable pinning pattern and the tunnel barrier pattern. A storage free pattern is interposed between the tunnel barrier pattern and the variable pinning pattern, and a guide free pattern is interposed between the storage free pattern and the variable pinning pattern. A free reversing pattern is interposed between the storage and guide free patterns. The free reversing pattern reverses a magnetization direction of the storage free pattern and a magnetization direction of the guide free pattern in the opposite directions.
US07732217B2	Apparatus and method for reading fluorescence from bead arrays When detecting fluorescence of a bead chip array, reflected light from a bead is detected at the same time, so as to recognize the bead position. The reflected light can be detected in a similar manner for all beads, regardless of the presence or absence of a fluorescent substance. If the positions of all beads are detected, accurate detection can be achieved by quantifying only the fluorescence at the detected positions. The fluorescence wavelength alone is detected by a first detector using a wavelength selection filter. Other wavelengths are detected by a second detector, thereby obtaining the reflected light. Data on the reflected light is processed into an image for obtaining the bead profile, the bead position is recognized by detecting the center position based on the profile, and the fluorescence is quantified based on the bead position.
US07732215B2	Cyanide sensing compounds and uses thereof The present invention relates to a cyanide detection method using fluorescence and cyanide sensitive boronic acid containing fluorophores, wherein a change in a measured fluorescent property correlates to the concentration of the cyanide compound in a biological or environmental test sample.
US07732210B2	Multi-analyte reference solutions The present invention provides a reference solution for use in instruments that determine hematocrit levels in biological samples by measuring the resistance and/or conductivity of the biological samples. A reference solution according to the invention achieves conductivities representative of known hematocrit levels in blood, while maintaining tolerable levels of interference with the measurement of other analytes in the reference solution.
US07732208B2	Method of conducting homologous recombination The present invention provides a novel method of significantly promoting the ratio of homologous recombination in desirable cells. In order to enhance the ratio of homologous recombination in desirable cells such as eukaryotic cells, mutation is introduced into genes encoding factors necessary for non-homologous recombination, such as Ku70 or Ku80, or the above genes are disrupted, so as to cause the loss of the functions thereof. At the time, foreign DNA is introduced into the cells via the electroshock method or the like, so as to carry out homologous recombination, thereby promoting the frequency of homologous recombination in the cells.
US07732205B2	Development and stratification of pine somatic embryos using a liquid system The invention provides methods for producing pine somatic embryos using a liquid development medium and/or a liquid stratification medium. In a first aspect, the methods comprise the step of culturing embryogenic cells in, or on, a liquid development medium to produce cotyledonary pine somatic embryos. In another aspect, the methods comprise the step of culturing pine cotyledonary somatic embryos in, or on, a liquid stratification medium to produce stratified cotyledonary somatic embryos. The invention also provides methods for producing pine somatic embryos in bioreactors.
US07732201B2	Method for production of neuroblasts A method for producing a neuroblast and a cellular composition comprising an enriched population of neuroblast cells is provided. Also disclosed are methods for identifying compositions which affect neuroblasts and for treating a subject with a neuronal disorder, and a culture system for the production and maintenance of neuroblasts.
US07732198B2	Device for the regeneration of tissue, specifically bone regeneration by means of callus distraction The device incorporates a structurally stable membrane (4, 4′, 34, 35) that incorporates a surface (15) to be bonded to a tissue to be regenerated, specifically a vital bone (2, 22, 38, 39). Means (9, 5, 6, 25, 36) are additionally provided whereby the membrane (4, 4′, 24, 35) is movable for the regeneration with a certain pulling force and speed. According to the invention the membrane (4, 4′, 24, 35) has, on its surface facing the tissue or bone, means (16) for the biological anchoring and adhesion for tissue or bone cells. These means (16) for the biological anchoring of tissue cells are specifically bone cells, protein molecules and/or osteoblasts (17), as well as indentations (45, 46, 48) and surface peaks (50) of the membrane.
US07732197B2	Tissue-specific and target RNA-specific ribozymes The present invention relates to multi-ribozymes and their use to target RNA in a tissue-specific, target RNA-specific, or pathogen-specific manner for the treatment of cancers, proliferative disease, and bacterial, parasitic and viral infections. More specifically, the present invention relates to the use of virions and viral vectors to package and deliver DNA encoding the multi-ribozymes to a host. The present invention relates to the use of liposomes and lipid-DNA complexes to deliver DNA encoding ribozymes to a host. Most specifically, the invention relates to the use of target specific virions to package and deliver DNA comprising a target specific promoter and encoding a ribozyme(s) directed to the target organism nucleic acids. The present invention further relates to a novel vectors encoding a multi-ribozyme structure with enhanced 5′ and/or 3′ autocatalytically cleaving ribozymes. The invention further relates to nucleotides encoding a multi-ribozyme comprising one or more ribozyme cassettes which contain one or more trans-acting ribozymes and one or more autocatalytically cleaving ribozyme sequences.
US07732193B2	Method for expression of small RNA molecules within a cell The invention provides methods and compositions for the expression of small RNA molecules within a cell using a lentiviral vector. The methods can be used to express doubles stranded RNA complexes. Small interfering RNA (siRNA) can be expressed using the methods of the invention within a cell, which are capable of down regulating the expression of a target gene through RNA interference. A variety of cells can be treated according to the methods of the invention including embryos, embryogenic stem cells, allowing for the generation of transgenic animals or animals constituted partly by the transduced cells that have a specific gene or a group of genes down regulated.
US07732185B2	Plasmid having response to dioxins, transgenic cell for measuring dioxins, dioxins sensing method and biosensor using the same A plasmid comprising a gene, which is reactive with dioxins and/or polycyclic aromatic hydrocarbons to thereby be activated (hereinafter referred to as DRE gene), and a secretory marker protein expressing gene disposed understream of the DRE gene. Further, there is developed a transgenic cell having this plasmid introduced therein which when exposed to dioxins and/or polycyclic aromatic hydrocarbons, secretes a secretory marker protein. Still further, there is developed a biosensor utilizing this transgenic cell.
US07732178B2	Laccase enzymes and their uses The present invention relates to novel laccase enzymes obtainable from the strains of the genus Thielavia or from the strains of the genus Chaetomium. The invention relates also to nucleic acid sequences encoding the enzymes, recombinant hosts into which the nucleic acid sequences have been introduced and to methods for the production of the enzymes in recombinant hosts. The enzymes of the invention are suitable for several applications, for example for treating denim and for strain removal.
US07732176B2	Nucleotide sequences that encode deregulated phosphoglycerate dehydrogenases of coryneform bacteria and method for producing L-serine The invention relates to nucleotide sequences of coryneform bacteria that encode proteins that are involved in the biosynthesis of L-serine and to a method for producing L-serine. According to the invention, at least 79 amino acids at the C terminus of the wild-type serA sequence are deleted, thereby producing a 3-phosphoglycerate dehydrogenase having a reduced feedback inhibition by L-serine vis-à-vis the wild-type sequence.
US07732175B2	Method and circuit arrangement for treating biomaterial The invention relates to a method for treating biomaterial using at least one electrical field generated by a first voltage pulse which is terminated once the value for an electrical parameter has exceeded or dropped below a preset limit. After the first voltage pulse has been terminated, it is continued by an additional voltage pulse. The invention also relates to a circuit arrangement comprising at least one storage device for electrical charges to generate at least one voltage pulse by selectively discharging the storage device, and at least one control unit for controlling the discharge. The present invention provides a controller for monitoring the chronological progression of the voltage pulse. This controller controls at least one continuation of discharge after termination.
US07732171B2	Process for the preparation of dihydroxy esters and derivatives thereof A process is provided for the preparation of a compound of formula (1) wherein R and R′ represent optionally substituted hydrocarbyl groups and X represents a hydrocarbyl linking group. The process comprises either the stereoselective reduction of the keto group in a dihydroxy keto precursor followed by selective esterification of a primary hydroxy, or selective esterification of a primary hydroxy of a dihydroxy keto precursor followed by stereoselective reduction of the keto group.
US07732169B2	Method for detecting West Nile virus nucleic acids in the 5′ non-coding/capsid region Methods for detecting flavivirus nucleic acids. Particularly described are methods for detecting very low levels of West Nile virus nucleic acids in the 5′ non-coding/capsid region.
US07732167B2	Interferon-α/β binding fusion proteins and therapeutic uses thereof Polypeptides and multimeric polypeptides capable of binding interferon α and/or interferon β which are useful therapeutically in methods of treating interferon α/β-related conditions or diseases.
US07732164B2	Method for producing α-1, 6-branched α-1, 4-glucans from sucrose Nucleic acid molecules which encode a branching enzyme from a bacterium of the genus Neisseria, vectors, host cell, plant cells and plants containing said nucleic acid molecules as well as starch obtainable from the plants described are described. Furthermore, an in-vitro method for producing α-1,6-branched α-1,4-glucans on the basis of sucrose and a combination of enzymes of an amylosucrase and a branching enzyme as well as the α-1,6-branched α-1,4-glucans obtainable by said method are described.
US07732163B2	Extracellular serine protease The present invention provides a DNA encoding a novel extracellular serine protease termed Tumor Antigen Derived Gene-14 (TADG-14) which is overexpressed in ovarian, breast and colon carcinoma samples. Also provided are vector and host cells capable of expressing the DNA of the present invention, as well as the uses of the DNA and protein of the present invention. Also provided is a TADG-14 protein variant that has a potential role for detecting and targeting of ovarian carcinomas.
US07732160B2	Methamphetamine derivatives and conjugates for immunoassay Compounds of methamphetamine derivatives having a meta-substituted alkyl linker on the benzene ring and a protective group on the nitrogen of the methamphetamine hapten. Such compounds have the structure. wherein R1 is an alkyl linker comprising 2-15 carbon atoms and 0-6 heteroatoms, R2 is a leaving group, and R3 is a protecting group.
US07732159B2	Assays for cancer patient monitoring based on levels of analyte components of the plasminogen activator system in body fluid samples The present invention describes clinically and medically important methods of examining, screening over time, and monitoring the outcome of a cancer patient who is undergoing treatment or therapy for his or her disease. More specifically, the invention provides a method of monitoring the progression of disease, or the effectiveness of cancer treatment, in a cancer patient by measuring the levels of one or more analytes of the plasminogen activator (uPA) system, namely, uPA, PAI-1 and the complex of uPA:PAI-1, in a sample taken from the cancer patient, preferably, before treatment, at the start of treatment, and at various time intervals during treatment. As a result of performing the method, an increase or elevation in the levels of one or more of the PA system analytes in the cancer patient compared with the levels one or more of the respective PA system analytes in normal control individuals serves as an indicator of cancer advancement or progression and/or a lack of treatment effectiveness for the patient.
US07732158B2	Method of high-speed detection for biological analyte This invention provides a method to detect analyte which comprises preparing fine particles which have a chargeable group in their core and a hydrophilic polymer chain in their shell; obtaining an agglutinated matter by forming a biologically specific bond between a specific residue on the surface of fine particles and analyte, and by simultaneously forming a bond by the electrostatic interaction between impure protein and said particles; and subsequently cleaving only the latter bond by raising ionic intensity. Thus, this invention provides a method to detect analyte with rapidity and high sensitivity with use of agglutination reaction.
US07732155B2	Methods for identifying lysophosphatidylcholine acyltransferases Nucleic acid molecules identified in encode lyso-phosphatidylcholine (LPC) acyltransferases. Over-expression of the LPC acyltransferases in a cell may lead to enhanced production of PUFA, or other unusual fatty acids, and/or to increased oil content in the cell.
US07732153B2	Nonseparation assay methods Assay methods are disclosed involving specific binding reactions which are simplified compared to known methods. A compound capable of producing chemiluminescence is immobilized on a solid support as is a member of a specific binding pair for capturing an analyte from a sample. An activator compound that activates the chemiluminescent compound and is conjugated to a specific binding pair member is added in excess along with the sample to the solid support. Addition of a trigger solution causes a chemiluminescent reaction at the sites where the activator conjugate has been specifically bound. The assay methods are termed non-separation assays because they do not require removal or separation of excess detection label (activator conjugate) prior to the detection step. The methods are applicable to various types of assays including immunoassays, receptor-ligand assays and nucleic acid hybridization assays.
US07732150B2	Lambdoid bacteriophage vectors for expression of foreign proteins Lambdoid phage comprising a matrix of proteins encapsulating a genome encoding first and second polypeptides of an autogenously assembling receptor and a receptor comprised of the first and second polypeptides surface-integrated into the matrix via a lambdoid phage tail protein matrix anchor domain fused to at least one of the polypeptides.
US07732145B2	Method and devices for rapid diagnosis of foot-and-mouth disease A rapid immunoassay method and apparatus for detecting foot and mouth disease virus are disclosed. The method and test device permit pen-side testing of animals and provide test results within a relatively short time period. In a preferred embodiment, the method and apparatus provide a means for differentiating between FMDV-infected and FMDV-vaccinated animals.
US07732144B2	Method of determining a chemotherapeutic regimen based on ERCC1 and TS expression The present invention relates to prognostic methods which are useful in medicine, particularly cancer chemotherapy. The object of the invention to provide a method for assessing TS and/or ERCC1 expression levels in fixed or fixed and paraffin embedded tissues and prognosticate the probable resistance of a patient's tumor to treatment with 5-FU and oxaliplatin-based therapies by examination of the amount of TS and/or ERCC1 mRNA in a patient's tumor cells and comparing it to a predetermined threshold expression level for those genes. More specifically, the invention provides to oligonucleotide primer pairs ERCC1 and TS and methods comprising their use for detecting levels of ERCC1 and TS mRNA, respectively.
US07732143B2	Method for the diagnosis of genetic diseases by molecular combing and diagnostic kit The invention concerns a method for detecting or locating one or several genes of one or several specific A DNA sequence or one or several molecules reacting with DNA on a B DNA characterised in that it consists in: (a) fixing and combing a certain amount of said B DNA on a combing surface; (b) reacting the product of the B combing with one or several probes, linked with the gene(s) or specific A DNA sequences, or with the molecules capable of reacting with DNA; (c) extracting information corresponding to at least one of the following categories: (1) the position of the probes, (2) the distance between the probes, (3) the size of the probes (the total sum of sizes for quantifying the number of hybridised probes) for determining therefrom the presence, the location and/or the amount of genes or specific A DNA sequences. This method can be used in particular for the diagnosis of genetic diseases.
US07732142B2	Sequences diagnostic for shrimp pathogens Primers have been isolated that are diagnostic for the detection of the infectious hypodermal and hematopoietic necorsis virus (IHHNV). The primers are based on a new portion of the IHHNV genome and may be used in primer directed amplification or nucleic acid hybridization assay methods.
US07732135B2	Genetic markers of food allergy A genetic marker of food allergy is disclosed. The marker comprises variants of IL-4 receptor alpha, IL13 and CD14.
US07732134B2	Methods to predict cholesterol elevation during immunosuppressant therapy This invention provides methods to predict the degree of elevation of serum cholesterol levels in patients treated with immunosuppressive medication. This invention also provides treatment strategies based on these predictions and kits to carry out these methods.
US07732133B2	Screening methods for biologically active ligands In the case when there are two objective biological activities, and the aim is to isolate a compound having at least one biological activity, the present inventors developed an assay method wherein a common detection marker is utilized for separately detecting the presence or absence of each of the biological activities. The present inventors discovered that a compound having at least one of two or more distinct biological activities can be efficiently and conveniently detected by simultaneously assaying at least one test sample or more by the above-mentioned method. Furthermore, for a test sample that proved to be positive by the detection method, they found that it is possible to efficiently and conveniently screen for a test sample having an objective specific biological activity by combining with a method wherein an individual activity of a test sample can be detected to specify the biological activity.
US07732132B2	Monoclonal antibody to the common epitope of NSs protein of watermelon silver mottle virus and assay for tospovirus The invention is an assay for detection of Watermelon silver mottle virus (WSMoV)-serogroup tospoviruses using a monoclonal antibody and a method for preparing the monoclonal antibody. A hybridoma cell line that produces a monoclonal antibody against the NSs proteins of WSMoV-serogroup tospoviruses was produced. The hybridoma cell line produces a monoclonal antibody binding with peptide SEQ ID No. 19.
US07732129B1	Method for the production and purification of adenoviral vectors The present invention addresses the need to improve the yields of viral vectors when grown in cell culture systems. In particular, it has been demonstrated that for adenovirus, the use of low-medium perfusion rates in an attached cell culture system provides for improved yields. In other embodiments, the inventors have shown that there is improved Ad-p53 production with cells grown in serum-free conditions, and in particular in serum-free suspension culture. Also important to the increase of yields is the use of detergent lysis. Combination of these aspects of the invention permits purification of virus by a single chromatography step that results in purified virus of the same quality as preparations from double CsCl banding using an ultracentrifuge.
US07732127B2	Dynamic monitoring of cell adhesion and spreading using the RT-CES system The present invention includes devices and methods for dynamically monitoring cell adhesion and cell spreading. Cells are added to a microelectronic cell sensor array operably connected to an impedance analyzer. The device also includes a coating including biological molecule or organic compound capable of interacting with the cell. Cell adhesion and cell mobility is determined by detecting changes in impedance and comparing impedance or cell index values between samples.
US07732126B2	Integrin CD18 is a novel stromal stem cell marker and functions to promote osteogenesis The present invention is directed to a new bone marrow stromal stem cell (BMSSC) marker, CD18, for use in selecting a population of cells enriched in BMSSCs, from bone marrow cells, adipose cells, or peripheral blood. The invention is further directed to methods for selecting a population of cells enriched in BMSSCs based on the selective expression of CD18 on their surface, using techniques known in the art such as fluorescent assisted cell sorting, an immunomagnetic method, flow microfluorimetry, immunofluorescence, immunoperoxidase staining, radioimmunoassay and immunoaffinity chromatography. The invention is further directed to the BMSSCs isolated based on CD18 expression, and their use to treat various diseases. In one aspect, the HMSSCs are transformed with a vector having a normal gene for CD18, and the transformed BMSSCs are administered to treat bone degenerative diseases and diseases of bone involving abnormal expression of CD18 expression of CD18.
US07732125B2	Bioartificial primarily vascularized tissue matrix, and bioartificial primarily vascularized tissue, method for the production and use of the same The invention relates to a bioartificial primarily vascularized tissue matrix, a bioartificial primarily vascularized tissue, a method for the production thereof and the use of the same. Said tissue matrix and bioartificial primarily vascularized tissue are obtained by preparing the necessary natural tissue, conserving at least one vessel.
US07732123B2	Immersion photolithography with megasonic rinse A method comprises forming a photoresist on a substrate, rinsing the photoresist using a rinse liquid agitated with at least one megasonic source, exposing the photoresist to radiation while immersed in a liquid, and developing the photoresist.
US07732117B2	Photocatalyst composition and photocatalyst containing layer The main object of the present invention is to provide a photocatalyst composition and a photocatalyst containing layer showing a high activity in a short period of time, and a pattern formed body using the photocatalyst containing layer.To attain the object, the invention provides a photocatalyst composition containing at least a photocatalyst, characterized by including a portion with the signal intensity of the electron spin resonance spectrum derived from the hydroxy radical increased to 1,000 times or more in 1 second within 600 seconds of the start of the ultraviolet ray irradiation at the time of measuring the electron spin resonance spectrum while irradiating the ultraviolet ray.
US07732115B2	Toners comprising modified pigments and processes for preparing the same The present invention relates to toner compositions comprising a resin and a colorant. Various embodiments of the colorant used in the toner compositions are disclosed, including a modified pigment comprising a pigment having attached at least one organic group having the formula -X-I, wherein X, which is directly attached to the pigment, represents an arylene or heteroarylene group, or an alkylene group, and I represents a non-polymeric group comprising at least one ionic group or at least one ionizable group. Processes for preparing toner compositions are also described.
US07732112B2	Electrophotographic imaging member undercoat layers An imaging member includes a substrate; a charge generation layer positioned on the substrate; at least one charge transport layer positioned on the charge generation layer; and an undercoat layer positioned on the substrate on a side opposite the charge generation layer, the undercoat layer comprising a binder component and a metallic component comprising metal thiocyanate and metal oxide.

1 2 3 4 5 6 7 8 9 10