Document | Document Title |
---|---|
US11053535B2 |
Devices with a fluid transport nanochannel intersected by a fluid sensing nanochannel and related methods
Devices, such as chips for DNA analysis, have at least one fluid transport nanochannel with at least one intersecting (e.g., transverse) sensing nanochannel that can be monitored for change in ionic current to determine characteristics or parameters of interest, e.g., molecular identification, length determination, localized (probe) mapping and the like. |
US11053532B2 |
Methods for treating polymicrobial infections
Methods for detecting and treating polymicrobial infections, wherein a mixed population of microbes (e.g., bacteria) are present in a patient sample and the microbes are not first isolated from the sample. For example, the present invention describes specific polymicrobial infections and methods of treating said infections, wherein a particular antibiotic or a group of antibiotics are selected based on the composition of the polymicrobial infections. |
US11053530B2 |
Bacteria analyzing method and specimen analyzer
Disclosed is a bacteria analyzing method comprising: irradiating with light a measurement sample prepared by mixing a specimen and a reagent; obtaining two types of optical information from each of at least some particles contained in the measurement sample; and generating a measurement result of the specimen with a flag representing morphological characteristics of bacteria contained in the specimen based on both of: (i) information indicative of a characteristic of a distribution pattern of particles plotted in a first region of a coordinate space including at least two axes, wherein the two types of optical information are scalable along the respective axes, and (ii) information representing a number of particles plotted in a second region being a part of the first region. |
US11053529B2 |
Activated formylglycine-generating enzymes and methods of producing and using the same
The present disclosure provides activated formylglycine-generating enzymes (FGE), methods of producing activated FGE, and their use in methods of producing a protein comprising a formylglycine (FGly) residue. The methods of producing activated FGE, as well as methods of use of activated FGE in producing FGly-containing proteins, include both cell-based and cell-free methods. Compositions and kits that find use, e.g., in practicing the methods of the present disclosure are also provided. |
US11053523B2 |
Method of producing lipid
A method of producing lipids, containing the steps of: culturing an alga belonging to the genus Nannochloropsis; and producing fatty acids or lipids containing the same as components; wherein expressions of genes encoding a Δ12-desaturase and a Δ6-desaturase are enhanced in the alga; and a transformant of an alga belonging to the genus Nannochloropsis, wherein expressions of genes encoding a Δ12-desaturease and a Δ6-desaturease are enhanced. |
US11053519B2 |
Method for producing objective substance
A method for producing an objective substance such as vanillin and vanillic acid is provided. An objective substance is produced from a carbon source or a precursor of the objective substance by using a microorganism having an objective substance-producing ability, which microorganism has been modified so that the activity of S-adenosyl-L-homocysteine hydrolase is increased. |
US11053517B2 |
Intermittent electrolysis streams
The invention provides for methods by which the economics of the gas fermentation process are improved. The invention provides for the integration of a fermentation process, with an industrial process and an electrolyzer process. The invention provides for the intermittent supply of electrolyzer feedstock from the electrolyzer process to the bioreactor for fermentation. The electrolyzer feedstock may displace at least a portion of the C1 feedstock from the industrial process. The electrolyzer feedstock may supplement the C1 feedstock from the industrial process. Whether or not the electrolyzer feedstock supplements or displaces the C1 feedstock with electrolyzer feedstock may be based upon a function of the cost per unit of the C1 feedstock, the cost per unit of the electrolyzer feedstock, and the value per unit of the fermentation product. |
US11053515B2 |
Pooled genome editing in microbes
The present invention relates to methods for editing the genome of a microbial host cell in one or more rounds of transformation. The method allows the introduction of genetic edits into the genome of a microbial host cell in a pooled and/or iterative fashion that does not require the use of functional counterselection following at least one round of transformation. It can be used to rapidly stack genetic edits in the genome of a microbial host cell. Compositions and kits for performing the methods are also disclosed. |
US11053511B2 |
Production of DHA and other LC PUFAs in plants
The invention provides recombinant host organisms genetically modified with a polyunsaturated fatty acid (PUFA) synthase system and one or more accessory proteins that allow for and/or improve the production of PUFAs in the host organism. The present invention also relates to methods of making and using such organisms as well as products obtained from such organisms. |
US11053510B2 |
Plant regulatory elements and uses thereof
The invention provides recombinant DNA molecules and constructs, as well as their nucleotide sequences, useful for modulating gene expression in plants. The invention also provides transgenic plants, plant cells, plant parts, and seeds comprising the recombinant DNA molecules operably linked to heterologous transcribable DNA molecules, as are methods of their use. |
US11053508B2 |
Enhanced processes and reagents for host engineering
Nonnaturally occurring host cells altered to increase their ability to transfer genetic molecules into the host cells as compared to an unaltered host cell are provided. Also provided are methods for identifying endogenous loci of a host cell which inhibit transformation efficiency and/or electroporation of genetic molecules into the cell as well as methods for producing nonnaturally occurring host cells with enhanced transformation efficiency and/or the modified ability to allow for genomic integration of an exogenous DNA sequence via electroporation. Methods for producing biochemicals and products produced with the nonnaturally occurring host cells are also provided. |
US11053506B2 |
Iterative genome editing in microbes
The present invention relates to methods for editing the genome of a microbial host cell in successive rounds of transformation. The method allows the introduction of genetic edits into the genome of a microbial host cell in an iterative fashion that does not require the use of functional counterselection following at least one round of transformation. It can be used to rapidly stack genetic edits in the genome of a microbial host cell. Kits for performing the methods are also disclosed. |
US11053492B2 |
Disordered protein-based seeds for molecular clustering
A system and method for reversibly controlling clustering of proteins around an engineered multivalent nucleus is disclosed. The system and method utilize clustering, which may be controlled by light activation or deactivation. The system and method enable the spatiotemporal control of protein supramolecular assemblies, including liquid-like droplets under some conditions, and solid-like gels under other conditions. The system and method can be utilized for segregating or locally concentrating desired proteins and/or RNA in cells or cell lysate, which may be useful for protein purification purposes, or for assembling single or multiple membraneless bodies within specific sub-regions of the cells. These synthetically assembled bodies may recruit both transgenic and endogenic proteins and other biomolecules, thus can be linked to affect and even trigger a plethora of cellular processes, including both physiological and pathological (e.g., protein aggregation) processes. |
US11053489B2 |
Cellobiohydrolase variants and polynucleotides encoding same
The present invention relates to cellobiohydrolase variants, polynucleotides encoding the variants; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of producing and using the variants. |
US11053483B2 |
Polypeptides having DNase activity
The present invention relates to polypeptides having DNase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides. |
US11053480B2 |
Gene construct encoding mutant thioesterase, mutant thioesterase encoded thereby, transformed host cell containing the gene construct, and method of using them to produce medium-chain fatty acids
Unnatural, mutated thioesterases having an amino acid sequence that is at least 80% identical to SEQ. ID. NO: 1 and having substitutions at one or more of amino acid positions I107, R108, L109, S122, M141, E142, Y145, and L146, gene constructs encoding and configured to express the mutated thioesterases in a transformed host cell and host cells transformed to contain the gene constructs. |
US11053478B2 |
Method for separating virus-like particles from a cell suspension
A method for separating virus-like particles from a cell suspension of host cells. The virus-like particles having at least one envelope protein embedded in a lipid double membrane including at least a portion corresponding to a small envelope protein of a virus of the family Hepadnaviridae. The host cells are disrupted to obtain a first suspension. A supernatant containing the virus-like particles is separated from the first suspension. Then, an adsorbent is added to the supernatant and separated off. Then, the virus-like particles are desorbed from the adsorbent by adding a desorption buffer. A soluble calcium salt is added to a supernatant separated from the second suspension to form a precipitate, the precipitate formed is separated off and transferred to a third suspension. The virus-like particles are separated from the third suspension and purified. |
US11053476B2 |
Generation of cancer stem cells and use thereof
Methods, kits and compositions for generating cancer stem cells are provided. |
US11053475B2 |
Methods of expanding hematopoietic stem cells, compositions, and methods of use thereof
Described herein are methods of expanding a population of hematopoietic stem cells by contacting the population of hematopoietic stem cells with an effective amount of an inhibitor of G-protein coupled receptor 65 (GPR65) and providing a population of expanded, substantially undifferentiated hematopoietic stem cells. Exemplary GPR65 inhibitors include siRNAs and certain sphingolipids. Also described are populations of expanded hematopoietic stem cells produced by the methods, media and kits containing GPR65 inhibitors, and methods for administering an expanded population of hematopoietic stem cells to patients. |
US11053470B2 |
Disposable cartridge for electroporation
The invention is directed to disposable cartridge for electroporation of cells, comprising a fluid compartment in an interior of the disposable cartridge; a first fluid port for providing cell suspension to the fluid compartment, and a second fluid port for delivering a fluid comprising at least one compound to be electroporated into the cells to the fluid compartment; a first electrode and a second electrode disposed in the fluid compartment; at least one exit port which delivers the fluid from the fluid compartment wherein the first and second fluid port have a fluid communication to a mixing channel which has a fluid communication to the fluid compartment, and a third ground electrode and a fourth ground electrode. |
US11053467B2 |
Accelerated aging of alcohol spirits
Alcoholic spirits may be artificially aged under highly pressurized carbon dioxide. The carbon dioxide may form carbonic acid, which may cause various esters to form in the presence of wood as well as to mellow the flavor when no wood is present. Wood may be pretreated with ozone, which may extract lignin which may further convert to vanillin during pressurized CO2 treatment, giving a vanilla note. After processing with pressurized CO2, a post-treatment of ozone may be given to the spirit, which may cause a mild oxidation and further mellowing of the spirit. |
US11053465B2 |
Methods of treating fabrics and related compositions
A process of treating a fabric with a fabric treatment composition, where the composition is provided to a receiving vessel such as the dispenser drawer of an automatic washing machine, the composition including a fabric conditioning active (FCA), where the composition may be dispensed from a container, for example a pressurized container, as a foam. Related compositions, including compositions in pressurized containers. Related uses, for example, to provide an anti-wrinkle benefit to a fabric. |
US11053461B2 |
Leuco triphenylmethane colorants as bluing agents in laundry care compositions
This application describes laundry care compositions that contain leuco colorants and their use in the laundering of textile articles. These types of colorants are provided in a stable, substantially colorless state and then may be transformed to an intense colored state upon exposure to certain physical or chemical changes such as, for example, exposure to oxygen, ion addition, exposure to light, and the like. The laundry care compositions containing the leuco colorants are designed to enhance the apparent or visually perceived whiteness of, or to impart a desired hue to, textile articles washed or otherwise treated with the laundry care composition. |
US11053459B2 |
Enhanced peroxygen stability in multi-dispense TAED-containing peroxygen solid
Stabilized compositions employing a sequestrant system and a binding system for improving shelf stability and dispensing stability of a solid activated bleach composition are disclosed. The compositions contain a peroxygen source and a catalyst activator which require generation of a peroxycarboxylic acid or other active oxygen sanitizing agent at a point of use. Stabilized compositions employ a sequestrant system including a phosphonic acid and/or dipicolinic acid sequestrant and a binding system comprising an anionic surfactant for a solid formulation of a catalyst activator and peroxygen source to provide shelf stability and dispensing stability for a activated bleach composition. Methods of formulating and use are further disclosed. |
US11053458B2 |
Hard surface cleaning compositions comprising phosphinosuccinic acid adducts and methods of use
Methods employing detergent compositions effective for reducing hard water scale and accumulation on hard surfaces, namely within food, beverage and pharmaceutical applications are disclosed. The detergent compositions employ phosphinosuccinic acid adducts in combination with an alkalinity source and optionally polymers, surfactants and/or oxidizers, providing alkaline compositions having a pH between about 10 and 13.5. |
US11053454B2 |
Fragrance compositions comprising essential oils and products comprising same for promoting wellness
The present technology relates to fragrance compositions comprising essential oils and products comprising the same. The technology also relates to methods of using the fragrance compositions to induce sleep and promote wellness. |
US11053449B2 |
Thioether-containing phenolic compounds
Thioether-substituted phenols that are the reaction product of a thioether-substituted alcohol or thioether-substituted amine and a phenol with at least one pendant acyl group and have a ratio of sulfur groups to phenol groups of at least 1:1 and uses for thioether-substituted phenols. Methods of lubricating an internal combustion engine by contacting the internal combustion engine with a lubricating composition comprising a thioether-substituted phenol. Methods of reducing deposit formation and/or corrosion in an engine using a lubricating composition comprising a thioether-substituted phenol. |
US11053444B2 |
Method and system for optimizing coke plant operation and output
The present technology is generally directed to methods of increasing coal processing rates for coke ovens. In various embodiments, the present technology is applied to methods of coking relatively small coal charges over relatively short time periods, resulting in an increase in coal processing rate. In some embodiments, a coal charging system includes a charging head having opposing wings that extend outwardly and forwardly from the charging head, leaving an open pathway through which coal may be directed toward side edges of the coal bed. In other embodiments, an extrusion plate is positioned on a rearward face of the charging head and oriented to engage and compress coal as the coal is charged along a length of the coking oven. In other embodiments, a false door system includes a false door that is vertically oriented to maximize an amount of coal being charged into the oven. |
US11053443B2 |
Microwave pyrolysis reactor
The present invention provides a microwave pyrolysis reactor (1) comprising an inner pipe element (2) and a housing (4), wherein the inner pipe element (2) is made of a microwave transparent material and comprises a first open end (5) and a second open end (6); the housing (4) comprises a first inner surface, enclosing an annular space (7,44) around the inner pipe element (2), a waste inlet (10), a solids outlet (11), a gas outlet (12), an inert gas inlet (45) and a port (13) for a microwave waveguide (14), the waste inlet and the solids outlet are in communication with the first open end and the second open end of the inner pipe element, respectively, and the port for a microwave waveguide is in communication with the annular space; and wherein the inner pipe element is arranged with the first open end at a higher vertical level than the second open end, such that a material entering the waste inlet during use is transported through the inner pipe element, from the first open end to the second open end, by gravity; and wherein the gas outlet (12) is arranged upstream the first open end of the inner pipe element and downstream the waste inlet of the housing, and the inert gas inlet (45) is arranged to provide an inert gas into the annular space (7,44) during use. |
US11053439B2 |
Methods for synthesis of inorganic nanostructures using molten salt chemistry
The invention relates to highly luminescent nanostructures with strong blue light absorbance, particularly core/shell nanostructures comprising an In(1-x)GaxP core and ZnSe and/or ZnS shell layers, wherein 0 |
US11053438B2 |
Fluoride-based phosphors for light emitting device
The invention relates to a red phosphor with a narrow full width at half maximum, having improved decay time and resolving afterglow phenomenon. The fluoride-based phosphor according to the invention is characterized in including a host having a composition of the following [Formula 1] including rubidium (Rb), cesium (Cs), silicon (Si) and fluorine (F) as constituent elements, and manganese (Mn) which is solid solution treated in the host as an activator: Rb3-xCsxSiF7 [Formula 1] (where, 0 |
US11053423B2 |
Date tree leaflet-based flaky lost circulation material
A lost circulation material (LCM) having flakes formed from date tree leaflets is provided. The flakes of the date tree leaflet LCM may be formed by tearing and shredding date tree leaflets from date trees. The date tree leaflets may be obtained from date tree pruning performed by date tree farming industries. The date tree leaflet LCM may be added to o a drilling fluid to mitigate or prevent lost circulation in a well. Methods of lost circulation control with the date tree leaflets LCM are also provided. |
US11053421B2 |
1,2,3,3,3-pentafluropropene production processes
A process is disclosed for making CF3CF═CHF. The process involves reacting CF3CClFCCl2F with H2 in a reaction zone in the presence of a catalyst to produce a product mixture comprising CF3CF═CHF. The catalyst has a catalytically effective amount of palladium supported on a support selected from the group consisting of alumina, fluorided alumina, aluminum fluoride and mixtures thereof and the mole ratio of H2 to CF3CClFCCl2F fed to the reaction zone is between about 1:1 and about 5:1. Also disclosed are azeotropic compositions of CF3CClFCCl2F and HF and azeotropic composition of CF3CHFCH2F and HF. |
US11053417B2 |
Curable silicone composition, cured product thereof, and optical display
Disclosed is a curable silicone composition. The composition comprises: (A) an organopolysiloxane having at least two alkenyl groups and at least one aryl group in each molecule; (B) a polyoxyalkylene compound represented by the general formula: XO—(C2H4O)p(CnH2nO)q(YO)r—X, wherein, each X represents a hydrogen atom, an alkyl group, an alkenyl group, an aryl group, an acryl group, or a methacryl group, provided that at least one X in each molecule is the alkenyl group, the acryl group, or the methacryl group, Y represents a divalent hydrocarbon group, n represents an integer of 3 to 6, p and q are integers satisfying: 2≤p≤100 and 0≤q≤50, and r represents 0 or 1; (C) an organopolysiloxane having at least two silicon bonded hydrogen atoms in each molecule; and (D) a catalyst for a hydrosilylation reaction. The composition forms a cured product having improved properties. |
US11053411B2 |
Reusable attaching apparatus and methods of making and using a reusable attaching apparatus
A reusable attaching apparatus includes (a) a reversible adhesive comprising a shape memory polymer and (b) a mounting structure bonded to the reversible adhesive. The shape memory polymer has a glass transition temperature (Tg) and comprises a deformable state at temperatures above the Tg and a rigid state at temperatures below the Tg. |
US11053409B2 |
Compositions for containers and other articles and methods of using same
This invention provides a polymer, which is preferably a polyether polymer. The polymer may be uses in coating compositions. Containers and other articles comprising the polymer and methods of making such containers and other articles are also provided. The invention further provides compositions including the polymer (e.g., powder coatings), which have utility in a variety of coating end uses, including, for example, valve and pipe coatings. |
US11053408B2 |
Resin composition for damping material
Provided is a vibration damping composite capable of providing a vibration damping material, at low cost, that exhibits a high vibration damping property in a wide temperature range and has excellent appearance. The present invention relates to a resin composition for vibration damping materials which contains a lignin and/or a lignin derivative. The present invention also relates to a vibration damping composite containing the resin composition for vibration damping materials and an inorganic pigment. The present invention also relates to a vibration damping material obtainable from the vibration damping composite. |
US11053404B2 |
Acylphosphine oxide photoinitiators
Thiol modified acylphosphine oxide photoinitiators exhibiting improved smell and extractability are disclosed. Also disclosed is a UV curable inkjet ink containing an acylphosphine oxide photoinitiator and a polymerizable compound, wherein the acylphosphine oxide photoinitiator includes one or more acyl groups substituted by a thiol. |
US11053391B2 |
Polymer modified asphalt for industrial applications
This invention provides for a method for producing polymer modified asphalt using base asphalt (bitumen) blended with partially air blown (“puffed”) asphalt which is further modified with polymers and additives to attain desired properties for industrial applications. The partially blown or blown asphalt is oxidized to a target softening point to suit the application. In another embodiment, the base asphalt is blended with hard PEN asphalt (“Zero PEN Asphalt”) which is further modified with polymers and additives to attain desired properties. By using the partially oxidized asphalt or blending the base asphalt with partially oxidized asphalt or hard PEN asphalt, the amount of polymers and additives needed to achieve desired properties and performance are significantly reduced. This technique can be used to attain polymer modified asphalt having a highly desirable combination of characteristics not otherwise attainable using the base asphalt. |
US11053384B2 |
Curable composition and cured product thereof
Provided are a curable composition capable of both exhibiting a low shrinkage percentage during curing and forming a cured product having a low elastic modulus under high temperature conditions, a cured product of the curable composition, and a semiconductor encapsulating material and a printed wiring board which are produced using the curable composition. The curable composition includes an active ester compound (A) that is an esterification product of a phenolic compound (a1) and an aromatic polycarboxylic acid or an acid halide thereof (a2); and a curing agent. Also provided are a cured product of the curable composition, and a semiconductor encapsulating material and a printed wiring board which are produced using the curable composition. |
US11053380B2 |
Polyolefin composition with improved surface appearance
The present invention is directed to a heterophasic polypropylene composition (HECO1) and the use thereof to reduce the amount of flow marks of an injection moulded polyolefin composition. Further, the present invention is directed to a polyolefin composition (C) comprising a polyolefin (PO), said heterophasic polypropylene composition (HECO1) and optionally a filler as well as an article comprising said polyolefin composition (C). |
US11053378B2 |
Polyolefin resin composition
A polyolefin resin composition includes 15-65% by weight of a polypropylene homopolymer, 5-35% by weight of a polypropylene copolymer, 5-65% by weight of a reinforcing filler, 0.25-5% by weight of a polypropylene compatibilizer, and 1-25% by weight of a surface active agent. |
US11053374B2 |
Basic magnesium sulfate powder, method for manufacturing basic magnesium sulfate powder, resin composition containing basic magnesium sulfate powder, masterbatch pellet, and molded body
A basic magnesium sulfate powder according to the present invention has a surface at least partially coated with an inorganic phosphorus compound. The basic magnesium sulfate powder preferably has a phosphorus content of from 0.001 to 5.0 mass %. |
US11053373B2 |
Polymeric matrices with ionic additives
Polymeric compositions include at least one polymer that is free of ester linkages and an additive that is a benzotriazole phenolate salt with substituents either ortho to the phenol hydroxide group and/or para to the phenol hydroxide group. The substituted benzotriazole phenolate salts can be prepared from substituted benzotriazole phenols. The ortho substituent group can be a simple hydrocarbon, alkoxy, or amino group, or the ortho substituent group can be a linking group, linking the benzotriazole phenolate to another benzotriazole phenolate group. |
US11053369B2 |
Segmented flexible gel composites and rigid panels manufactured therefrom
The present invention describes various methods for manufacturing gel composite sheets using segmented fiber or foam reinforcements and gel precursors. Additionally, rigid panels manufactured from the resulting gel composites are also described. The gel composites are relatively flexible enough to be wound and when unwound, can be stretched flat and made into rigid panels using adhesives. |
US11053368B2 |
Foams based on thermoplastic polyurethanes
Expandable thermoplastic polyurethane comprising blowing agent, wherein the Shore hardness of the thermoplastic polyurethane is from A 44 to A 84. |
US11053367B2 |
Composition for polyurethane foam containing polyrotaxane, polyurethane foam derived from composition, and method for producing polyurethane foam
The present invention provides: a polyurethane foam having excellent viscoelastic characteristics and/or excellent feeling; a composition for the polyurethane foam; and a method for producing the polyurethane foam. The present invention provides a composition for a polyurethane foam, the composition containing: (A) a polyol having three or more OH groups; (B) a compound having two or more isocyanate groups; and (C) a polyrotaxane obtained as a result of arranging, on both ends of a pseudo-polyrotaxane formed through skewering-like inclusion of a linear molecule through the openings of cyclic molecules, stopper groups so that the cyclic molecules do not dissociate from the pseudo-polyrotaxane. |
US11053361B2 |
Colorant and additive concentrate carrier system with efficacy over a wide range of polymeric processing temperatures
A concentrate carrier system for adding colorants and/or other additives to resin formulations over a broad range of processing temperatures is described. The carrier system includes at least 20 wt. % of a base acrylate copolymer, such as ethyl-methyl acrylate, provided in combination with less than 30 wt. % of polycarpolactone, or a similar ring-opened cyclic ester or ether derivatives. The remainder, which may include an optional organic plasticizer such as epoxidized soybean oil, is dedicated to an additive package that may include colorants, property enhancers, and/or non-property fillers. |
US11053360B2 |
Methods of making an elastomer composite reinforced with silica and carbon black and products containing same
Methods to make a silica and carbon black elastomer composite with a destabilized dispersion that includes silica are described, along with particle reinforced elastomer composites made from the methods. The advantages achieved with the methods are further described. |
US11053357B2 |
Spherical powder containing crosslinked body formed having polyrotaxane, and method for producing same
The present invention provides a spherical powder having properties, such as an excellent strength, toughness, and deformation recovery, and provides a method for producing same. The present invention provides: a spherical powder containing a crosslinked body formed having (A) a polyrotaxane in which both ends of a pseudopolyrotaxane, which are formed by inclusion of the opening of a cyclic molecule by threading therethrough with a linear molecule, are provided with a capping group so that dethreading of the linear molecule is prevented, in particular, a spherical powder having an average particle diameter of 0.5 to 1,000 μm, preferably 1 to 500 μm, more preferably 1 to 300 μm, and still more preferably 1 to 150 μm; and a method for producing this spherical powder. |
US11053354B2 |
Liquid crystal display device
The present invention provides a liquid crystal display device with a high degree of freedom in molecular structure design of an alignment film and with reduced image sticking. The liquid crystal display device includes a pair of substrates; a liquid crystal layer held between the substrates; an alignment film disposed on a liquid crystal layer side surface of at least one of the substrates; and a polymer layer disposed between the liquid crystal layer and the alignment film, the alignment film containing a first polymer containing at least one structure represented by the following formula (1) in a side chain, wherein R1 represents a C3-C6 branched or cyclic alkylene group, and a hydrogen atom at a para position to a carbonyl group in the phenyl group is optionally replaced. |
US11053349B2 |
Biomimetic networks comprising polyisocyanopeptide hydrogels
A polymer hydrogel having a polymer formed by the crosslinking reaction of a polymeric unit A according to formula (I), with a crosslinking unit B according to formula (II) and water, wherein n=100-10,000, preferable 250-2500, more preferable 500-1500; m=independently 2-10, preferably 3 or 4; FG is a functional moiety that can be covalently coupled to the complementary functional moiety F1 or F2 of the crosslinking unit (B); k=0.01-0.05; h=0, 1 or 2; the spacer is an organic moiety, having a main chain comprising at least two functional moieties F1 and F2, wherein the length of the crosslinker in the extended conformation as determined by molecular modeling (including spacer and functional groups F1 and F2) is between 2.5 and 12 nm, or wherein the length is between 20 and 80 atoms. |
US11053348B2 |
Epoxy stabilization using metal nanoparticles and nitrogen-containing catalysts, and methods
The present disclosure provides a curable, one-part epoxy/thiol resin composition. The composition comprises an epoxy/thiol resin mixture including: an epoxy resin component including an epoxy resin having at least two epoxide groups per molecule, a thiol component including a polythiol compound having at least two primary thiol groups, and a nitrogen-containing catalyst for the epoxy resin. The epoxy/thiol resin mixture further includes metal nanoparticles (e.g., silver nanoparticles, copper nanoparticles, or both), dispersed in the epoxy/thiol resin mixture. The present disclosure provides a method of curing a curable, one-part epoxy/thiol resin composition, including providing a curable, one-part epoxy/thiol resin composition and heating the composition to a temperature of at least 50° C. |
US11053347B2 |
Curing agent for low-emission epoxy resin compositions
A curing agent for epoxy resins, containing at least one amine adduct of formula (I) which can be obtained as an addition product of a mixture of a primary diamine, a monoalkylated other diamine and a polyepoxide. The curing agent makes it possible to produce low-odor, low-emission epoxy resin products, in particular coatings, which have a surprisingly low viscosity, a high curing rate, a high final hardness, and a surprisingly appealing surface. |
US11053346B2 |
Hardener for cold hardening epoxy resin adhesives having fast hardening
An adduct AD obtained from the reaction of at least one novolak glycidyl ether containing an average of 2.5 to 4 epoxy groups per molecule with an amine mixture including bis(6-aminohexyl)amine and at least one amine A1 other than bis(6-aminohexyl)amine that has at least one primary amino group. Preferably, the amine mixture is a technical grade quality of bis(6-aminohexyl)amine that contains 25% to 82% by weight of bis(6-aminohexyl)amine. The adduct AD is preparable in a simple manner and without the use of solvents, and enables low-odor, low-toxicity and low-viscosity hardeners that can be processed and stored even under cold conditions. Epoxy resin compositions cured therewith very rapidly build up high binding forces and high strengths under ambient outdoor temperatures, even on substrates that are difficult to bond. |
US11053345B2 |
Polyurethane polymer, method for preparing the same and use thereof
The present invention relates to the technical field of polymer materials, and in particular, relates to a polyurethane polymer and a method for preparing the same and use thereof. The present invention discloses use of aminoimidazolinone-based compound in preparing an end-capped polyurethane polymer product, by which the polyurethane polymer capable of achieving repeated self-healing for multiple times without adding any self-healing agent and any external stimulation can be prepared. The present invention further provides a polyurethane polymer capable of achieving repeated self-healing for multiple times without any external stimulation and having a compressive strength restored to at most 96% of the one before compression, and a method for preparing the same. |
US11053342B2 |
Polyurethane/urea materials
The present disclosure provides soft block copolymer segments of Formula 1 for thermoplastic polyurethane or polyurethaneurea elastomer materials and their reaction products with divalent compounds, such as diisocyanates, chain extenders and optional additional polyols or polyamines. Also disclosed herein are methods for the production of the soft block copolymer segments, and possible applications of these materials in the formation of biomaterials for articles including medical devices such as implants, heart valves and drug delivery devices. |
US11053338B2 |
Composition
An isocyanate reactive composition comprising At least one component selected from the group consisting of a polyether polyol, a polyester polyol, a polyether polyamide and a polyester polyamide; one or more amine components, each of said amine components having a given structure. In some embodiments, the average number of nitrogen atoms of said amine components is in the range of 5 to 10. |
US11053336B2 |
High heat resistant and high scratch resistant water-based polyurethane and manufacturing method thereof
A method for manufacturing high heat resistant and high scratch resistant water-based polyurethane, which can improve the mechanical strength and water resistance of water-based polyurethane by using acrylate graft modification, is provided. In particular, 2-hydroxyethyl acrylate (2-HEA), methyl methacrylate (MMA), ethyl acrylate (EA), acrylic acid (AA), glycidyl methacrylate (GMA) and triallyl isocyanuric acid ester (TAIC) are used to dilute polyurethane prepolymer. As a result, the prepolymer has a good dispersing effect, and further, waterborne bridging agent and cellulose nanofiber are added to the water-based polyurethane to obtain water-based polyurethane which has high heat resistance and scratch resistance. |
US11053335B2 |
Polymers and methods for ophthalmic applications
Novel methods and materials particularly useful for ophthalmic applications and to methods for making and using the same are disclosed herein. More particularly, relatively soft, optically transparent, foldable, high refractive index materials particularly suited for use in the production of intraocular lenses, contact lenses, and other ocular implants and to methods for manufacturing and implanting IOLs made therefrom are disclosed. |
US11053332B2 |
Ethylene copolymers produced with single site catalyst
Embodiments of the invention described herein relate to a polyethylene polymer composition suitable for use in the manufacture of packaging articles, flexible films and/or sheets. In one embodiment, the copolymer comprises a polyethylene resin with density 0.918 g/cm3 to about 0.935 g/cm3, G′ at G″(500 Pa) value, as determined from Dynamic Mechanical Analysis at 190° C., of less than 40 Pa, Mz/Mw of greater than 2, CDBI50 of greater than 60. Other embodiments relate to polymer compositions with defined molecular characteristics and formulations suitable for use in the manufacture of articles including films, sheets, bags and pouches with improved creep resistance and high toughness and a good balance of film stiffness and processability in monolayer and/or multi-layer film structures. |
US11053331B2 |
Polymerisation process
The present invention relates to a cascade process useful for (fast) ionic polymerisation of liquid monomer(s) containing reaction mixture for the production of the corresponding polymer(s). |
US11053329B2 |
Multiple non-coordinating anion activators for propylene-ethylene-diene monomer polymerization reactions
This invention relates to production of propylene-predominant copolymers using a transition metal complex and at least two different non-coordinating anion activators. An olefinic feed comprising a C3-C40 alpha olefin, ethylene, and a diene monomer is contacted under polymerization reaction conditions with a catalyst system comprising a first non-coordinating anion activator, a second non-coordinating borate activator differing from the first non-coordinating anion activator, and a transition metal complex comprising a tetrahydro-s-indacenyl or tetrahydro-as-indacenyl group bound to a group 3-6 transition metal. A molar ratio of the first non-coordinating anion activator to the second non-coordinating anion activator is sufficient to produce a melt flow rate under the polymerization reaction conditions for the resulting copolymer of about 30 g/10 min or below as determined by ASTM D-1238 (230° C., 2.16 kg). |
US11053323B2 |
Dissolution of oxidized cellulose and particle preparation by cross-linking with multivalent cations
A process for dissolving modified cellulose includes contacting modified cellulose solution with at least one multivalent cation to form a plurality of modified cellulose particles. |
US11053322B2 |
Apolipoprotein nanodiscs with telodendrimer
The present invention provides a nanodisc with a membrane scaffold protein. The nanodisc includes a membrane scaffold protein, a telodendrimer and a lipid. The membrane scaffold protein can be apolipoprotein. The telodendrimer has the general formula PEG-L-D-(R)n, wherein D is a dendritic polymer; L is a bond or a linker linked to the focal point group of the dendritic polymer; each PEG is a polyethylene glycol) polymer; each R is and end group of the dendritic polymer, or and end group with a covalently bound hydrophobic group, hydrophilic group, amphiphilic compound, or drug; and subscript n is an integer from 2 to 20. Cell free methods of making the nanodiscs are also provided. |
US11053319B2 |
CXCR2 antibodies and uses thereof
The invention relates to CXCR2, to antibodies and related fragments thereof for binding to CXCR2, to production of said antibodies and fragments and to use of said antibodies and fragments for detection and therapy of various conditions. |
US11053316B2 |
Optimized antibody variable regions
The present invention is directed to optimized anti-CD3 variable sequences for use in a variety of bispecific formats, including those that utilize scFv components. The invention further relates to nucleic acids encoding for the polypeptide, to vectors comprising the same and to host cells comprising the vector. In another aspect, the invention provides for a pharmaceutical composition comprising the mentioned polypeptide and medical uses of the polypeptide. |
US11053314B2 |
Methods to eliminate cancer stem cells by targeting CD47
Described herein is the discovery that cancer stem cells (CSCs) can be induced to differentiate by altering CD47 signaling. Provided herein are methods and compositions for inducing differentiation of cancer stem cells, for instance irreversible differentiation, including methods of treating subjects with cancer such as breast cancer, colon cancer, lung cancer, ovarian cancer, or melanoma, and including metastatic as well as primary cancer. Also provided are methods for treating subjects with triple negative breast cancers involving forcing differentiation of bCSCs of the subjects through targeting of CD47. |
US11053304B1 |
Anti-SARS-Cov-2 antibodies derived from 6nb6
This disclosure provides antibodies and antigen-binding fragments that are derived from 6nb6 and that can be administered to an individual that is infected or suspected of being infected with a virus. Antibodies and antigen-binding fragments herein can be capable of treating or curing the virus, and which may provide protection against the virus for up to several weeks. Antibodies and antigen-binding fragments herein can be used to diagnose a SARS CoV 2 infection. |
US11053297B2 |
Monocyte modulation and control of tumor metastasis
Disclosed herein are methods of increasing numbers of monocytes to a tumor or cancer metastasis site in a subject. Non-limiting embodiments include administering or using a Nur77 polypeptide or subsequence thereof; a Nur77 agonist; a CX3CR1 agonist; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+ GR1− (Ly6C−)) monocytes; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes contacted with a Nur77 agonist or contacted with a CX3CR1 agonist. Also disclosed herein are methods of increasing, stimulating, activating or promoting monocyte migration to or mobilization against a tumor or cancer metastasis in a subject. Non-limiting embodiments include administering a Nur77 polypeptide or subsequence thereof; a Nur77 agonist; a CX3CR1 agonist; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes; or CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes contacted with a Nur77 agonist or contacted with a CX3CR1 agonist. |
US11053295B2 |
Peptides having effects of preventing or treating central nervous system diseases and pharmaceutical compositions for preventing or treating central nervous system diseases containing same as active ingredient
The present invention has a function of enabling the penetration of the blood-brain barrier and the blood-spinal cord barrier of the central nervous system, which have not been significantly penetrated, with excellent efficiency, thereby enabling a rapid, quick, and more efficient therapeutic effect to be obtained through low dose administration. In addition, the present invention enables local administration unlike conventional therapeutic agents, thereby decreasing side effects, and enables local administration of a therapeutic agent at a high concentration, thereby enabling potentially new treatments and prescriptions. |
US11053294B2 |
Masked cytokine polypeptides
Provided herein are cytokines or functional fragments thereof that, in some embodiments, are engineered to be masked by a masking moiety at one or more receptor binding site(s) of the cytokine or functional fragment thereof. In some embodiments, the cytokines are engineered to be activatable by a protease at a target site, such as in a tumor microenvironment, by including a proteolytically cleavable linker. In some embodiments, the proteolytically cleavable linker links the cytokine to the masking moiety, links the cytokine to a half-life extension domain, and/or links the masking moiety to a half-life extension domain. The masking moiety blocks, occludes, inhibits (e.g., decreases) or otherwise prevents (e g masks) the activity or binding of the cytokine to its cognate receptor or protein. Upon proteolytic cleavage of the cleavable linker at the target site, the cytokine becomes activated, which renders it capable of binding to its cognate receptor or protein with increased affinity. |
US11053292B2 |
GM-CSF and IL-4 conjugates, compositions, and methods related thereto
In certain embodiments, this disclosure relates to conjugates comprising a polypeptide of GM-CSF and a polypeptide IL-4. Typically, the GM-CSF and IL-4 are connected by a linker, e.g., polypeptide. In certain embodiments, the disclosure relates to isolated nucleic acids encoding these polypeptide conjugates, vectors comprising nucleic acid encoding polypeptide conjugates, and protein expression systems comprising these vectors such as infectious viral particles and host cells comprising such nucleic acids. |
US11053286B2 |
Stabilised FMDV capsids
The present invention relates to the stabilisation of foot-and-mouth disease virus (FMDV) capsids, by specific substitution of amino acids in a specific region of FMDV VP2. The invention provides stabilised FMDV capsids and vaccines against FMD. |
US11053280B2 |
Anti-VEGF protein compositions and methods for producing the same
The present disclosure pertains to compositions comprising aflibercept and methods for producing such compositions in chemically defined media and using chromatography to reduce amounts of certain aflibercept variants. |
US11053279B2 |
Methods for the site-selective coupling of a first agent to a second agent
The present invention relates to a method for site-selective coupling of a first agent to a second agent, comprising the steps of: contacting a first agent comprising at least one furan moiety with an activation signal and with a second agent comprising at least one hydrazine moiety or at least one hydroxylamine moiety, thereby activating said furan moiety to an activated furan moiety; and reacting said activated furan moiety with the hydrazine moiety or the hydroxylamine moiety, thereby site-selectively coupling said first agent to said second agent. |
US11053277B2 |
Process for preparation of a peptide
The present invention relates to a novel process for preparation of peptides having amino acid chain length in the range of 2-40 comprises the steps: i) attaching an end-blocked amino acid with an ionic liquid based solid support in presence of an ionic solvent to obtain an end-terminal blocked amino acid attached ionic liquid; ii) removing end-terminal blocking agent from the end-terminal blocked amino acid attached ionic liquid of step i) followed by work up to obtain an amino acid attached ionic liquid; iii) repeating steps i) through ii) one or more times to obtain a polypeptide attached ionic liquid; and iv) detaching the polypeptide from the polypeptide attached ionic liquid of step iii) to obtain the polypeptide. Said process does not use any auxiliary reagents like dehydrating agent or activating agent. The use of ionic liquids as supports as well as solvents result in the faster kinetics of the process, the separation issues are reduced, and the process has no racemization issues. |
US11053275B2 |
Method for bile acid derivative by using continuous flow reaction
Provided herein is a method of preparing a bile acid derivative using a continuous flow reaction. When bile acid derivatives are synthesized using a continuous flow reaction according to the present invention, the reaction is very safe compared to an existing batch-type reaction, the reaction time is significantly reduced, and high-quality bile acid derivatives may be synthesized with high efficiency. In particularly, according to the present invention, a hydrogenation reaction proceeds under substantially water-free reaction conditions, and thus the conversion rate (UDCA: CDCA) of a UDCA hydrogenation reaction may be significantly enhanced. |
US11053274B2 |
Process for the production of estetrol intermediates
The present invention relates to a process for the preparation of a compound of formula (I) said process comprising the steps of: a) reacting a compound of formula (II), with an acylating or a silylating agent to produce a compound of formula (III), wherein P1 and P2 are each independently a protecting group selected from R2—Si—R3R4, or R1CO—, wherein R1 is a group selected from C1-6alkyl or C3-6cycloalkyl, each group being optionally substituted by one or more substituents independently selected from fluoro or C1-4alkyl; R2, R3 and R4 are each independently a group selected from C1-6alkyl or phenyl, each group being optionally substituted by one or more substituents independently selected from fluoro or C1-4alkyl; b) reacting the compound of formula (III) in the presence of palladium acetate or a derivative thereof to produce compound of formula (IV); and c) reacting the compound of formula (IV) with a reducing agent to produce compound of formula (I). |
US11053272B2 |
Cyclic dinucleotides for cytokine induction
A cyclic dinucleotide compound of Formula (I): wherein X1 is H or F; X2 is H or F; at least one among X1 and X2 is a fluorine atom; Z is OH, OR1, SH or SR1, wherein: R1 is Na or NH4, or R1 is an enzyme-labile group which provides OH or SH in vivo such as pivaloyloxymethyl; B1 and B2 are bases chosen from Adenine, Hypoxanthine or Guanine, and B1 is a different base than B2 and a pharmaceutically acceptable salt thereof. Pharmaceutical compositions including the cyclic dinucleotide, as well as their use in the treatment of a bacterial infection, a viral infection or a cancer are also described. |
US11053271B2 |
Methods and compositions for nucleic acid integration
The disclosure provides methods and compositions for the integration (insertion) of a donor DNA molecule into a target DNA molecule. In general, the methods include contacting a target DNA molecule with a linear donor DNA molecule and a Cas 1 protein, where the target DNA molecule includes an AT-rich region (e.g., in some cases positioned 5 and within 50 nucleotides of a region that forms a DNA cruciform structure), where the contacting is not in a bacterial or archaeal cell (e.g., the contacting is in vitro outside of a cell, inside of a eukaryotic cell, etc.), and provides for integration of the donor DNA molecule into the target DNA molecule. |
US11053267B2 |
Electrochromic compound, electrochromic composition, and display element
To provide an electrochromic compound, represented by the following general formula (I): where X1, X2, X3, X4, X5, X6, X7 and X8 are each independently a hydrogen atom or a monovalent substituent; R1 and R2 are each independently a monovalent substituent; A− and B− are each independently a monovalent anion; and Y is represented by the following general formula (II) or (III): where X9, X10, X11, X12, X13, X14, X15, X16, X17, and X18 are each independently a hydrogen atom or a monovalent substituent. |
US11053263B2 |
Halogermanides and methods for the preparation thereof
A trichlorogermanide of formula (I): [R4N]/[R4P]Cl[GeCl3] (I), where R is Me, Et, iPr, nBu, or Ph, tris(trichlorosilyl)germanide of formula (II): [R4N]/[RrP][Ge(SiCl3)3] (II), where R is Me, Et, iPr, nBu, or Ph, a tris(trichlorosilyl)germanide adduct of GaCl3 of formula (III): [Ph4P][Ge(SiCl3)3*GaCl3], and a tris(trichlorosilyl)germanide adduct of BBr3 of formula (IV): [Ph4P][Ge(SiCl3)3*BBr3]. Also, methods for preparing the trichlorogermanides of formula (I), the tris(trichlorosilyl)germanide of formula (II), the tris(trichlorosilyl)germanide adduct of BBr3 of formula (IV). |
US11053262B2 |
Heterocyclic amide compounds having RORyT inhibitory action
The present invention relates to compound (I) or a salt thereof which has a RORγt inhibitory action. In the formula (I), each symbol is as defined in the specification. |
US11053260B2 |
Tri-cycle compound and applications thereof
Disclosed in the present invention are a compound represented by formula (I), a tautomer thereof or a pharmaceutically acceptable salt, and applications thereof in the preparation of drugs for treating HBV-related diseases. |
US11053257B2 |
Production method of thienopyrimidine derivative
The present invention provides a production method of a thienopyrimidine derivative or a salt thereof which has a gonadotropin releasing hormone (GnRH) antagonistic action with high quality in high yield. The present invention provides a method of producing a thienopyrimidine derivative, which comprises reacting 6-(4-aminophenyl)-1-(2,6-difluorobenzyl)-5-dimethylaminomethyl-3-(6-methoxypyridazin-3-yl)thieno[2,3-d]pyrimidine-2,4(1H,3H)-dione or salt thereof, 1,1′-carbonyldiimidazole or a salt thereof and methoxyamine or a salt thereof, and the like. |
US11053248B2 |
[1,2,4]triazolo[1,5-a]pyrimidine compounds as PDE2 inhibitors
The present invention relates to novel [1,2,4]triazolo[1,5-a]pyrimidin-yl derivatives as inhibitors of phosphodiesterase 2 (PDE2). The invention is also directed to pharmaceutical compositions comprising the compounds, to processes for preparing such compounds and compositions, and to the use of such compounds and compositions for the prevention and treatment of disorders in which PDE2 is involved, such as neurological and psychiatric disorders. |
US11053247B2 |
Pyrimidinones as factor XIA inhibitors
The present invention provides compounds of Formula (1): or stereoisomers, tautomers, or pharmaceutically acceptable salts thereof, wherein all the variables are as defined herein. These compounds are selective factor XIa inhibitors or dual inhibitors of FXIa and plasma kallikrein. This invention also relates to pharmaceutical compositions comprising these compounds and methods of treating thromboembolic and/or inflammatory disorders using the same. |
US11053246B2 |
Substituted tricyclic compounds as FGFR inhibitors
The present invention relates to tricyclic compounds, and pharmaceutical compositions of the same, that are inhibitors of one or more FGFR enzymes and are useful in the treatment of FGFR-associated diseases such as cancer. |
US11053230B2 |
3-hydroxy-imidazolidin-4-one compounds as inhibitors of indoleamine 2,3-dioxygenase
The invention relates to a compound of Formula (I): Formula (I), or pharmaceutically acceptable enantiomers, or salts thereof. The present invention also relates to the use of compounds of Formula (I) as selective inhibitors of indoleamine 2,3-dioxygenase. The invention also relates to the use of the compounds of Formula (I) for the treatment or prevention of diseases cancer, infections, central nervous system disease or disorder, and immune-related disorders, either as a single agent or in combination with other therapies. |
US11053229B2 |
Compound, material for organic electroluminescent element, organic electroluminescent element, and electronic device
A compound represented by formula (1): wherein R1 to R7, R11 to R18, L1 to L3, a to c, n, and Ar are as defined in the description, provides an organic electroluminescence device having an emission efficiency and a device lifetime further improved. |
US11053228B2 |
Condensed cyclic compound, composition including the condensed cyclic compound, and organic light-emitting device including the condensed cyclic compound
A condensed cyclic compound represented by Formula 1: Ar1-L1-Ar2 Formula 1 wherein, in Formula 1, Ar1, Ar2, and L are the same as described in the specification. |
US11053225B2 |
Pyrimidine derivative compound, optical isomer thereof, or pharmaceutically acceptable salt thereof, and composition for preventing or treating Tyro 3 related disease comprising same as active ingredient
A pyrimidine derivative compound of Chemical Formula 1, an optical isomer thereof, or a pharmaceutically acceptable salt thereof, and a composition for preventing or treating cancer comprising the same as an active ingredient. The pyrimidine derivative compound of Chemical Formula 1, the optical isomer thereof, or the pharmaceutically acceptable salt thereof has an excellent selective inhibitory effect especially against TYRO 3 among TAM receptor inhibitory effects, and thus can be used as an excellent composition of preventing or treating cancer without adverse effects resulting from the inhibition of Axl and Mer. |
US11053224B2 |
Polymorphic forms of kinase inhibitor compound, pharmaceutical composition containing same, preparation method therefor and use thereof
The invention discloses polymorphic forms of a compound of formula I, pharmaceutical compositions containing same, preparation method therefor and use thereof. The compound of formula I of the present invention is as shown in formula I, of which the crystalline form can be crystalline form 1, crystalline form 2, crystalline form 3, crystalline form 5, crystalline form 6 or crystalline form 7. All the crystalline forms of the compound of formula I in the present invention have good crystalline stability and chemical stability and a decrease in purity of their main ingredient less than 2%. The preparation method of the present invention may be used to produce the various crystalline forms of the compound of formula I with high purity, and suitable for large scale production. |
US11053218B2 |
3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof
The present disclosure provides a compound of Formula (I′): or a pharmaceutically acceptable salt, hydrate, solvate, prodrug, stereoisomer, or tautomer thereof, wherein R1, R2, Rx, X1, n, n1, and q are as defined herein, and methods of making and using same. |
US11053215B2 |
Heterocyclic compounds useful as Pim kinase inhibitors
The present application is concerned with heterocyclic compounds that inhibit the activity of Pim kinases and are useful in the treatment of diseases related to the activity of Pim kinases including, e.g., cancers and other diseases. |
US11053213B2 |
Pharmaceutical compounds
The present invention relates to compounds of Formula (I) that are useful as inhibitors of the activity of the ubiquitin specific protease USP19. The present invention also relates to pharmaceutical compositions comprising these compounds and to methods of using these compounds in therapy. |
US11053211B2 |
Process for pomalidomide
The present invention provides a novel process for the preparation of pomalidomide crystalline Form I. The present invention also provides a process for the purification of pomalidomide. |
US11053204B2 |
Pyrimidinyloxy benzene derivatives as herbicides
Disclosed are compounds of Formula 1, including all stereoisomers, N-oxides, and salts thereof, wherein A, Z, R1 R2, R3 and m are as defined in the disclosure. Also disclosed are compositions containing the compounds of Formula 1 and methods for controlling undesired vegetation comprising contacting the undesired vegetation or its environment with an effective amount of a compound or a composition of the invention. |
US11053198B2 |
1-cyano-pyrrolidine compounds as USP30 inhibitors
The present invention relates to novel compounds and method for the manufacture of inhibitors of deubiquitylating enzymes (DUBs). In particular, the invention relates to the inhibition of ubiquitin C-terminal hydrolase 30 (USP30). The invention further relates to the use of DUB inhibitors in the treatment of conditions involving mitochondrial dysfunction and cancer. Compounds of the invention include compounds having the formula (II) or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, R4, R5, R8, R9, R10, R12, Z, Y and m are as defined herein. |
US11053197B2 |
Carbazole derivatives
Disclosed are compounds of Formula (I): or a salt thereof, wherein Q, R1a, R1b, R2a, R2b, R3, R4, R5a, R5b, R6a, R6c, R7a, R7b, R7c, and R7d are defined herein. Also disclosed are methods of using such compounds as inhibitors of Bruton's tyrosine kinase (Btk), and pharmaceutical compositions comprising such compounds. These compounds are useful in treating, preventing, or slowing the progression of diseases or disorders in a variety of therapeutic areas, such as autoimmune diseases and vascular disease. |
US11053196B2 |
Substituted indoline derivatives as dengue viral replication inhibitors
The present invention concerns substituted indoline derivatives, methods to prevent or treat dengue viral infections by using said compounds and also relates to said compounds for use as a medicine, more preferably for use as a medicine to treat or prevent dengue viral infections. The present invention furthermore relates to pharmaceutical compositions or combination preparations of the compounds, to the compositions or preparations for use as a medicine, more preferably for the prevention or treatment of dengue viral infections. The invention also relates to processes for preparation of the compounds. |
US11053195B2 |
Compounds and uses thereof for the modulation of hemoglobin
Provide herein are compounds and pharmaceutical compositions suitable as modulators of hemoglobin, methods and intermediates for their preparation, and methods for their use in treating disorders mediated by hemoglobin and disorders that would benefit from tissue and/or cellular oxygenation. |
US11053191B2 |
Hydroxy functional alkyl carbamate crosslinkers
A hydroxy functional alkyl carbamate is disclosed having the formula: wherein R comprises a substituted or unsubstituted C1 to C36 alkyl group, an aromatic group, and/or a polymeric moiety; wherein each R1 is independently a hydrogen, alkyl having at least 1 carbon, or a hydroxy functional alkyl having 2 or more carbons and at least one R1 is a hydroxy functional alkyl having 2 or more carbons; and n is 2-6. The present invention is also directed to a composition, and substrates coated therewith, comprising a film-forming resin; and a hydroxy functional alkyl carbamate crosslinker having the formula shown above.Other hydroxy functional alkyl carbamate compounds, polymers made with the same, and compositions comprising the same are also disclosed as are substrates coated at least in part with or formed with any of the compositions described herein. |
US11053189B2 |
Method and mixture to form functionalized cyclic compounds
A method for producing a homocyclic or heterocyclic compound includes reacting a compound of formula (I) with a compound of formula (II) in presence of a base: In formula (I), B is an unsaturated moiety selected from substituted or unsubstituted vinylene, ethynylene, aryleneethynylene, substituted or unsubstituted arylenevinylene, and a combination thereof, the vinylene or arylenevinylene has n (=0, 1 or 2) substituent(s) R2, G is an electron-withdrawing group, R1 is hydrogen or a substituent, and two of R1, R2 and G may joint together to form a ring. In formula (II), R3 and R4 are independently hydrogen or a substituent, R5 is an electron-withdrawing group, and two of R3, R4 and R5 may joint together to form a ring. The conjugate acid of the base has a pKa in the range of 1 to 15. |
US11053184B2 |
Downstream processing of fatty alcohol compositions produced by recombinant host cells
The disclosure relates to downstream processing of fatty alcohol (FALC) and provides a novel purification method that provides FALC at high purity and yield. |
US11053183B1 |
Process and apparatus for separating methanol from other oxygenates
We have discovered that addition of water to a mixture of oxygenates increases their volatility relative to methanol. A process and apparatus are disclosed for separating methanol from other oxygenates. Water is separated from a stream comprising water, methanol and at least one other oxygenate to provide a water rich stream and a methanol and oxygenate rich stream. The methanol and oxygenate rich stream and water are fed to a column to provide an oxygenate rich stream and a methanol and water extract stream. The methanol and water can then be readily separated from each other. |
US11053182B2 |
Method for producing hexafluorobutadiene
By subjecting a starting material composition containing hexafluorobutadiene and at least one additional compound selected from the group consisting of octafluoro-1-butene, octafluoro-2-butene, heptafluoro-1-butene, and heptafluoro-2-butene to extractive distillation in the presence of an extraction solvent to reduce the concentration of the additional compound, hexafluorobutadiene with higher purity can be obtained. |
US11053178B2 |
Parallel reactor system for ethylbenzene dehydrogenation
A multi-stage dehydrogenation process including contacting, in a first stage, a feed stream comprising a hydrocarbon and steam with a dehydrogenation catalyst under dehydrogenation conditions to yield a first stage effluent, heating the first stage effluent, and contacting, in a second stage, the heated first stage effluent with a dehydrogenation catalyst under dehydrogenation conditions to yield a second stage effluent comprising a dehydrogenation product, wherein the first stage includes a first reactor and a second reactor arranged in parallel, and wherein the second stage includes a third reactor connected in series with the first reactor and the second reactor. A multi-stage dehydrogenation system for carrying out dehydrogenation is also provided. |
US11053177B2 |
Process for the production of high purity isobutylene
Processes for the production of high purity isobutylene are disclosed. The processes may include supplying a mixed C4 feed stream to a catalytic distillation column, which may contain a butene isomerization catalyst. 1-butene is isomerized to 2-butene and concurrently in the catalytic distillation column the 2-butene is separated from the isobutane and isobutylene. The overheads fraction comprising the isobutane and isobutylene is then condensed in an overheads system and fed to a splitter, where the isobutane is separated from the isobutylene. The process further includes operating the catalytic distillation column at an overheads temperature greater than a bottoms temperature of the splitter, and heating a portion of the splitter bottoms stream via indirect heat exchange with at least a portion of the catalytic distillation column overheads fraction, thereby producing a heated bottoms stream (reboil vapor) fed to the splitter and a cooled overheads fraction. |
US11053173B2 |
Process for forming a product solution from poultry waste digestate
Disclosed are methods and systems for the conversion of poultry waste into useful products. Some embodiments are directed to a process for forming a product solution from poultry waste. The process includes providing a feedstock that contains greater than 60 percent poultry waste, and anaerobically digesting the feedstock to produce a digestate that has a solids content of about 5% to about 15% by weight. The process also includes separating and classifying the digestate into multiple high solids fractions and a first filtrate. The process also includes adding the high solids fractions to an acid solution to form a slurry that is then separated and classified into multiple second solids fractions and a second filtrate. The process also includes clarifying the first and second filtrates to produce a first and a second centrate. The process also includes mixing the first centrate with the second centrate to form the product solution. |
US11053170B2 |
Liquid urease inhibitor formulations
The present application generally relates to a method for the manufacture of a liquid composition essentially consisting of an organic solvent of the type glycol and a urease inhibitor of the type phosphoric triamide and products obtained therewith. |
US11053169B2 |
Syntactic insulator with co-shrinking fillers
A thermally-insulating composite material with co-shrinkage in the form of an insulating material formed by the inclusion of microballoons in a matrix material such that the microballoons and the matrix material exhibit co-shrinkage upon processing. The thermally-insulating composite material can be formed by a variety of microballoon-matrix material combinations such as polymer microballoons in a preceramic matrix material. The matrix materials generally contain fine rigid fillers. |
US11053166B2 |
Transparent rare earth aluminum garnet ceramics
Provided is a transparent rare earth aluminum garnet ceramic that has a highlight transmission rate and can be mass produced. The transparent rare earth aluminum garnet ceramic is represented by general formula R3Al5O12 (R is an element selected from the group consisting of rare earth elements having an atomic number of 65 to 71) and includes Si and Y as sintering aids, or is represented by general formula R3Al5O12 (R is an element selected from the group consisting of rare earth elements having an atomic number of 65 to 70) and includes Si and Lu as sintering aids. |
US11053164B2 |
Solar control glass article
A solar control glass article includes a transparent substrate provided with a thin multilayer coating having solar control properties. The thin multilayer coating includes an absorber layer sandwiched between a first and second transparent dielectric layers, a functional layer protected by an upper and lower blocker layers and a third transparent dielectric layer provided over the upper blocker layer. The thickness of the functional layer and the thickness of the transparent dielectric layers are adjusted to give a gold colored reflection on a surface opposite to the first surface of the transparent substrate provided with a thin multilayer coating. |
US11053163B2 |
Transparent hydrophobic mixed oxide coatings and methods
A hydrophobic coating and a method for applying such a coating to a surface of a substrate. The method includes applying a coating composition to the surface and heating the coated surface at a cure temperature from about 300° C. to about 600° C. for a time from about 2 hours to about 48 hours. The coating composition is applied to the surface by an application method selected from the group consisting of flowing, dipping, and spraying. The coating composition comprises a yttrium compound, an additive selected from the group consisting of a cerium compound and a dispersion of yttrium oxide nanoparticles, a water-soluble polymer, and a solvent solution of de-ionized water and a water-soluble alcohol. |
US11053162B2 |
Lithium containing glass or glass ceramic article with modified K2O profile near the glass surface
A method of reworking lithium containing ion exchanged glass articles is provided. The method includes a reverse ion exchange process that returns the glass article to approximately the composition of the glass from which the glass article was produced, before being subjected to ion exchange. The reworked glass articles exhibit a K2O concentration profile comprising a portion wherein a K2O concentration increases to a local K2O concentration maximum. |
US11053161B2 |
Glass fluorescent powder slice with multi-layer structure and preparation method therefor, and light-emitting device
A multi-layer glass phosphor powder sheet and its preparation method, and a light-emitting device. The preparation method for the multi-layer glass phosphor powder sheet includes: mixing a first optical functional material, a glass powder and an organic carrier to obtain a first slurry, and mixing a second optical functional material, the glass powder and the organic carriers to obtain a second slurry; coating the first slurry on a first substrate, and drying it at a first temperature so that at least some of the organic carrier is volatilized, to obtain a first functional layer, the first temperature being lower than a softening point of the glass powder; coating the second slurry on the surface of the first functional layer, to obtain a second functional layer; and sintering the first substrate on which the functional layers are coated at a second temperature, to obtain the multi-layer glass phosphor powder sheet. |
US11053159B2 |
Polychromatic articles and methods of making the same
An article includes SiO2 from about 40 mol % to about 80 mol %, Al2O3 from about 1 mol % to about 20 mol %, B2O3 from about 3 mol % to about 50 mol %, WO3 plus MoO3 from about 1 mol % to about 18 mol % and at least one of: (i) Au from about 0.001 mol % to about 0.5 mol %, (ii) Ag from about 0.025 mol % to about 1.5 mol %, and (iii) Cu from about 0.03 mol % to about 1 mol %, and R2O from about 0 mol % to about 15 mol %. The R2O is one or more of Li2O, Na2O, K2O, Rb2O and Cs2O. R2O minus Al2O3 ranges from about −12 mol % to about 3.8 mol %. |
US11053158B2 |
Chopper assembly and method for manufacturing chopped fibers
An assembly for chopping glass fibers including a cutter wheel having a plurality of radially extending blades and a cot wheel adjacent the cutter wheel. The cot wheel including an inner hub, an elastomeric ring mounted onto the inner hub for rotation therewith; and a retaining device fixably attached to the hub and engaging the elastomeric ring to resist separation of the elastomeric ring from the hub during rotation of the cot wheel. |
US11053156B2 |
Method of closed form release for brittle materials using burst ultrafast laser pulses
A method for machining and releasing closed forms from a transparent, brittle substrate includes using a burst of ultrafast laser pulses to drill patterns of orifices in the substrate. Orifices are formed by photoacoustic compression and they extend completely or partially in the transparent substrate. A scribed line of spaced apart orifices in the transparent substrate comprise a closed form pattern in the substrate. A heat source is applied in a region about said scribed line of spaced apart orifices until the closed form pattern releases from the transparent substrate. |
US11053151B2 |
Amorphous alloy, molding die, and method for forming optical element
An amorphous alloy contains Ni and Nb and has a composition including at least one of: a composition containing Nb with a content in the range of 35.6 atomic % to 75.1 atomic %, Ir with a content in the range of 7.2 atomic % to 52.3 atomic %, and Ni with a content in the range of 4.0 atomic % to 48.5 atomic %; a composition containing Nb with a content in the range of 19.6 atomic % to 80.9 atomic %, Re with a content in the range of 7.4 atomic % to 59.2 atomic %, and Ni with a content in the range of 4.1 atomic % to 56.9 atomic %; and a composition containing Nb with a content in the range of 7.5 atomic % to 52.9 atomic %, W with a content in the range of 16.4 atomic % to 47.0 atomic %, and Ni with a content in the range of 22.0 atomic % to 53.3 atomic %. |
US11053146B2 |
Water treatment system and methods thereof
A water treatment system with a photocatalytic nanocomposite sheet, an adsorbent layer, and a fibrous filter, wherein the photocatalytic nanocomposite sheet comprises polymethylmethacrylate and silver phosphate, the adsorbent layer comprises plasma activated carbon nanotubes, and the fibrous filter is a composite of polymethylmethacrylate, polyvinylidene fluoride, and polyvinylpyrrolidone polymer fibers, with carbon nanotubes that are dispersed within the polymer fibers and silver nanoparticles that are deposited on the polymer fibers. Various embodiments of the water treatment system and methods of fabricating the photocatalytic nanocomposite sheet, the adsorbent layer, and the fibrous filter are also provided. |
US11053145B2 |
Apparatus for treating pharmaceutical waste
A compact system for treating pharmaceutical waste at a location at which the pharmaceutical waste is disposed includes a housing having a door. The housing contains a waste influent tank configured to hold and discharge a fluid comprising pharmaceutical waste; a first container configured to hold and discharge hydrogen peroxide utilized in a chemical reaction to treat the pharmaceutical waste; a second container configured to hold and discharge aqueous iron solution utilized in the chemical reaction to treat the pharmaceutical waste; and a neutralizer tank in which the chemical reaction is carried out. The door of the housing is configured to move between an open position and a closed position to allow or deny access to an interior of the housing. |
US11053141B2 |
Water purification device
A device (1) for purification of water driven by gravity through a purification unit between an upper dirt water container (2) and a lower clean water tank (3). A backwash system may be integrated, the system comprising a receptacle (8) for accumulation of the backwash water to prevent consumption thereof by mistake. |
US11053139B2 |
Methods and uses of encapsulated exudates and dried euglena biomass for binding metal
A method of binding a target metal in solution. The method of binding a target metal comprises contacting a solution containing i) a target metal with ii) an encapsulated exudate of a culture of algal flagellate, or a fraction thereof; or an encapsulated dried Euglena biomass or a fraction thereof, to form a complex between the target metal, and the encapsulated exudate or fraction thereof, or the encapsulated dried Euglena biomass or the fraction thereof; and optionally separating the complex from the solution. The disclosure also relates to a biosorbent element, as well as methods of using same in binding a metal in solution. |
US11053131B2 |
Process for the preparation of sodium cyanide
The invention relates to a process for the preparation of alkali metal cyanides as a solid substance, comprising the steps of: i) an absorption step in the form of an absorption of hydrogen cyanide from a hydrogen cyanide-containing synthesis gas in an aqueous alkali metal hydroxide solution; ii) a crystallization step in the form of introducing said alkali metal cyanide solution into an evaporative crystallizer; iii) a separation step; iv) a recycle step; v) a drying step. |
US11053130B2 |
Process for the co-production of methanol and ammonia
A process for the combined preparation of methanol and ammonia based on primary steam reforming a hydrocarbon feed stock and adiabatic secondary reforming with oxygen enriched air from electrolysis of water. |
US11053129B2 |
Magnesium modified Y-type molecular sieve, preparation thereof and catalyst comprising the same
A magnesium modified Y-type molecular sieve has a rare earth oxide content of about 4% to about 11% by weight, a magnesium oxide content of about 0.1% to about 4% by weight, a sodium oxide content of about 0.3% to about 0.8% by weight, a total pore volume of about 0.33 mL/g to about 0.39 mL/g, a percentage of the pore volume of secondary pores having a pore size of 2-100 nm to the total pore volume of the modified Y-type molecular sieve of about 10% to about 30%, a lattice constant of about 2.440 nm to about 2.455 nm, a percentage of non-framework aluminum content to the total aluminum content of the modified Y-type molecular sieve of no more than about 20%, and a lattice collapse temperature of not lower than about 1045° C. |
US11053125B2 |
Graphene from fly ash
Methods of forming graphene may include reacting a dispersed mixture, comprising fly ash, a charged heteroaromatic compound, particularly a pyridinium compound, such as a 1-(4-pyridyl)-pyridinium salt, and a solvent, particularly an alcohol, such as ethanol, with a polymeric oxidizing agent, preferably polymer-supported pyridinium chlorochromate, to form a second mixture; and contacting the second mixture at a temperature of 120 to 180° C. with a gas stream comprising at least 0.1 vol. % CH4 and at least 10 vol. % H2 to form graphene on the fly ash. Methods of managing waste may comprise using fly ash waste to produce graphene. Devices for implementing such methods may involve steel cylindrical reaction vessels including a cover through which a valve-stoppable pipe is fed, which reaction vessel is at least partially surrounded by a heating device, and suitable for handling solvent and fly ash, as well as for receiving gas inflow through the pipe. |
US11053122B2 |
Continuous combustion production equipment for synthesizing ton-grade fullerenes and a synthetic process therefor
A continuous combustion production equipment for synthesizing ton-grade fullerenes and a synthetic process therefor. The continuous combustion production equipment is equipped with a gas supply and flow control system, a liquid supply and flow control system, a vaporization and preheating system, a combustion furnace, a combustor, a spray nozzle, an ignition system, a filter tank, a product collection system, a vacuum control system, a vacuum measuring and displaying unit and a circulation water cooling system. Opening the supply line of gas fuels, arranging the tip of a metal electrode of the ignition system near the gas fuel outlet of the combustor, opening the ignition system, igniting the gas with an electric spark to generate a flame; initiating the vacuum pump set; opening the supply line of liquid raw materials, adjusting to a suitable flux with a constant flow pump; adjusting the pressure of the system to keep it below 5000 Pa. |
US11053113B2 |
Beverage management system
Systems and methods for dispensing beverages are described. The systems and methods enable convenient control and monitoring for dispensing one or more different beverages. The system may include a system for identifying a beverage based on a passive identifier (e.g., quick response (QR code)), a beverage database, a controller for matching a user to a beverage, a flow input device, an automated flow valve, and a flow meter for measuring an amount of the beverage dispensed and generating a signal, so the controller can subtract the amount of beverage dispensed from a beverage allocation amount. |
US11053109B2 |
Systems and methods for automatic beverage dispensing according to a recipe linked with a marker
A system for automatically dispensing beverages according to a drink order. The system includes a conveyor that conveys a plurality of cup holders in and between a cup receiving location, a dispensing location, and a serving location. A cup dispenser is configured to dispense a cup into each of the plurality of cup holders at the cup receiving location. A plurality of additive dispensers is configured to dispense additives to the cup at the dispensing location. A controller is configured to receive the drink order, create a recipe from the drink order and link the recipe with one of the plurality of cup holders via a marker, dispense a cup to the cup holder via the cup dispenser, and thereafter control the conveyor and the plurality of additive dispensers so that the cup is filled with a beverage according to the recipe and then conveyed to the serving location. |
US11053107B2 |
Jack pad holding device and method for jacking an aircraft
A jack pad holding devices for supporting a jack pad to an aircraft, and a method for jacking an aircraft are provided. In one non-limiting example, the jack pad holding device includes a coupler housing configured for holding the jack pad. Coupling elements are coupled to the coupler housing and are configured to couple to the aircraft. |
US11053104B2 |
Boom for a pipelaying machine
A boom for a pipelaying machine includes a pair of posts located in a first plane and disposed in a tapered configuration with respect to a second plane transverse to the first plane. The boom also includes a cross-brace disposed between the pair of posts and located partway along a length of the pair of posts. The cross-brace includes a first link member and a second link member disposed along the first plane. Further, each of the first and second link members are angularly offset from each other and the second plane respectively. Furthermore, ends of the first and second link members are rigidly attached to the pair of posts. The cross-brace further includes a first rib member and a second rib member disposed along the second plane and rigidly attached to the first link member and the second link member respectively. |
US11053102B2 |
Gantry system for replacing full trackside girders under the station platform and installing precast platform panels
A gantry system has at least one crane assembly, at least one support post, and at least one hoist. The crane assembly has a stationary base, a rotating base, and a crane arm. The rotating base is attached to both the stationary base and the crane arm in such a ways as to allow the rotating base and the crane arm to rotate while the stationary base remains stationary. The crane arm is supported on its far end by a support post. The crane assembly is configured such that the support post rests on an in-place girder. A hoist is attached and can move along the crane arm to position a railway component, such as a replacement girder and/or a precast panel. |
US11053097B2 |
Magnet assembly for an electronic safety brake actuator (ESBA)
Disclosed is an electronic safety brake actuator (ESBA) for actuating an electronic brake, the ESBA having: a first member having a proximate side and a distal side spaced in a widthwise direction, a first nominal front surface and a first rear surface spaced in a depth-wise direction, and a first top surface and a first bottom surface spaced in a height-wise direction, a plurality of side members including a proximate member and a distal member, the proximate member disposed adjacent the proximate side of the first member and the distal member disposed adjacent the distal side of the first member, the first member being magnetic and the plurality of side members being at least partially non-magnetic, and the plurality of side members including a respective plurality of nominal front surfaces including a proximate front surface and a distal front surface, the plurality of nominal front surfaces being co-planar. |
US11053095B2 |
Elevator alert system
An elevator alert system for alerting a mechanic working inside a hoistway comprises an elevator car vertically movable within a hoistway, a counterweight vertically movable within the hoistway and a compensation member with one end connected to the bottom of the elevator car and the other end connected to the bottom of the counterweight. The compensation member includes at least one light source attached to the compensation member near the elevator car or counterweight. The at least one light source longitudinally extends along the compensation member over a length. |
US11053092B2 |
Method for feeding laminar elements into an insertion device and feeding station
A method for feeding laminar elements into an introducer associated with a graphic printing station provided for printing at least one of the faces of the laminar element, wherein a plurality of laminar elements are grouped in an orderly manner in a stacked group of laminar elements that extends upwards, such that the longitudinal axis of each of the laminar elements is located perpendicular with respect to an advance direction of the group, the advance direction of the group being perpendicular to the advance direction of the introducer. This group of laminar elements is turned 180 degrees with respect to a rotation axis that is parallel to the advance direction of the introducer, such that the upper face of each one of the laminar elements is oriented downwards, the turned laminar element advancing in a direction perpendicular to the advance direction of the introducer. |
US11053091B2 |
Sheet position detection apparatus, sheet conveyance apparatus, and image formation apparatus
Provided are a sheet position detection apparatus, a sheet conveyance apparatus, and an image formation apparatus. The sheet position detection apparatus has a first and a second conveyance roller which are arranged to oppose across a sheet to be conveyed and to nip the sheet, and a detector configured to detect an end position of the sheet, the detector has a light emitter and a light receptor arranged on the first conveyance roller side, the light emitter and the light receptor are arranged such that a light emitted from the light emitter is reflected on a reflective face of the second conveyance roller and enters the light receptor, and the detector detects passage of an end of the sheet based on a change in the amount of light entering the light receptor when the sheet shields a light emitted from the light emitter. |
US11053090B1 |
Document scanner with envelope discrimination and detection
A system for detecting envelopes from multi-fed documents in a scanning system with a scanning track along which documents move laterally toward a scanning station having a plurality of spaced apart penetrating detectors across the scanning track. The scanners detect a leading edge as a single layer material, i.e. without an air gap and the interior as having an air gap in the document scanned. If a document has an interior air gap, but the leading edge does not, it is first assumed to be an envelope. |
US11053089B2 |
Printing apparatus, control method thereof and storage medium
A printing apparatus includes a conveyance unit configured to convey a tray on which a printing medium is placed, a printing unit configured to perform printing on a print surface of a printing medium on the tray based on a print job, and a first detection unit configured to detect a relative position relationship between the tray and a printing medium placed on the tray. In addition, a control unit is configured to control the printing unit not to perform printing in a case where the first detection unit detects that the printing medium is not placed at an appropriate position, and a selecting unit is configured to select whether to continue printing irrespective of results of the detection by the first detection unit. |
US11053083B2 |
Transport device
A transport device having a plate; an unloading device which pushes a plurality of articles arranged on the plate; a bridge disposed adjacent to the plate; and a conveyor belt which is disposed adjacent to the bridge and which transports a row of articles having been pushed out from the plate. After a predetermined row of articles is pushed out from the bridge onto the belt conveyor, the belt conveyor moves in the same direction as the direction in which the unloading device pushes the articles, separating from the bridge. |
US11053076B1 |
Carton induction optimization in order fulfillment picking system
Technology for optimizing carton induction in an order fulfillment picking system is described. In an example embodiment, a method, implemented using one or more computing devices, may include receiving scan data reflecting status of cartons being conveyed by a conveying system, receiving confirmatory input reflecting pick completion for a subset of the cartons being conveyed by the conveying system, and generating an estimated time of arrival for one or more cartons not yet inducted into the conveying system based on the scan data and the confirmatory input. The method may further include generating a load forecast based on the estimated time of arrival and inducting one or more of the one or more cartons into the conveying system based on the load forecast. |
US11053065B2 |
Tablet and capsule dispensing assembly
A dispensing assembly, including a case including at least one aperture, a drive gear operatively arranged to engage the case, a tablet disc rotatably arranged in the case and including a plurality of compartments, and an electronics assembly, including a motor engaged with the drive gear, and a housing operatively arranged to engage the tablet disc, wherein the motor is arranged to rotate the electronics assembly and the tablet disc with respect to the case to align the plurality of compartments with the at least one aperture. |
US11053062B2 |
Food tray
A food tray has a lower tray containing a first food product and an upper tray nested stably at least partly inside the lower tray, with the upper tray containing a second food product. An air permeable interface is provided between the upper tray and lower tray to allow venting of steam from the lower tray during cooking. A cover is provided for the food tray. Each of the lower tray and the upper tray are formed of a material that is suitable for use in a microwave or conventional oven. Various constructions may be used to create the air permeable interface, such as lugs, ledges and lips. The upper tray may sit above the lower tray. The trays are nested loosely for ease of removal of the upper tray from the lower tray. Various configurations of cover may be used such as a sleeve, carton or lid. The upper tray may contain the higher value food product. |
US11053060B2 |
Resealable moisture tight container assembly for strips and the like having a lip snap seal
A substantially moisture tight container and lid assembly for storing and packaging moisture-sensitive items comprising an assembly with a container and a lid, the lid is attached by a hinge to an upper housing portion of the container, the lid includes a lip seal member that depends downwardly from the lid, the lip seal member is configured to abut at least a portion of the interior side of the container when the lid is in the closed position resulting in a substantially moisture tight seal between the lid and the lid, and the container assembly further comprising a base portion and an upper housing portion, the upper housing portion is capable of being snap-fit into the base portion by employing a lip seal mechanism to form a substantially moisture-tight seal. |
US11053059B2 |
Vacuum sealed container and method for using thereof
The present application discloses a vacuum sealed container, including a container body, a container lid, a vacuum generator, at least one magnifier and an indicator. The container body includes a first wall and a bottom surface, wherein the first wall and the bottom surface define an accommodation space. The container lid is coupleable to the container body. The vacuum generator is coupled to the container lid to evacuate fluid from the accommodation space. The at least one magnifier is coupled to the container body. The indicator is coupled to the container. A method for using the aforementioned vacuum sealed container is also disclosed. |
US11053058B2 |
Base having mounting portions and elastic pieces for mitigating damaging forces experienced by a device positioned thereon
An apparatus according to one embodiment includes a base having at least three mounting points on an upper surface thereof, an elastic block above each of the mounting points, and an elastic panel coupled to, and extending along, the upper surface of the base in a region between the mounting points. An apparatus according to another embodiment includes a base having at least three mounting points on an upper surface thereof, an elastic block above each of the mounting points, and at least two elastic pads positioned in recesses in the upper surface of the base. An apparatus according to another embodiment includes a base having at least three mounting points on an upper surface thereof, and an elastic panel coupled to, and extending along, the upper surface of the base in a region between the mounting points. The apparatus further includes at least two elastic pads. |
US11053057B2 |
Volume-reducing overlapping-scale container system and method
A volume-reducing overlapping-scale container system and method for reducing empty air space within the container as the contents are removed, providing a spiral-grooved overlapping-scale container body with a continuous downward spiraling groove along a cylindrical side surface having overlapping scales that provide added structure to the container while allowing easy cutting from an acute angle, and providing a cutting cap to seal the container body, and having mounted inside a reducing cutter to follow and cut through the continuous downward spiraling groove when the cutting cap is turned in a nominally clockwise direction, yielding a smaller container and a tail of removed material, a tail channel within the cutting cap to allow passage of the tail of removed material out of the cutting cap, and a tail-trimming cutter that moves away from the tail of removed material during clockwise rotation of the cutting cap, and moves into and cuts the tail of removed material when the cutting cap is rotated counterclockwise. |
US11053054B2 |
Spout fitment and cap
A spout fitment and cap assembly for a dispensing container is provided. The spout fitment and cap assembly includes a fitment and a cap. The fitment includes a generally tubular shape surrounding a central axial passage and multiple horizontal sealing ribs configured to secure the fitment to the dispensing container. The cap includes a generally tubular shape with an annular wall extending circumferentially about an exterior surface of the tubular shape, a central plug portion, and multiple flow openings surrounding the central plug portion. The cap is slidably coupled to the fitment and is configured to be actuated between a first position and a second position through an application of force to the annular wall. |
US11053045B2 |
Locking packaging container
The technology disclosed herein includes a storage apparatus comprising an inner sleeve, including a first tab including memory-inducing laminated material, a second tab including memory-inducing laminated material, and an inner sleeve storage compartment; and an outer sleeve encompassing the inner sleeve when the storage apparatus is locked, and including a first aperture for receiving the first tab in a first locking mechanism, and a second aperture for receiving the second tab in a second locking mechanism. |
US11053043B2 |
Method and arrangement for emptying a flexible container
The present invention relates to a method and an arrangement for emptying a flexible container (30) of bag contents (31) therein. Such a flexible container includes a bottom opening (34) in its lower end and a top opening (37) in its upper end. When this container is to be emptied of its contents, it is placed in an emptying arrangement in such a way that the container's bottom opening lies below the top opening. The flexible container is then turned around an axis of rotation that unites said bottom opening and top opening. The turning motion produced is gradually propagated from the container's upper end towards its lower end whereby the container is twisted into a tight string (32). This twisting contributes to removing the bag contents (31) from the flexible container via the bottom opening (34) provided or made therein. |
US11053042B2 |
Crushed end of self-mating closure segment for lap or fin seal
This disclosure pertains to a forming device used in the formation of a package with a self-mating reclosure, where a single self-mating closure wraps around the periphery of the forming device, and one end of the zipper segment extends into the lap seal of the forming device. Alternatively, one or two ends of the zipper segment could extend into a fin seal. The self-mating reclosure is mounted transversely on the sheet of web or film and includes at least one crushed end proximate to one edge of the sheet of web or film. The self-mating closure may be pre-crushed, prior to attachment to the sheet of web or film, or may be crushed after the sheet of web or film is wrapped around a forming device or similar structure. |
US11053039B2 |
Processing device for foil pouches
The invention relates to a processing device for foil pouches, comprising a plurality of pouch receiving elements arranged side by side, each of them being configured to receive and transport one foil pouch, a plurality of pairs of oppositely disposed ramps arranged successively in the direction of transport, the pouch receiving elements being transported in a guided manner along said ramps when in operation, the distance of oppositely disposed ramps defining the width of the pouch receiving elements, and an adjusting element configured to automatically adjust the distance transversely to the direction of transport between oppositely disposed ramps. |
US11053035B2 |
Method for handling and drying cardboard tubes
A method for handling and drying cardboard tubes is provided. The method involves using the skids for supporting cardboard tubes during the drying, wrapping and transport of the cardboard tubes, in order to reduce handling of the tubes while maintaining a low moisture level in the tubes. |
US11053030B2 |
Load-decoupling attachment system
A load-decoupling attachment system is configured to secure a component to a primary structure. The load-decoupling system includes a fore end coupling bracket that is configured to attach to a fore end of the component. A first tie rod is coupled to the fore end coupling bracket. The first tie rod is configured to couple to a first portion of the primary structure. A second tie rod is coupled to the fore end coupling bracket. The second tie rod configured to couple to a second portion of the primary structure. A universal joint mount assembly is configured to couple to an aft end of the component and a third portion of the primary structure. |
US11053029B1 |
Modular high thermal capacity spacecraft
A modular spacecraft is provided. The modular spacecraft includes a bus module and a payload module. The bus module provides additional thermal radiative capacity for the payload module by including a bus-panel payload thermal zone that couples operational components of the payload module to a radiator panel in the bus module. The bus module also includes its own operational components that are thermally coupled to the radiator panel but that are thermally isolated from the payload module and the bus-panel payload thermal zone. |
US11053027B2 |
Space-based gas supply system
A method of supplying a receiving tank of a receiving spacecraft with a supply gas. The method includes coupling a second end of a transfer line in flow communication with the receiving tank. The transfer line extends from a first end to the second end. The first end is coupled to a transfer tank disposed on a supply spacecraft. The transfer tank holds a transfer quantity of the supply gas. The supply spacecraft includes a heating system coupled in thermal communication with the transfer tank and a transfer valve operatively coupled to the transfer line. The method also includes activating the heating system while the transfer valve is closed such that a pressure of the transfer quantity of the supply gas is increased. The method further includes opening the transfer valve, wherein a difference between the increased pressure of the supply gas in the transfer tank and a pressure in the receiving tank causes a portion of the transfer quantity of the supply gas to flow through the transfer line to the receiving tank. |
US11053026B2 |
Tool and method for inspecting the quality of assemblies of structural elements of aircraft
A device and an inspection method for inspecting screw and nut assemblies in an aircraft, comprising a mechanical tool and a digital human-machine interface. The mechanical tool comprises a housing comprising a bearing surface defining a reference plane, a support beam mounted to be translationally mobile inside the housing, a linear encoder configured to measure, in use, a distance between the reference plane and a bottom face of the mobile support beam. The digital human-machine interface comprises a central unit, a display screen, an application and a database in which are stored validity ranges or standardized distances relating to types of assembly, the application and the database being loaded and operational in the central unit. |
US11053015B2 |
Engine pylon having a drain
An engine pylon that is used for supporting an engine, the engine pylon including a pylon body having an upper pylon and a lower pylon. The pylon further includes a fairing that covers the pylon body such that the upper pylon and fairing define a predetermined region. Moreover, the pylon includes a first drain that is configured to discharge a flammable liquid leaking from a pipe provided within the predetermined region into outside air; and a ventilation path configured to bring the inside of the predetermined region into communication with the outside air. The first drain includes a drain port and a drain pipe, wherein the drain pipe extends in a rear direction from the drain port and has an outlet at a rear end of the drain pipe, the outlet being located past a rear end of the upper pylon and a rear end of the lower pylon. |
US11053014B2 |
Vertical takeoff and landing aircraft
A method for operating a vertical takeoff and landing aircraft includes modifying a first variable component of a wing associated with a first portion of the plurality of vertical thrust electric fans relative to a second variable component of the wing associated with a second portion of the plurality of vertical thrust electric fans to adjust an exposure ratio of the first portion of the plurality of vertical thrust electric fans relative to the second portion of the plurality of vertical thrust electric fans. |
US11053013B2 |
Unit for generating non-propulsive electrical power
A unit (1′, 10′, 100′) for generating non-propulsive electrical power for use on board an aircraft, the unit (1′, 10′, 100′) comprising an electricity production device (3, 30) comprising a gas turbine (31) and an electricity generator (32) mechanically connected to an outlet shaft (33) of the gas turbine (31), said electricity generator (32) including output electrical connections (320) for being electrically connected to an electrical power supply network (2, 20, 200) on board an aircraft.The unit (1′, 10′, 100′) includes energy storage means (5) and regulator means (6) configured to control the speed of rotation of the gas turbine (31) as a function of the electrical power required by the on-board electrical power supply network (2, 20, 200). |
US11053008B2 |
Parasite aircraft for airborne deployment and retrieval
A parasite aircraft for airborne deployment and retrieve includes a wing; a fuselage rotatably mounted to the wing; a dock disposed on top of the fuselage and configured to receive a maneuverable capture device of a carrier aircraft; a pair of tail members extending from the fuselage; and a plurality of landing gear mounted to the wing. A method of preparing a parasite aircraft for flight includes unfolding an end portion of a wing; unfolding an end portion of a tail member of the parasite aircraft; and rotating a fuselage of the parasite aircraft so that the fuselage is perpendicular to the wing. A method of preparing a parasite aircraft for storage includes rotating a fuselage of the parasite aircraft to be parallel with a wing of the parasite aircraft; folding an end portion of the wing; and folding an end portion of a tail member of the parasite aircraft. |
US11053006B2 |
Systems and methods of delivering products with unmanned delivery aircrafts
In some embodiments, systems, apparatuses and methods are provided to enhance delivery of packages. Some embodiments provide an unmanned delivery system comprising: a rotational drive shaft; a crane motor cooperated with the drive shaft that is rotated by the crane motor; a first crane system with a first cord fixed with the first crane system, wherein the first crane system is configured to cooperate with the drive shaft to control the first crane system in controlling the spooling and retraction of the first cord; a control circuit coupled with the crane motor; and a stop switch electrically coupled with the control circuit and positioned to be contacted by a package release hanger secured with the first cord when the first cord is retracted to a first threshold; wherein the control circuit is configured to stop the crane motor in response to receiving a signal from the stop switch. |
US11053004B2 |
Aerodynamic drone using airfoil-designed fuselages and associated parts
This invention is directed toward an aerodynamically designed drone with a unique angle of propulsion. The drone uses airfoil design to move more efficiently through the air, and the aerodynamic design is optimized when the drone is tilted forward at various degrees of “tilt” to provide the most aerodynamic profile to the oncoming air. The invention contemplates single hull, double hull and triple hull designs, and is applicable to heaving lifting drones, drones use for photography and remote sensing, and racing drones. |
US11052999B2 |
Compound helicopters having auxiliary propulsive systems
A fully compounding rotorcraft includes a fuselage having first and second wings extending therefrom and configured to provide lift compounding responsive to forward airspeed. A twin boom includes first and second tail boom members that extend aftward from the first and second wings. An empennage is coupled between the aft ends of the tail boom members. An anti-torque system includes a tail rotor that is rotatably coupled to the empennage. An engine is disposed within the fuselage and is configured to provide torque to a main rotor assembly via an output shaft and a main rotor gearbox. An auxiliary propulsive system is coupled to the fuselage and is configured to generate a propulsive thrust to offload at least a portion of a thrust requirement from the main rotor during forward flight, thereby providing propulsion compounding to increase the forward airspeed of the rotorcraft. |
US11052996B2 |
Lifting surface
A lifting device including: a movable discontinuity (1) located in a surface of the lifting device, the movable discontinuity (1) being movable between: an active position in which the movable discontinuity (1) acts as vortex generator, and a passive position in which the movable discontinuity (1) is integrated into the surface of the lifting surface, a conduit (2) located in the spanwise direction of the lifting surface and in communication with the movable discontinuity (1), the lifting surface including openings (3) in its surface spanwise distant from each other in communication with the conduit (2), the movable discontinuity (1) and the conduit (2) being configured such that when an airflow goes through the conduit (2), this airflow activates the movable discontinuity (1) to act as a vortex generator of the lifting surface. |
US11052992B2 |
Mini-spoilers for enhancing the effectiveness of lateral-control surfaces of aircraft wings
Mini-spoilers for enhancing the effectiveness of lateral-control surfaces of aircraft wings are described. An example aircraft includes a wing, a lateral-control surface, and a mini-spoiler. The lateral-control surface is movably coupled to the wing. The lateral-control surface is movable between a neutral position, a first upward deflected position, and a second upward deflected position extending beyond the first upward deflected position. The mini-spoiler is located on or forward of the lateral-control surface. The mini-spoiler is movable between a retracted position and a deployed position. The mini-spoiler is configured to be moved from the retracted position to the deployed position based on the lateral-control surface being moved from the neutral position to or toward the first upward deflected position. |
US11052991B2 |
Fairing for an aircraft
A fairing for an aircraft is disclosed in which the fairing comprises a first fairing portion configured to be fixedly attached to a first structural component and having a first edge; a second fairing portion configured to be fixedly attached to a second structural component and having a second edge, wherein the first edge and the second edge define an interface configured to enable relative movement between the first fairing portion and the second fairing portion. |
US11052988B2 |
Aircraft element comprising a leading edge having a system for preventing the clogging of holes produced in the leading edge
An element including a leading edge forming a box delimited by a skin forming a lower surface and an upper surface and pierced with holes, in which the skin includes an inner wall and an outer wall that are electrically conductive and an electrically insulating intermediate wall, a pump for expelling or injecting air from or into the box. Each hole is equipped with an anti-clogging system including a conductive base, a needle made of piezoelectric material, one end of which is secured to the base, an electrical generator generating an electrical current in the needle, in which the form of the needle is such that a space is created between the needle and the edges of the hole, and in which the base has a recess in the extension of the space. Such an installation makes it possible to eliminate the residues which are lodged in the holes. |
US11052987B2 |
Integrally damped composite aircraft floor panels
A sound-damping panel. The sound-damping panel includes a first face sheet. The sound-damping panel also includes a core connected to the first face sheet. The core has a honeycomb structure. Walls of the honeycomb structure are embedded with a viscoelastic material configured to dampen sound in a pre-selected frequency range. The sound-damping panel also includes a second face sheet connected to the core, the second face sheet opposite the first face sheet relative to the core. |
US11052986B2 |
Aeronautic glazing comprising a sheet of acrylic polymer having improved mechanical properties
An aeronautical glazing unit includes at least one sheet of modified acrylic, wherein the sheet is combined with at least one other sheet of modified acrylic, and/or at least one sheet of cast poly(methyl methacrylate) (PMMA), and/or at least one sheet of another transparent polymer such as polycarbonate (PC), and/or at least one sheet of glass in particular that is chemically strengthened, as a laminated and/or multiple glazing unit. |
US11052983B2 |
Marine propulsion system
There is disclosed a marine propulsion system for a shaft-driven boat. The system includes a recess formed in the hull of the boat, and a drive cassette. The drive cassette includes: a housing; a static tube extending rearwardly from the housing and fixed relative thereto; and at least one drive shaft extending through the static tube and into the housing. The drive shaft is supported for rotation within the static tube by at least one shaft bearing, and is rotatably supported within the housing by thrust bearings. The static tube, the drive shaft, the or each shaft bearing, and the thrust bearings are all coaxially aligned with one another. The housing and the recess are mutually configured such that the housing may be engaged within the recess to install the drive cassette within the drivetrain of the boat. |
US11052970B2 |
Control device for wirelessly controlling at least one component of a bicycle
A control device for a bicycle is arranged or can be arranged on the handlebar of the bicycle and serves to wirelessly drive at least one electronic, electrical, electromechanical or electrohydraulic component of the bicycle. The control device includes an operator control arrangement which has at least one manually operable operator control element and is designed to respond to operation of the operator control element and to output electrical signals which represent the operation. The control device also includes at least one electronic circuit arrangement comprising a radio communication circuit and a control circuit which is connected or can be connected to the operator control arrangement. The control device also may include at least one antenna which is connected or can be connected to the radio communication circuit or which is integrated into the said communication circuit. |
US11052969B2 |
Cassette and body for mounting a cassette on a bicycle rear wheel hub
A cassette adapted for mounting on a bicycle rear wheel hub and a by a mounting body for positioning the assembly on a bicycle rear wheel hub. The cassette has a plurality of adjacent sprockets fixedly connected to one another along an axis of the cassette. The cassette has an axial centering opening for centering on the mounting body without transmission of torque, and a plurality of attachment areas positioned a greater radial distance from the axis of the cassette than the radius of the centering opening for attachment to the mounting body. |
US11052968B2 |
Electric bicycle
An electric bicycle comprises a removable battery pack (1) for storing electrical energy, and a frame element (5) to which the battery pack (1) is intended to be fixed. The battery pack comprises a housing and a lock arranged in said housing and the frame element (5) comprises a projecting locking element (21), said locking element (21) penetrating into the housing of the battery pack (1) through an entry opening so as to co-operate with said lock with a view to fixing said battery pack (1) to said frame element (5). |
US11052964B2 |
Bicycle frame assembly
There is provided a bicycle assembly including a front frame portion having at least one front frame support member. The bicycle assembly also includes a rear frame portion having at least one upper rear frame support member and at least one lower rear frame support member. At least one junction member is removably coupled with the front frame support member, the junction member having a lower frame member coupling end portion and an upper frame member coupling end portion. The lower rear frame support member is coupled with the lower frame member coupling end portion. The upper rear frame support member is coupled with the junction member between the lower frame member coupling end portion and the upper frame member coupling end portion. There is thereby provided a modular bicycle frame assembly wherein components may be removed and replaced to accommodate user biomechanics and terrain aspects. |
US11052958B2 |
Bicycle seats
A seat for a pedal-powered vehicle includes a support frame, a left seat element, a right seat element, and a nose. The left and right seat elements and the nose are implemented as separate components supported by the support frame. The two seat elements support a seated rider's weight while the nose does not. The seat elements and the nose form a gap below the seated rider's perineum area. The seat elements pivot forwards and backwards when the seated rider is pedaling. The seat elements counter-pivot when the seated rider is pedaling. Each seat element includes a concave surface that supports the seated rider. |
US11052955B2 |
Spare wheel catcher in a vehicle
A spare wheel catcher in a vehicle comprises a base adapted to be connected on a rear differential and a catcher plate. The base includes a support extending along a longitudinal direction of the vehicle at an assembled position and a connection member; and the catcher plate is connected with a first end of the support and forms an obtuse angle with a forward moving direction of the vehicle. |
US11052953B2 |
Tank trailer wrap
An aerodynamic wrap for use with a tank trailer illustratively includes opposing first and second side assemblies. In an illustrative embodiment, each side assembly includes an upper panel pivotably supported by the tank trailer, and a lower panel pivotably supported by the upper panel. A lower connecting member illustratively couples the lower panels of the first and second side assemblies under the belly of the tank trailer. |
US11052949B2 |
Rear vehicle body structure
Provided is a rear vehicle body structure that includes: a right and left pair of frame members each extending in a front-rear direction and having a damper supporting part; rear wheel wells; a rear floor panel; a rear cross member upper part connecting the right and left pair of frame members to each other on a front side of the damper supporting parts; front side reinforcements provided along a vehicle cabin inner side of each of the rear wheel wells and extending in an up-down direction on the front side of the damper supporting parts; and a reinforcing member mounted on each of the frame members and having a reinforcing member main body that reinforces the damper supporting part and a reinforcing member coupling part that couples together the rear cross member upper part and the front side reinforcement. |
US11052948B2 |
Vehicle hood outer panel stretching mechanism
An assembly includes a vehicle hood outer panel and hood panel stretching mechanism coupled to the hood panel. The stretching mechanism includes a first hood attachment portion affixed to the panel at a first location, and a second hood attachment portion affixed to the panel at a second location. A first arm has a first end coupled to the first attachment portion, and a second end opposite the first end. A second arm has a first end coupled to the second attachment portion, and a second end opposite the first end. The mechanism is structured so that simultaneous movement of the first arm second end and the second arm second end toward a line extending between the first attachment portion and the second attachment portion causes movement of the first attachment portion and the second attachment portion to increase a spacing between the hood attachment portions. |
US11052947B2 |
Structural component
A structural component, in particular for a vehicle, includes a beam and at least one energy absorption device which is disposed on a portion of the outer surface of the beam. The beam is profiled and has at least one inner chamber. |
US11052946B2 |
Modular reconfigurable vehicle frame system
A modular, reconfigurable frame that can be combined into multiple standardized segments to create different core vehicle configurations is described herein. The frame includes a plurality of components that affix together universally to make multiple versions of cycle, vehicle, and airframe styles. The reconfigurable frame includes a quick pin and fastener that allows for transportation platforms to be incorporated into the frame in a modular fashion. |
US11052942B2 |
Three-wheeled tilting vehicle
A tiltable vehicle is configured to transform between an autonomous mode and a rideable mode by pivoting the handlebars and steering column of the vehicle about a pitch axis. In the autonomous mode, the steering column is folded back toward the chassis and a tiltable chassis of the vehicle is prevented from tilting. In the rideable mode, the steering column is unfolded and the chassis is free to tilt. In some examples, a tiltable vehicle includes features beneficial for vehicle-sharing, such as parking devices or a basket. These features may be included on any suitable vehicle and are not limited to use on transforming vehicles. |
US11052941B2 |
Rod-end suspension arm
A rod-end front suspension is provided for an off-road vehicle. The rod-end front suspension comprises a spindle assembly that is pivotally coupled with an upper suspension arm by way of a first rod-end joint and pivotally coupled with a lower suspension arm by way of a second rod-end joint. A steering rod-end joint coupled with the spindle assembly pivotally receives a steering rod. An axle assembly coupled with the spindle assembly conducts torque from a transaxle to a wheel coupled with the spindle assembly. Each of the first and second rod-end joints comprises a ball rotatably retained within a casing. The ball is fastened within a recess between parallel prongs extending from the spindle assembly. A threaded shank extending from the casing is threadably fixated with the suspension arm, such that the spindle assembly may be moved with respect to the casing and the suspension arm. |
US11052939B2 |
Steering feel control apparatus and method of motor driven power steering
A steering feel control apparatus of a motor driven power steering (MDPS) system may include: a filter configured to filter a motor current inputted to a motor, in order to remove a vibration component which generates vibration on a steering wheel; and a controller configured to control the filter to remove the vibration component of the motor current when the MDPS is driven. |
US11052937B2 |
Splined component assembly and method
A rack and pinion assembly for a vehicle steering assembly includes a pinion shaft having a splined region comprising a plurality of splines extending longitudinally in an axial direction of the pinion shaft. The rack and pinion assembly also includes an axial retention feature integrally formed on the splined region to axially retain a component matable with the pinion shaft. |
US11052935B2 |
Motor-adjustable steering column for a motor vehicle
A motor-adjustable steering column for a vehicle includes a supporting unit attachable to a vehicle body and by which there is held an adjusting unit in which a steering spindle is mounted so as to be rotatable about a longitudinal axis. An adjustment drive is connected to the supporting unit and to the adjusting unit and is adjustable relative to the supporting unit. The adjustment drive includes a drive unit and a threaded spindle which engages in a spindle nut and which has a threaded spindle axis. The threaded spindle and the spindle nut can be driven to rotate relative to one another about the threaded spindle axis by the drive unit. To prevent slipping or spinning of the spindle drive in a crash situation the adjustment drive includes a blocking device which can be brought into a blocking position for blocking the threaded spindle relative to the spindle nut. |
US11052934B2 |
Foldable strollers and related methods
Foldable strollers and related methods are disclosed herein. An example frame for use with a stroller includes a first leg, a second leg, a first joint to couple the first leg and the second leg, a handle arm, and a second joint to couple the handle arm and the first leg. The second joint includes a first portion having a pocket and a second portion including a lock slidably disposed in the second portion. The lock is to be removably coupled to the pocket. The handle arm is to rotate relative to the first leg via the second joint when the lock is removed from the pocket. The rotation of the handle via the second joint is to enable the second leg to rotate relative to the first leg via the first joint to fold the frame. |
US11052932B2 |
Foldable tricycle
A foldable tricycle is provided and has a frame having a first end and a second end, a seat connected to the frame, a front wheel adjacent the first end of the tricycle, and a rear wheel adjacent the second end of the tricycle. A head tube housing is provided adjacent the first end of the main frame, and a fork is provided adjacent the first end of the tricycle. The front wheel is rotatedly secured to the fork. A stem extends from the fork and supports a handlebar, wherein a portion of the head tube housing is slidingly connected to the stem, and wherein the tricycle can be manipulated between a use position and a folded position by sliding a portion of the head tube toward the handlebar. |
US11052930B2 |
Robotic arm cart having locking swivel joints and other position adjustment features and uses therefor
Apparatuses and methods described herein relate to arm carts for transporting and securing a robotic arm to a surgical table. In some embodiments, an arm cart may include an arm support having two joints that can be manipulated to move an arm into a position in which a coupler of the arm is engageable with a coupling site of a surgical table. In some embodiments, an arm cart may include an arm support that is rotatable and translatable to permit movement of an attachment area for receiving and attaching a coupling site of a surgical table to a coupler attached to an arm. In some embodiments, an arm cart may include an arm support that releasably couples to a middle segment of the arm positioned at least two segments away from an end of the arm having a coupler for coupling to a coupling site of a surgical table. |
US11052929B1 |
Obstruction detection system
A control system may be provided that may include one or more processors. The one or more processors may be configured to receive obstruction information related to a defined area from at least one optical sensor, determine an obstruction is in the defined area based on the obstruction information in response to actuation of a first safety device that is configured to prevent the obstruction from entering the defined area, and communicate an actuation signal to a second safety device to control movement of the second safety device based on the obstruction determined to be in the defined area. |
US11052921B2 |
System and method for engaging a driver during autonomous driving mode
The present subject matter relates to a method and system maintaining driver alertness while driving mode of a vehicle is changed from manual to autonomous driving mode. The system includes a monitoring module to detect a transition from a manual drive mode to an autonomous drive mode. Based on this, a driver monitoring module gets activated. The driver monitoring module once activated, monitors the driver alertness during the autonomous drive mode. The system further includes an interactive module, which is connected to the monitoring module that gets activated in case alertness level of the driver falls below a first threshold value. The first threshold value may be determined based on multiple attributes. Further, the interactive training program is deactivated if the alertness of the driver is equal or greater than a second threshold value. |
US11052919B2 |
Situation-dependent sharing of map messages to improve digital maps
A system for creating a digital map for driver assistance systems of a vehicle, includes a communications unit for exchanging messages between vehicles. A position acquisition unit acquires the position of the individual vehicle. A map unit stores and processes a digital map. A detection unit detects ambiguities of a driving situation in relation to a position in the digital map. Upon detection of an ambiguity, a message including map data and/or a warning message is/are output. |
US11052917B2 |
Vehicle control device provided in vehicle and method for controlling vehicle
A vehicle control device includes at least one processor configured to perform operations including: performing a function related to autonomous driving based on a sensor signal from a sensing unit of a vehicle; autonomously driving the vehicle based on performance of the function related to autonomous driving; in a state in which the vehicle is autonomously driven, receiving an update request related to a first sensor of the sensing unit from a communication unit of the vehicle; determining presence of a second sensor configured to provide the sensor signal for performance of the function related to autonomous driving; and in response to reception of the update request, updating information related to the first sensor based on presence of the second sensor. |
US11052916B2 |
Conveyance amount controlling apparatus
A conveyance amount controlling apparatus includes a control state detector, a road surface state detector, and at least one conveyance amount controller including a conveyance device conveying, to a driver, information representing a road surface state and a conveyance amount controlling device controlling a vibration conveyance amount as a conveyance amount of a vibration caused by a road surface irregularity. A second conveyance amount, as the vibration conveyance amount obtained when a road surface state amount less than a first threshold is detected by the road surface state detector, is less than a first conveyance amount, as the vibration conveyance amount obtained when execution of an automatic driving control is not detected by the control state detector. A third conveyance amount, as the vibration conveyance amount obtained when the road surface state amount equal to or greater than the first threshold is detected, is greater than the second conveyance amount. |
US11052915B2 |
Intoxicated vehicle driver accident reduction system
A sobriety ignition interlock system including an engine control device and a method for managing available vehicle engine power using the sobriety ignition interlock system. The engine control device includes an engine control processor (ECP) that is electronically connected in between an engine control unit (ECU), an engine sensor assembly, and a sobriety processor. The sobriety processor determines a sobriety level of a vehicle driver and sends a corresponding sobriety signal to the ECP. The ECP intercepts an engine signal transmitted from the engine sensor assembly to the ECU and manipulates the engine signal according to the sobriety signal, in order to manage the available power of the vehicle engine. |
US11052908B2 |
Parking assistance for a motor vehicle for parking on public and private land
The invention relates to a method for operating a parking assistance device (2) of a motor vehicle (1), comprising a) learning a parking trajectory (4) between an initial position (5) and a parked position (6) of the motor vehicle (1) by means of a computing unit (3) of the parking assistance device (2) in the case of parking which is controlled by a driver of the motor vehicle (1); b) checking whether the learnt parking trajectory (4) runs over public land (11) or over private land (12) in at least one respective section (13, 14); c) driverless parking of the motor vehicle (1) along the parking trajectory (4) exclusively in a section (14) of the checked parking trajectory (4) which runs over private land (12), in order to increase safety during a parking process which is assisted or carried out by the parking assistance device (2). |
US11052906B2 |
Dynamic roll over control system for machines
A dynamic roll over control system generates ground speed signals indicative of a current speed and compares the current speed to a desired speed. The desired speed is determined based upon the machine characteristics, the payload of the bed, the yaw rate of the bed, the pitch rate of the bed, and the roll angle of the bed. When the current speed of the machine exceeds the desired speed, the controller generates prime mover control signals to control operation of the prime mover to slow the machine so the current speed does not exceed the desired speed. |
US11052902B2 |
Method for determining the maximum force to be transmitted to the driving wheels of a vehicle provided with a hybrid power train
A method determines a force to be transmitted to driving wheels of a vehicle provided with a hybrid power train with several gear ratios and a traction battery. The method includes determining, over all of a speed range that the vehicle is capable of achieving, a maximum force that the power train is theoretically capable of transmitting to the wheels in predetermined nominal conditions of charge of the traction battery and/or of outside temperature and/or of atmospheric pressure; and determining, over all of the speed range, a drivability force that the power train is capable of transmitting to the wheels. The drivability force confirms that whatever the value of the speed of the vehicle, the drivability force is less than or equal to the maximum force; and the drivability force evolves within the speed range without exhibiting an inflexion point at values of the speed requiring a gear change. |
US11052898B2 |
Methods and system for managing torque of a driveline
Systems and methods for operating a vehicle that includes an engine that may be automatically stopped and started are described. In one example, a requested driver demand power may be filtered via a first order low pass filter in response to a powertrain speed. The filtered requested driver demand power may be a basis for automatically stopping and starting an engine. |
US11052895B2 |
Vehicle control unit
When acceleration control is interrupted due to a lane change or the like, the engine speed is controlled from a high rotation speed to a low rotation speed, a variation in engine speed increases, and poor driver's driving performance is brought about. Furthermore, suppression of acceleration when there is a lane change possibility may rather cause the lane change and the driver feels discomfort. The vehicle control unit according to the present invention includes a target engine speed calculation unit which corrects a target engine speed to be reduced relative to a predetermined target engine speed when the acceleration/deceleration possibility determination unit determines that there is a deceleration possibility during acceleration to a target vehicle speed in automatic acceleration/deceleration control, and an engine control unit which controls an engine to have a target engine speed corrected by the target engine speed calculation unit. |
US11052889B2 |
Method for the automated electronic control of a braking system and electronically controllable braking system in a utility vehicle
A method for automatic electronic control of a brake system in a vehicle includes reading a request signal for automatic electronic control of actuators in the vehicle. At least one of the actuators has an influence on actual longitudinal vehicle dynamics of the vehicle, and requests that are to be implemented by the actuators for realizing automatically requested target longitudinal vehicle dynamics are transmitted via the request signal. The method further includes plausibility-checking the request signal to establish whether the requests are, or can be, implemented completely or without error by the actuators, taking into account a tolerance, and determining a correction deceleration and/or a correction velocity if the implementation of at least one of the requests has not taken place, or cannot take place, completely or without error, taking into account the tolerance, in order to specify corrective braking. |
US11052887B2 |
Electric component assembly, and brake fluid pressure control device for vehicle
An electric component assembly includes a housing with which an electric component is fitted, and the electric component and the housing are fixed to one surface of a base body. The electric component includes a connection terminal press-fitted to a through-hole (201a) of a board provided in the housing, and an insertion direction of the connection terminal into the through-hole is a fitting direction of the electric component with the housing. The electric component assembly includes a rib which is protrudingly provided on either one of an outer surface of the electric component intersecting the fitting direction and an inner surface of the housing facing the outer surface, and a groove portion which is provided as a recess on another one of the surfaces and the rib is inserted into; and a protrusion that abuts onto the rib is provided on an inner surface of the groove portion. |
US11052884B2 |
Braking control for rail vehicles with adaptive lining characteristic curve
The invention relates to a device and a method for controlling a braking device of a rail vehicle, wherein a pressure characteristic curve of the braking device is changed by means of characteristic curve change device as a function of a frictional characteristic of a type of brake lining used in the braking device. |
US11052880B2 |
Parking lock arrangement
A parking lock arrangement for a drive train of a motor vehicle includes a controllable locking mechanism and an unlocking mechanism. The controllable locking mechanism includes a spindle drive with a spindle shaft rotationally drivable about a spindle axis, an actuator for rotating the spindle shaft and a positioning element movable by rotating the spindle shaft for actuating a blocking element. The blocking element acts at least indirectly on a drive element in a blocking or releasing manner. The unlocking mechanism includes an unlocking element and a manually operable control element. The unlocking element is movable via the control element from a normal position, in which the unlocking element is spaced apart from the spindle shaft, into an engagement position, in which the unlocking element is coupled in torque-transmitting manner to the spindle shaft for forced releasing of the locking mechanism. |
US11052879B2 |
Apparatus and methods for powered trailer dollies
Power dollies can be used for moving moveable objects such as trailers. A power dolly could include a frame, a mount and a plurality of wheel sets. The mount could couple the power dolly to a moveable object. One or more of the plurality of wheels sets could be powered. The plurality of wheels sets could be separated into a primary wheel set and one or more support wheel sets. The wheels of the primary wheel set could extend farther from the frame that the wheels of the support wheel sets. |
US11052878B2 |
Manually-operable hydraulic stabilizing system
A stabilizing system includes a plurality of jacks, each operated by a corresponding hydraulic actuator. A hydraulic fluid transfer pump supplies hydraulic fluid to and receives hydraulic fluid from one or more pressure chambers of the actuator. A pilot-operated check or directional valve may be provided in fluid communication with one or more of the pressure chambers and configured to regulate the flow of hydraulic fluid to and from the pressure chamber. A directional control valve may connect the pump output with the jacks via respective pilot-operated directional valves. The directional control valve may include a plurality of switch positions respectively connecting the pump output with pairs of the jacks. |
US11052867B1 |
Dedicated emergency seatbelt hinge
An emergency secondary release system is provided. The seatbelt's lap belt section is split into a lower belt section and an upper belt section. A release latch upper section terminates the lower belt section. A release latch lower section terminates the upper belt section. A connection mechanism in the form of a connection pin, cotter pin, hitch pin or clevis pin releasably connects the release latch upper section to said release latch lower section. The instant abstract is neither intended to define the invention disclosed in this specification nor intended to limit the scope of the invention. |
US11052858B2 |
Behavior control airbag apparatus
A behavior control airbag apparatus including: a floating cushion disposed in a seating part of a seat, and configured to push up a passenger on the seating part while deployed by gas injected by an inflator; and a behavior cushion disposed eccentrically on an outboard side of the floating cushion, and configured to push up the outboard side of the passenger according to the injection of the gas, such that the passenger is inclined to an inboard side. |
US11052856B1 |
Foldable brake pedal apparatus for autonomous driving vehicle
A foldable brake pedal apparatus for an autonomous driving vehicle is provided. A brake pedal is exposed to the interior of the vehicle allowing a driver to manipulate the brake pedal in a manual driving mode and the brake pedal is prevented from being exposed to the interior of the vehicle to prevent the driver from manipulating the vehicle in an autonomous driving situation. |
US11052852B2 |
Impact detection system
An impact detection system is disclosed for detecting and identifying an object colliding with a vehicle. The impact detection system comprises a sensor arrangement arranged to measure a characteristic of an impact of the object against the vehicle, a trigger determiner associated with the sensor arrangement for determining whether the characteristic of the 5 impact is greater than a predefined threshold value, and an image capturing device arranged to capture an image of the object. The system is arranged to automatically make the captured image available for inspection in response to the trigger determiner determining that the characteristic of the impact is greater than the predefined threshold value so that the object in the image can be identified substantially in real-time. |
US11052850B1 |
Underride guard
Vertical brackets extend downwardly from a trailer or semi-trailer frame to a transverse tubular bar to form an underride guard. The transverse tubular bar includes a top, a bottom, a rear impact side and a forward side and extends beyond the vertical brackets to define two end portions. The top and bottom have slits therethrough on the outer half of the end portions extending from inwardly of the rear impact side toward the forward side at an angle toward the vertical brackets. The slits extend toward the vertical brackets at an angle at least 45° through a portion of their length and parallel to the longitudinal axis of the vehicle through a second portion. The forward side includes two converging surfaces from the top and bottom. The slits extend from the top and bottom no more than half way to the convergence of the two surfaces. |
US11052849B2 |
Vehicle member
A vehicle member comprises a wooden member and a resin cover member integrally covering the wooden member. The vehicle member absorbs or transmits a received load. The cover member integrally includes a load acting portion and an attaching portion. The wooden member is positioned in the vehicle member so that a shaft center direction of annual rings is aligned with an input direction of the load. The attaching portion is attachable to an attached member of a vehicle. |
US11052845B2 |
Cast bumper system and method of manufacturing same
A bumper system including a bumper beam being cast from metal having a front panel and a back panel, extending between a first bumper beam end and a second bumper beam end. A plurality of reinforcing ribs integrally cast with the bumper beam extends between the front panel and the back panel defining a non-uniform cross-sectional profile along a portion of the bumper beam. The front panel includes a front center portion disposed between a pair of front side portions. The back panel includes a back center portion disposed between a pair of back side portions. The front center portion has a front center portion thickness greater than a back center portion thickness. Each of the front side portions has a front side portion thickness being less than a back side portion thickness of adjacent one of the back side portions. Method of manufacturing the bumper system is provided. |
US11052841B2 |
Electric drive device and electric power steering device
Heat radiation base body 23 that is adjacent to electric motor unit EM and extends in direction of rotation shaft of electric motor is provided close to rotation shaft of electric motor. Board 24 of one electronic control unit of redundant system is fixed to heat radiation base body along direction in which heat radiation base body 23 extends with thermal conduction to heat radiation base body 23 allowed. Board 26 of the other electronic control unit of redundant system is fixed to heat radiation base body so as to face to board 24 of one electronic control unit of redundant system, with thermal conduction to heat radiation base body 23 allowed. Rotation position detection circuit board 22 to which neutral terminals 31 of electric motor for each phase are connected is provided between heat radiation base body 23 and motor housing 20. |
US11052839B2 |
Binding structure of wire routing material, and engaging member
A binding structure of wire routing materials are formed by: elongated wire routing materials; a binding member for binding the wire routing materials; and an engaging member including a movable body portion including an engaging portion for assembly into a vehicle body, and a bound portion to be bound and held together with the wire routing materials by the binding member. The bound portion includes a main portion facing the wire routing materials, and a leg portion extending from the main portion and being in contact with the wire routing materials. The movable body portion includes a sliding portion disposed such that sliding thereof is allowed on the wire routing materials in a gap. |
US11052838B2 |
Engaging member
An engaging member is formed by a binding member and a body member separate from the binding member being combined. The binding member has a belt portion that winds around an outer periphery of a wire routing material, and a buckle portion capable of fixing both ends of the belt portion. The body member includes, as an engaging portion for assembly into a vehicle body, a pillar portion to be inserted in a fixing hole of the vehicle body, and an elastic latch piece that is inserted, together with the pillar portion, in the fixing hole, is elastically deformed so as to approach the pillar portion when inserted, is elastically restored in the inserted state, is latched by and against a peripheral portion of the fixing hole. The pillar portion has a buckle storing portion in which the buckle portion is stored. |
US11052836B2 |
Portable display device
The present invention relates generally to illuminated display devices and methods of displaying indicia, advertisements, etc. on a changeable illuminated display. The display device comprises a frame structure having an open space. The display device further comprises a compact image display device operable to display an image, the compact image display device held and positioned relative to the frame structure such that the image, when displayed by the compact image display device, is visible through the open space. Additionally, control circuitry is coupled to the compact image display device. |
US11052834B2 |
Vehicular vision system with windshield mounted camera
A method for providing image processing for a plurality of vehicular driving assist systems includes mounting a camera module at a portion of an in-cabin side of a windshield of a vehicle. The camera module houses a camera, a circuit board, at least one electrical connector and an image processor. The camera is electrically connected to circuitry of the circuit board via a flexible electrical connection. With the camera module mounted at the vehicle windshield, electrical power is provided to the camera via the flexible electrical connection, the camera is controlled via the circuitry, the camera is operated to capture image data, which is provided to the circuitry via the flexible electrical connection and is received at the circuitry. The image processor processes the image data received at the circuitry of the circuit board for the plurality of driving assist systems of the vehicle. |
US11052833B2 |
Camera mounting structure, camera apparatus, and jacket
Provided is a camera mounting structure for attaching an in-vehicle camera to a vehicle. An optical protection window cover 503 is inserted into an opening 500 on the vehicle body side together with a camera 500 main body. It is possible to reduce the proportion of the water droplet 502 adhering to the surface of the optical protection window cover 503 with respect to the viewing angle of the camera 500, enabling the observer to visually recognize the presence of the water droplet 502 in visual examination of an image. In addition, the optical protection window cover 503 uses its body 602 to cover the side surface of a camera apparatus main body to implement positional alignment of a camera apparatus. |
US11052825B2 |
Side clearance device for motor vehicle, side viewing system and associated motor vehicle
The invention concerns a side clearance device for motor vehicle comprising: a first section comprising a first end fixed with a fastening plate; the said first section extending according to a first direction (XI); a second section comprising a first end connected with a second end of the said first section; and the said second section extending according to a second direction (X2); the said first and second sections having a drag coefficient of under 0.45; the said second section possessing a terminal surface (20) between 40 and 600 mm2, opposite to the said first end of the said second section; the said terminal surface (20) being designed to extend in the field of vision of the driver when the said fastening plate is fixed onto a vehicle. |
US11052824B2 |
Rear view device and vehicle with such rear view device
An external rear view device for a motor vehicle includes a casing which has at least one part made from a polymer, wherein the at least one part of the casing comprises piezo-electrical particles and at least one conductive element which is in electrical contact with the piezo-electrical particles and inductively coupled to a power storage unit. A motor vehicle with such a rear view device is also described. |
US11052823B2 |
Vehicle rear monitoring system
A vehicle rear monitoring system includes a camera that captures an image of an area to a rear of a vehicle, and a processing unit that processes the image captured by the camera. The processing unit creates a first vehicle rear image that is displayed in a first display area that is a portion of a display area of a display device, when traveling forward, and creates a second vehicle rear image that is displayed in a second display area that is within the display area of the display device and that is an area that includes the first display area and is larger than the first display area, when traveling backward. |
US11052820B2 |
Variable lighting system for a vehicle
Interior panels for an interior of a vehicle, vehicles, and methods for making interior panels for an interior of a vehicle are provided. In one example, the interior panel includes a first trim section having a first exposed surface configured to face towards the interior. A second trim section that has a second exposed surface configured to face towards the interior is disposed adjacent to and spaced apart from the first trim section to define a gap. A first lighting array that includes light sources is configured to be disposed proximate the gap hidden from the interior by the second trim section. A controller is configured to be in communication with the first lighting array to independently direct each of the light sources to generate light that passes through the gap into the interior and illuminates the first exposed surface to define an illumination pattern. |
US11052818B2 |
Large vehicle turning safety warning apparatus
The invention provides a large vehicle turning safety warning apparatus, which is mainly through a warning device set on at least one turning warning zone of a car body, and a control signal is generated by a control module to control the starting or closing of the warning device, or to control the warning device to execute a warning mode. In this way, when vehicles or pedestrians approach the car body, the warning device can be known by the warning device, so as to evade the invisible zone of the car body. Thus, the safety of driving is increased to avoid the occurrence of related traffic accidents because the driver of the car body cannot know whether there are pedestrians or related vehicles in the invisible zone. |
US11052809B2 |
Cable reel trailer
The present invention discloses various aspects of a cable reel trailer that uses the automotive force of a tractor or truck used to transport the trailer, a method of making same, and a method of using. The inclusion of a pivotally connected tongue that is pivotally connected to the main frame of the trailer overcomes many of the aforementioned problems with the prior art because there is no motor or hydraulic system necessary for lifting the cable reel securely on to the trailer. In accordance with the present invention, the towing automotive force, such as a truck, tractor or any other hauling vehicle, provides all the power for lifting the cable reel, rather than requiring a separate power source on the trailer for doing the heavy lifting. By locking up the wheel on the trailer with a wheel stop, the forward movement provided by a towing truck can concentrate on lifting the cable reel instead of moving the trailer forward. This means that no separate on-board power is needed for lifting the cable reel. |
US11052808B2 |
Expandable buggy for vehicle
Apparatus and method for handling and securing cargo in a vehicle bed. The apparatus is a buggy with an adjustable width platform and an adjustable length handle that is both a locking device and a lifting device. The platform has a pair of frame rails with multiple adjustable length crossmembers spaced therebetween. The platform has wheels that allow the buggy to be moved between a loading position and a transport position. The handle is used to move the platform between the two positions. The handle has an adjustable length to secure the buggy in the transport position. In another embodiment, a tailgate hook with a catch that holds the platform captive in the vehicle. A shield is releasably positioned over a portion of at least two crossmembers of the platform. The shield has a surface that supports small and/or odd shaped cargo to prevent such cargo from falling between crossmembers. |
US11052803B2 |
Roof handle
A roof handle for vehicles comprises a carrier which can be fixed to a vehicle roof and on which a handle body is pivotably mounted in order to be pivotable between a holding position, in which a user exerts a substantially downwardly directed weight force on the handle body, and a starting position, in which the handle body is pivoted by a spring into a folded-up position with respect to the vehicle roof, the carrier comprising a molded body made of plastic on which at least one insert made of metal is provided, and the handle body being held on the insert made of metal via bearing elements. As a result, the roof handle can have a low dead weight and be optimally adapted to the geometry of a vehicle roof. |
US11052800B2 |
Seat core material
A seat core material of the present invention is a seat core material for vehicle including a thermoplastic resin expanded bead article and a frame member embedded in a peripheral edge portion of the expanded bead article. The frame member includes a front frame part, a rear frame part, and two side frame parts interconnecting the front frame part and the rear frame part. Slits crossing the two side frame parts are formed along a longitudinal direction with continuous parts left intact outside the side frame parts on both ends of the expanded bead article. The slit penetrates or does not penetrate the expanded bead article in a thickness direction. The continuous parts are formed in a curved shape or a bent shape. |
US11052797B2 |
Recliner heart for seat assembly
A recliner heart includes a housing member, a locking plate and a pawl. The housing member includes a plate surface having a first recess and a second recess. The locking plate includes a surface having teeth formed thereon. The pawl is movable in the first recess between a secure position in which the pawl is engaged with the teeth of the locking plate and a release position in which the pawl is disengaged from the teeth of the locking plate. The pawl includes a boss slidably received in the second recess. A first lateral side of the boss abuts against a sidewall of the second recess upon an impact event. |
US11052796B2 |
Vehicle seat
A vehicle seat for attaching to a vehicle structure of a vehicle has a seat part and a backrest. The vehicle seat is movable in the longitudinal direction of the vehicle in relation to the vehicle structure and adjustable into a resting or lying seat position. In the event of a collision, the vehicle seat with the seat part is or can be pivoted upwards along an axis extending parallel to the vehicle transverse direction, with a front region facing away from the back rest. The backrest, at least in the resting or lying position, is or can be connected to the vehicle structure of a tensile force transmission element. |
US11052795B2 |
Motor vehicle rear seat backrest provided with a stiffening plate
The present invention concerns a motor vehicle rear seat backrest suitable for being mounted in such a way that it can pivot on the structure of said vehicle between a raised position and a substantially horizontal stowed position, said backrest comprising a reinforcement (30) comprising a metal frame (32) and an array of metal wires (33) extending between the two uprights and between the two crossmembers of said frame (32), and a padding (40) supported by the front part of said reinforcement (30) and a cover (50) externally covering said reinforcement (30) and said padding (40); further comprising a stiffening plate (60) held via holding means (54; 55) against the inner face of the back (52) of said cover (50) and bearing against the rear part of said reinforcement (30). |
US11052791B2 |
Seat adjuster
A seat adjuster includes an adjustable slider, a cam lever, and/or a pivot arm. The cam lever may be rotatably connected to the slider at or about a cam-slider axis such that the cam lever pivots about the cam-slider axis when the slider is adjusted. The pivot arm may have a first arm end and a second arm end disposed opposite one another. The first arm end may be rotatably connected to the cam lever at or about a cam-arm axis such that, when the slider is adjusted, (i) the cam lever pivots about the cam-arm axis and (ii) the pivot arm pivots about an arm-housing axis extending through the second arm end. |
US11052787B2 |
Seat adjustment mechanism
A vehicle seat having a base (10) and a squab (11) and an adjustment mechanism (20) whereby the position of an occupant sitting in the seat can be adjusted, the mechanism being configured so as to permit the seat to follow a motion path that provides coordinated adjustment of both height and back inclination of the occupant, the motion path being such that as the height of the occupant is raised the back inclination of the occupant becomes less supine. |
US11052786B2 |
Vehicle
A vehicle includes: a driving seat; a pair of doors; a seat moving mechanism configured to move the driving seat between a driving state and a receiving state, the driving seat in the driving state being positioned at a vehicle width direction center and facing a vehicle front, and the receiving state satisfying at least one condition of: the driving seat being positioned closer to one door of the pair of doors than in the driving state or the driving seat facing further toward the one door than in the driving state; a detection unit configured to detect a portable device in a detection area in a vicinity of the vehicle and outside a passenger compartment; and a seat control unit that controls the seat moving mechanism so as to move the driving seat into the receiving state. |
US11052785B2 |
Seating arrangement of an autonomous automobile
A seating layout of an autonomous automobile, which is aligned in a roughly rounded, circular or elliptical arrangement is disclosed. The seating layout comprises of a seating area and a cabin structure to provide a unique travelling experience in terms of atmosphere and feelings for the passengers along with different aspects of travel such as comfort, safety, ergonomics, etc. The seating area and the cabin structure are aligned and assembled together in such a way that the passengers are oriented towards a common focal area. This arrangement stimulates interaction and in turn, provides a communal atmosphere to the passengers. The novelty of this layout in an autonomous automobile will result in a visually unique interior. |
US11052782B1 |
Onboard field weakened AC charger
A charging system for a vehicle is provided. The charging system is for charging an energy storage system of the vehicle using grid power. The grid power may be an external three-phase AC. The charging system may use field weakening techniques to reduce a peak line-line voltage detected at input terminals of conversion circuitry when a need is determined. |
US11052774B2 |
Rail transit braking energy recovery system and hybrid power rail transit
A rail transit braking energy recovery system. The rail transit braking energy recovery system comprises a braking motor, a fuel battery, an electrolytic bath, and a hydrogen tank. The braking motor is used for converting braking energy of the rail transit into electric energy. An output end of the braking motor is connected to a power input end of the electrolytic bath. The electrolytic bath comprises a hydrogen output end and an oxygen output end, the hydrogen output end is connected to the hydrogen tank, and the hydrogen tank is connected to the fuel battery and is used for supplying hydrogen to the fuel battery. In the system, only the electrolytic bath is structurally added, and the existing vehicle-mounted hydrogen tank is directly used for storing hydrogen, therefore the structure is simple, the self weight of the vehicle body is reduced, the energy conversion efficiency is high, and at the same time, the injection of hydrogen is reduced and the operation cost is reduced. In addition, the purity of the hydrogen obtained by means of electrolysis is high, so that the hydrogen can be directly supplied to the fuel battery to be used without being processed. Also provided is a hybrid power rail transit system. |
US11052773B2 |
Vehicle structure of electric automobile
There is provided a vehicle structure of an electric automobile including: a center module having a battery that is accommodated beneath a floor of a vehicle cabin; a front module that is joined to a vehicle front side of the center module; a rear module that is joined to a vehicle rear side of the center module; a driving unit that is provided at one of the front module or the rear module, and that is connected to the battery; and a control unit that is provided at another of the front module or the rear module, and that controls autonomous driving of the vehicle. |
US11052765B2 |
Control system
A first and a second control device capable of transmitting and receiving signals to and from a third control device that performs an overall management to the control devices. The third device transmits a command signal to the second device in response to a reception signal from the first device. The first device transmits, to the second device and the third device, an electrical power storage unit signal includes at least one of control information and abnormality information about charging/discharging. The second device includes a function of controlling actuation of a rotating electrical machine on the basis of an actuation command signal about actuation of the rotating electrical machine transmitted from the third device in response to the electrical power storage unit signal, and a function of controlling actuation of the rotating electrical machine on the basis of the electrical power storage unit signal transmitted from the first device. |
US11052763B2 |
Electric apparatus and electric apparatus module
An electric apparatus (air pump), which operates by receiving a power supply from a drive control apparatus (PDU) mounted in a fuel cell vehicle, includes a first connection terminal section configured to directly connect to the drive control apparatus, and a second connection terminal section configured to connect to the drive control apparatus via a cable. |
US11052762B2 |
Cockpit for a vehicle
A cockpit for a vehicle includes an interactive device and an instrument panel. The interactive device includes an entry section that collects a first voice messages produced by vehicle occupants and an output section that outputs a second voice messages to the vehicle occupants. The instrument panel is provided at a vehicle cabin front portion. The interactive device is fixed to the vehicle width direction center of the instrument panel. The entry section and output section are exposed to the vehicle cabin interior. |
US11052761B2 |
Vehicle display system using gaze interactions with multiple display areas
A control device in a vehicle display system includes: a gazed image display output unit configured to display a normal gazed image in a part of each of main screen areas; a gazed image visual recognition determination unit configured to determine, based on a line-of-sight state, whether an occupant visually recognizes a normal gazed image in one of the main screen areas; and a main screen area selection unit configured to select, based on an input unit, the main screen area corresponding to the normal gazed image determined to be visually recognized by the occupant. Earlier selection display information displayed in an earlier selection main screen area selected earlier by the main screen area selection unit is displayed in a later selection main screen area selected later. |
US11052759B2 |
Traveling vehicle
A traveling vehicle includes: a body; a steering wheel that is attached to the body and rotates around a rotating shaft; and a forward-reverse switching lever that switches between a forward position, a neutral position, and a reverse position. The forward-reverse switching lever includes: a lever main body that is pulled up at the neutral position and swings forward or rearward in a pulled-up state; and a grip mounted to an upper portion of the lever main body, the grip includes: a base portion including an upper face; and a protruding portion protruding downward from the base portion, and the protruding portion includes: a distal face that is opposite a rotating-shaft side of the protruding portion; a first side face; and a second side face. |
US11052749B2 |
Longitudinally mounted dual-power source automobile drive assembly
A drive assembly is provided with an automatic transmission, comprising a first input shaft, a first power source is connected to the first input shaft, an output shaft, and an intermediate shaft; a first stage of deceleration gear train is mounted through the first input shaft and the intermediate shaft, an Nth stage of deceleration gear train is mounted through the intermediate shaft and the output shaft, and N≥2; and a second input shaft is provided parallel to the intermediate shaft or the output shaft, a second power source is connected to the second input shaft, a driving gear on the second input shaft is engaged with any the second stage to the Nth stage, and the power of the second power source is transmitted to the output shaft via the one stage of deceleration gear train. |
US11052747B2 |
Multi-mode powertrains
A powertrain has an engine, a continuously variable power source (CVP), an output shaft and a transmission configured to provide selection between a plurality of transmission modes. The transmission includes a variator, with first and second output members, that is operably connected to the engine and the CVP and forward, reverse, first speed and second speed transmission components, each having an engaged position and a disengaged position. The transmission configured to provide at least first and second forward transmission modes and a reverse transmission mode in each of which combined power from the engine and the CVP rotates the output shaft. The forward, first speed and second speed transmission components are substantially coaxial with the output members of the variator. |
US11052746B2 |
Horizontal drive assembly of dual power source vehicle
A vehicle drive assembly with transverse dual-power-source, comprising two power sources and an automatic transmission. The automatic transmission has a first input shaft and a second input shaft, and the two power sources are respectively connected to the two input shafts; a first intermediate shaft is provided parallel to the first input shaft, a second intermediate shaft is provided coaxial with the first input shaft, a third intermediate shaft is provided coaxial with the first intermediate shaft, and a first gear and a second gear on the first intermediate shaft are in engaged transmission; a third gear shaft and a fourth gear on the second intermediate shaft are in engaged transmission; and a fifth gear and a sixth gear on the third intermediate shaft are in engaged transmission, and the sixth gear is simultaneously in engaged transmission with a seventh gear on a differential. |
US11052742B2 |
Mounting system for an electrical power delivery system
A mounting system includes a chassis, guide rods, and lifting elements. The guide rods extend from a back wall of the chassis and are suspended above a support platform of the chassis. A first guide rod is spaced a designated height above the support platform to be received within a channel of a module while the module is disposed on the support platform. The first guide rod guides movement of the module towards the back wall. As the module approaches the back wall, a first lifting element engages the module at an angled contact interface to lift the module off the support platform responsive to additional movement of the module towards the back wall. When the module is fully loaded, the module is supported by the back wall, the first lifting element, and/or the first guide rod, and is spaced apart from the support platform by a gap. |
US11052739B2 |
Quick release window gasket for escape window
A window assembly moveable between open and locked positions having a pane of window glass held in a gasket attached to a window frame with adhesive. When in the locked position, the gasket has a removable pull strip enclosed in an internal channel which when removed allows the gasket to move to the open position, allowing safe exit through the window opening. |
US11052738B2 |
Deflector structure for sunroof device
Provided is a deflector structure for a sunroof device to inhibit an arm portion from being pivoted when a vehicle traveling, with a simple structure. The deflector structure includes: a fixed part fixed to a side frame; an affected part arranged anterior to the fixed part and affected by onrushing air; an arm portion having one end pivotally connected to the fixed part and the other end holding the affected part, and vertically pivoted about the fixed part; and a lock member having one end pivotally connected to the arm portion and the other end pivoted in conjunction with the arm portion being pivoted, wherein the lock member is configured such that a lock main body of the lock member is in contact with the fixed part and raised, at a predetermined pivot position, to lock the arm portion being pivoted downward. |
US11052735B2 |
Wind deflector and roller blind panel of an automobile and method for producing a functional element
A method for producing a functional element of an automobile that can be folded and/or wound up, having the steps of providing a fabric that can be folded and/or wound up, arranging the fabric on an application table or in a casting tool in a level arrangement and molding at least one edge strip made of a polyurethane material to the fabric under atmospheric pressure. Furthermore, a wind deflector element of an automobile is provided to a roller blind panel of an automobile, each comprising a fabric that can be folded and/or wound up and that is provided with an edge strip made of a polyurethane material and forming an edge reinforcement. |
US11052733B2 |
Convertible skeleton door
A vehicle door assembly includes a door housing configured for covering a vehicle access opening. A frame member is disposed within the door housing. A module includes an intrusion beam coupled to the frame member and removable from the door housing. The module is configured to accept attachment of a module hinge and a module latch to provide a secondary door assembly. A modular vehicle door assembly and a method of assembling a door assembly to a vehicle are also disclosed. |
US11052728B2 |
Air inlet apparatus and method for operating an air inlet
A method for operating an air inlet in a vehicle includes setting, via a touch-sensitive operator control unit in an air stream of the air inlet, a temperature and/or a volume flow of air flowing into an interior of the vehicle through the air inlet. The method also includes controlling a color of one or more luminous elements of the operator control unit depending on the setting of the temperature and/or of the volume flow. An apparatus for an inflow of air includes an air inlet, the air inlet configured to provide an inflow of an air stream into a vehicle interior, and a touch-sensitive operator control unit positioned in front of the air inlet such that the touch-sensitive control unit is disposed in the air stream, the touch-sensitive control unit being configured to set first and second operating parameters of the air inlet. |
US11052723B2 |
Air conditioning system for use with unenclosed mowers
An air conditioning system for use with unenclosed mowers is provided. The system is designed for installation on unenclosed mowers to provide conditioned air to operators of such mowers. The system comprises an air conditioning unit and a compressor drive assembly. The air conditioning unit is configured to generate and emit conditioned air and comprises a compressor, condenser, and evaporator unit. The compressor drive assembly may interconnect the mower's engine to the air conditioning unit such that rotational motion generated by the engine is transmitted to the air conditioning unit. To this end, the compressor drive assembly may include a crankshaft pulley assembly, a gearbox having two pulleys, and a plurality of pulley belts. The system may also include an alternator. |
US11052722B2 |
Air-conditioning system
An air-conditioning system, in particular for a motor vehicle, having a refrigerant circuit, which has an evaporator and a condenser, and a coolant circuit, wherein the refrigerant circuit and the coolant circuit are thermally coupled to each other, in particular in the region of the evaporator and in the region of the condenser, wherein the coolant circuit has a line system having junctions, wherein a heating body, a cooling body, an outside heat exchanger, an additional heat source, a first bypass line, and a second bypass line are integrated into the line system, wherein the first bypass line bypasses the additional heat source from the cooling body to the outside heat exchanger, and/or the second bypass line bypasses the additional heat source from the heating body to the outside heat exchanger. |
US11052720B2 |
Method for actuating the vibration damper of a wheel suspension
A method for actuating the vibration damper of a transportation vehicle wheel suspension including generating data which represents the topography of the roadway lying in front of the transportation vehicle; analyzing the data with respect to roadway unevenness; adjusting the vibration damper while taking into consideration the evaluation of the roadway unevenness, wherein the amplitude spectrum of the roadway unevenness is ascertained from the data; and generating a specification for the damping of the vibration damper based on the amplitude spectrum. |
US11052718B2 |
Active suspension control unit and method
An active suspension control unit may include an actuator having an active roll stabilization (ARS) structure to variably adjust response characteristics of a suspension, and a controller for determining a driving situation of a vehicle through information input from a sensor, and determining a final desired control value of the actuator based on a desired relative suspension vertical force value set in advance according to the driving situation and a difference value generated by a difference between left and right wheel's relative suspension vertical velocities. |
US11052714B2 |
Automotive suspension for a sport car
An automotive suspension for a sports car comprising a lower oscillating arm and a shock absorber having a relative end connected with a first intermediate part of the lower oscillating arm by means of a connecting rod having a first end hinged with said end of the shock absorber and a relative second end, opposite to the first end, hinged with said first intermediate part, locking means for locking said connecting rod in a stable position ranging between two extreme positions wherein said first end of the connecting rod is in a position close to or distal relative to the frame of the car. |
US11052712B2 |
Tire pressure indicating device
A tire inflation viewing device that enables to view the proper operation of the inflation arrangements and that, in turn, enables to determine which of all of the tires is being inflated and has an air leak. |
US11052706B2 |
Composite layer tire
A green tire includes a plurality of sheets of green rubber having a substantially circular shape, wherein each sheet of green rubber includes an upper ring and a lower ring, and each sheet of green rubber further includes a plurality of spoke portions extending from the upper ring to the lower ring. The green tire further includes a plurality of reinforcements. Each reinforcement is disposed between adjacent sheets of green rubber. At least one reinforcement is sandwiched between the upper rings of adjacent sheets of green rubber, and at least one reinforcement is sandwiched between the spoke portions of adjacent sheets of green rubber. |
US11052702B2 |
Resealable wet or dry application roller apparatus container with a single use disposable liner insert
A resealable wet or dry application roller container, with optional disposable insert liner, for the sealed storage and transportation of a wet or dry application roller, either by itself, or while remaining attached to the application roller frame, and after rolling off any excess paint from a wet application roller, and being sealed within container, with, or without, optional disposable insert liner, does not leak regardless of orientation. |
US11052696B2 |
Sheet bundle discharging apparatus
A sheet bundle discharging apparatus, including: a guide unit configured to guide a sheet bundle with a spine as a leading end; a receiving unit configured to receive the spine of the sheet bundle guided by the guide unit; and a discharging unit configured to discharge the sheet bundle, wherein the receiving unit includes: a first surface configured to receive the spine at a first position; a second surface configured to push the sheet bundle in a rotation direction of the receiving unit; and a third surface configured to regulate a movement of the sheet bundle in the rotation direction while the receiving unit rotates from the first position to a second position, and wherein a friction coefficient between the sheet bundle and the third surface in a direction away from the first surface is larger than a friction coefficient between the first surface and the sheet bundle. |
US11052695B2 |
Book production line and method for producing individual books as well as very short and short runs of books
The invention relates to a book production line and a method for producing individual books as well as very short and short runs of books. The book production line comprises a feed device and a following transport section for book covers, a feed device and a following transport and processing section with a rounding and pressing machine, an adhesive-backing apparatus for book blocks, and a casing-in machine. The rounding and pressing machine forms an upstream-arranged, first adjustment segment. The adhesive-backing apparatus is divided into at least two additional adjustment segments that successively follow each other in a transport direction of the book blocks. Each adjustment segment includes a separate drive and a number of book block positions which is the same for each adjustment segment or differs maximally by three book block positions. |
US11052693B2 |
Mechanical handwriting apparatus and method of use thereof
The invention comprises a mechanical handwriting system linked to a user input system to generate a plotted document, such as a greeting card, note card or document, using a conveyor belt unit to support and move the document, a plotter, and a series of rollers to position and constrain movement of the greeting card, which is optionally and preferably linked to a paper feeder system in an assembly line format, where the rollers are optionally and preferably adjustable in position to accommodate varying paper sizes and to allow movement of the document during a plotting period to avoid positional overlap constraints of the rollers and a plotter head of the plotter in a process of plotting the document/card in sections. |
US11052690B2 |
Apparatus for printing on an object having a curved surface
A printing module configured to print a label on a curved surface of an article includes an expandable printing mechanism configured to be expanded to an open configuration for receiving the article or contracted to a closed configuration placing the curved surface in an operative position with respect to a print head and an article moving assembly configured to grasp and hold the article and effect relative movement between the curved surface and the print head. The printing mechanism includes contact elements, such as rollers, that contact or otherwise engage the article when the printing mechanism is in the closed configuration and maintain the curved surface in the operative position with respect to the print head during relative movement between the curved surface and the print head. |
US11052688B2 |
Recording apparatus
A recording apparatus includes: a recording section that performs a recording operation on a medium; a housing that contains the recording section; a storage section that stores the medium; and a reading unit disposed in an upper portion of the housing. The reading unit includes: a reading section that reads an original sheet; a guide member that guides the original sheet; and an aperture through which the original sheet that has been read by the reading section passes. By being rotated relative to the housing, the guide member is switched between a first position in which the aperture is exposed and the original sheet is to be guided and a second position in which the aperture is covered. |
US11052682B2 |
Identifying printing substrate types
Devices and methods for identifying categories or types of print media in image forming apparatuses are disclosed. In an example method print media are advanced in a feeding direction to reach a cutting position, a cutter is advanced in a cutting direction, perpendicular to the feeding direction to cut the print media, friction between the cutter and the print medium is measured, and the print media are identified based on the measured friction. |
US11052679B2 |
Apparatus for discharging liquid
An apparatus for discharging liquid includes a rotary member, a liquid applier, a conveyance belt, a first heater, and a second heater. The rotary member is configured to convey a sheet material. The liquid applier is configured to apply liquid to the sheet material conveyed by the rotary member. The conveyance belt is configured to convey the sheet material fed from the rotary member. The first heater is configured to heat the sheet material between the rotary member and the conveyance belt. The second heater is configured to heat the sheet material conveyed by the conveyance belt. |
US11052674B2 |
Exhaust device for inkjet coating, inkjet ejection device, inkjet coating method, and method for manufacturing member
To reduce an influence of a flow of ambient atmosphere and the like on flying of a droplet ejected from a nozzle of an inkjet head. To exhaust vapor of a solvent contained in a coated film while reducing an influence on flying of the droplet. An exhaust device for inkjet coating includes: a cover that covers at least a target range on an object to be coated, the target range being a range in which a droplet lands that is ejected from an ejection nozzle of an inkjet head to a surface of the object to be coated; a closing member that closes a gap between the cover and the object to be coated around the target range; an external communication portion through which a compartment surrounded by the cover, the object to be coated, and the closing member communicates with an outside; and an exhaust mechanism configured to exhaust air from the compartment. |
US11052673B2 |
Printing system
A printing system includes: a printing device including a thermal head, a supplier, a winder, and a ribbon transport mechanism; and a controller configured to: transport an ink ribbon in a first direction from the supplier to the winder and heat the ink ribbon to perform printing; rewind the ink ribbon subjected to the printing in a second direction opposite to the first direction; after again receiving a print command, rewind the ink ribbon in the second direction by a first length corresponding to a length required to reach a printable speed; after the rewindings, store a second length corresponding to a length of the ink ribbon subjected to the printing upstream of the thermal head in the first direction; and feed the ink ribbon in the first direction by the stored second length. |
US11052669B2 |
Integrated circuit device for a replaceable printer component
In one example, an article for a replaceable printer component includes an integrated circuit device having a device controller, a conductor to supply power to the device controller and to carry a signal to and from the device controller, and a sensor operatively connected to the device controller to sense a voltage and/or a frequency on the conductor. The device controller to send an indication of a sensed voltage and/or a sensed frequency to the printer controller. |
US11052660B2 |
Liquid absorber and liquid ejection apparatus
A liquid absorber includes a liquid absorption member and a case. The liquid absorption member absorbs liquid. The liquid absorption member includes materials that include a fiber and a liquid-absorbent resin. The liquid absorption member is stored in the case. The case has an opening portion. The materials of the liquid absorption member are bonded together in at least a portion of a surface of the liquid absorption member. The surface is a surface adjacent to the opening portion. |
US11052659B2 |
Liquid discharge apparatus
There is provided a liquid discharge apparatus including: a discharging member including a plurality of individual electrodes arranged side by side in a first direction, a plurality of individual channels arranged side by side in the first direction, a plurality of nozzles arranged side by side in the first direction, a common channel communicating with the plurality of individual channels, and an opening communicating with the common channel; and a heating member at least a part of which makes contact with the discharging member. An individual electrode, included in the plurality of individual electrodes and located at an end in the first direction, and the opening are apart from each other in the first direction. At least the part of the heating member is a part making contact with the discharging member, at a location between the opening and the individual electrode located at the end in the first direction. |
US11052658B2 |
Head module
A head module includes a pressure chamber, a piezoelectric member, a supply manifold, a return manifold, and a damper portion. The pressure chamber is configured to hold liquid therein and in fluid communication with a nozzle orifice. The piezoelectric member is configured to apply pressure to liquid held in the pressure chamber. The supply manifold is in fluid communication with the pressure chamber and configured to allow liquid to flow into the pressure chamber therefrom. The return manifold is in fluid communication with the pressure chamber and configured to allow liquid not ejected from the nozzle orifice to flow thereinto. The damper portion is positioned between the supply manifold and the return manifold when viewed in plan from a nozzle surface of the head module. The nozzle surface has the nozzle orifice defined therein. The damper portion includes a particular plate having a particular recessed portion. |
US11052656B2 |
Fluid actuator evaluation independent of actuation state
In one example in accordance with the present disclosure, a fluidic die is described. The fluidic die includes an array of fluid actuators grouped into primitives. The fluidic die also includes a fluid actuator controller to selectively activate fluid actuators via activation data. The fluidic die also includes an array of actuator evaluators, wherein each actuator evaluator of the fluidic die is coupled to a subset of the array of fluid actuators. The actuator evaluators selectively evaluate an actuator characteristic of a selected fluid actuator based on: an output of an actuator sensor paired with the selected fluid actuator, the activation data, and an evaluation control signal. |
US11052655B2 |
Fluidic die controller with edge sharpness mode
A die controller to control a fluidic die having a plurality of primitives each including a plurality of nozzles addressed by a same set of addresses. The die controller provides operational data including a series of actuation data groups to the fluidic die to actuate the nozzles to eject fluid to form an article, each actuation data group including a series of fire pulse groups, with each fire pulse group corresponding to a different address of the set of addresses and including a set of actuation data for each primitive and a set of start bits to initiate actuation of the nozzles based on the actuation data of the immediately preceding fire pulse group. The die controller to provide a blank fire pulse group immediately following a last fire pulse group of the series of fire pulse groups of each actuation data group when operating in an edge sharpness mode. |
US11052654B2 |
Droplet dispensing device
A droplet jetting apparatus includes: a nozzle that ejects a jet of liquid droplets; a detector that detects a hand or an object in a flight path of liquid droplets from the nozzle; a pump including a suction portion for suction of liquid, and a discharge portion which is connected to the nozzle and discharges the liquid which has been sucked into the suction portion; a driver which by rotation of a cam, sucks liquid into the pump and discharges the liquid in a compressed state; and controller which actuates the driver. When the detector detects the hand or object, the controller actuates the pump by rotation of the cam, and ejects a jet of liquid in droplet form from the nozzle. |
US11052647B2 |
Direct additive synthesis of diamond semiconductor
In an embodiment, a system includes a three-dimensional (3D) printer, a neutral feedstock, a p-doped feedstock, an n-doped feedstock, and a laser. The 3D printer includes a platen and an enclosure. The platen includes an inert metal. The enclosure includes an inert atmosphere. The neutral feedstock is configured to be deposited onto the platen. The neutral feedstock includes a halogenated solution and a nanoparticle having a negative electron affinity. The p-doped feedstock is configured to be deposited onto the platen. The p-doped feedstock includes a boronated compound introduced to the neutral feedstock. The n-doped feedstock is configured to be deposited onto the platen. The n-doped feedstock includes a phosphorous compound introduced to the neutral feedstock. The laser is configured to induce the nanoparticle to emit solvated electrons into the halogenated solution to form, by reduction, layers of a ceramic comprising a neutral layer, a p-doped layer, and an n-doped layer. |
US11052646B2 |
Lining material peeling method
In a lining material peeling method of peeling a lining material, which is fixedly formed on a surface of a base material, from the base material, a liquefied fluid which evaporates after injection is injected to a boundary between the base material and the lining material. |
US11052645B2 |
Thermoplastic resin film, its manufacturing method, and laminated body
Provided is a thermoplastic resin film having at least one of film surfaces being excellent in printability, having sufficiently low internal haze, and exhibiting a favorable matte appearance. A thermoplastic resin film according to the present invention composed of a thermoplastic resin composition (C) including at least one kind of a thermoplastic resin (R) and fine particles (P) having a volume average particle diameter of 0.5 to 15 μm and a refractive index different from that of the thermoplastic resin (R) by 0.02 or more.At least one of film surfaces satisfies formulas (1) and (2). GL≥60 (1), GL−35≤GH≤GL−10 (2) (In the formulas (1) and (2), GL is 60° gloss (%) at 20° C., GH is 60° gloss (%) when the thermoplastic resin film is heated at a temperature 10° C. higher than a glass transition temperature of the thermoplastic resin composition (C) for 30 minutes, then cooled to 20° C.). |
US11052642B2 |
Gas barrier film and method for producing gas barrier film
A gas barrier film has, in sequence, a support, an inorganic layer, and a resin film, the inorganic layer and the resin film being supported on the support. The resin film has a hydroxy group. The inorganic layer and the resin film are directly joined to each other with separate portions that are partially present at an interface between the inorganic layer and the resin film. The gas barrier film has one or more sets of a combination of the inorganic layer and the resin film. A method for producing the gas barrier film includes forming an inorganic layer by a gas-phase deposition method, subsequently laminating a resin film having a hydroxy group with the inorganic layer, and heating the resulting film laminate. |
US11052639B2 |
Thermoplastic film for a laminated glass pane
Thermoplastic film suitable as an intermediate layer for a laminated glass pane, wherein the thermoplastic film includes a defined region, which is provided for a camera window or an HUD (head-up display) region that has a non-zero wedge angle, and a region surrounding the defined region on all sides, in which the thermoplastic film has a substantially constant thickness, wherein the maximum thickness in the defined region of the thermoplastic film is less than the thickness in the surrounding region. |
US11052638B2 |
Metal-clad laminate and manufacturing method for same
A metal-clad laminate (1) includes a thermoplastic liquid crystal polymer film (2), a metal deposition layer (4) formed on one surface of the thermoplastic liquid crystal polymer film (2), and metal foil (6) laminated to the other surface of the thermoplastic liquid crystal polymer film (2). |
US11052636B2 |
Fused sheet for electromagnetic wave absorption-extinction and shielding, and for electronic equipment high heat dissipation, and method of manufacturing the same
The present invention discloses a fused sheet for electromagnetic wave absorption/extinction and shielding, and for electronic equipment high heat dissipation. The fused sheet for electromagnetic wave absorption/extinction and shielding, and for electronic equipment high heat dissipation of the present invention includes a premolded graphite sheet prepared by molding a graphite substrate into a sheet form having a density in a range of 0.1-1.5 g/cm3 and an incomplete state of crystal structure; and a porous metal sheet having a plurality of pores connected to upper and lower surfaces of the porous metal sheet, wherein the premolded graphite sheet is stacked on one surface of the porous metal sheet, and press molded to be integrally attached and combined, so as to have a density of 1.6 g/cm3-6.0 g/cm3. |
US11052634B2 |
Laminated substrate for electrochromic dimmer element and manufacturing method for electrochromic dimmer element
A laminated substrate for an electrochromic dimmer element includesa glass substrate; anda transparent conductive film.The glass substrate includes a silicon oxide, an aluminum oxide, a boron oxide, an alkaline earth metal oxide, and an alkali metal oxide in a total amount of 90 mol % or more, and includes the alkali metal oxide in a total amount of 12 mol % or less.The transparent conductive film includes an indium oxide film containing tin, and a tin oxide film containing at least one of tantalum, antimony and fluorine, in this order from a glass substrate side.The indium oxide film is formed directly on the glass substrate, a refractive index and an extinction coefficient of the indium oxide film at a wavelength of 1.3 μm is less than 0.4, and greater than 0.4, respectively.A film thickness of the tin oxide film is greater than 35 nm. |
US11052623B2 |
Tire cure mold and method for manufacturing tire
A tire cure mold has a tire molding face, a mounting groove provided to the tire molding face and a stencil plate mounted into the mounting groove. The stencil plate has a front face that faces a cavity, a back face that faces a bottom face of the mounting groove, and a through hole extending from the front face to the back face. A recessed portion for forming a protruding identification mark on the outer surface of the tire is provided to the front face. A first protruding portion corresponding to the recessed portion is provided to the back face. A second protruding portion that protrudes toward the bottom face of the mounting groove is provided to an outer edge portion of the stencil plate at least at a periphery of the through hole. |
US11052617B2 |
Fabrication of plank stringers
A method of fabricating a plank stringer for use in an aircraft includes grouping a plurality of stacked plies of reinforcing material into a plurality of charges, where each charge in the plurality of charges includes a substack of plies. The method also includes grouping the plurality of charges into two or more groups such that, for each charge in a given group, a respective substack of plies includes a sequence of orientation angles with respect to a longitudinal axis of the plank stringer corresponding to the given group. The method also includes laying up each group of charges as a continuous blanket of plies, where each continuous blanket of plies includes the respective substack of plies for each charge in the respective group. The method also includes cutting each continuous blanket of plies into the respective group of charges and stacking the plurality of charges to form the plank stringer. |
US11052614B2 |
Thermal fill bonding method
A Thermal Bonding Method and Apparatus to thermally bond sheets of fill in a cooling tower fill pack. The apparatus creates a hemispherical joint extending through two fill sheets to provide a substantial joint between said sheets. |
US11052613B2 |
Top-loading straddle-mounted pipe fusion machine
A fusion machine which can be top-loaded on very large polyolefin pipes and pipelines has jaws which consist of an upper half jaw and lower left and right complemental jaws which pivot on the half jaw. Left and right actuators connected between the complemental jaws and the half jaw operate in one direction to cause the complemental jaws to rotate to an opened condition in which the upper half jaw can be lowered onto and lifted from the pipes to be fused and in the other direction to cause the complemental jaws to rotate to a closed condition in which the pipes to be fused are gripped so substantially around their circumferences as to resist their deformation from round during manipulation by the machine. The top-loading machine minimizes the need for heavy equipment to load and unload pipe to and from the fusion machine. |
US11052611B2 |
Fabricating apparatus, fabricating method, and recording medium that permits fabrication based on permissibility information
A fabricating apparatus includes processing circuitry. The processing circuitry is configured to receive designation of a scheduled fabrication start time of a fabrication object, detect a change in a fabrication practicability condition of the fabricating apparatus, and output change information indicating an occurrence of a change in the fabrication practicability condition of the fabricating apparatus when the change in the fabrication practicability condition has been detected after reception of the designation of the scheduled fabrication start time. |
US11052610B2 |
Powder delivery device and powder delivery method for providing raw material powder to a powder application device of a powder bed fusion apparatus
A powder delivery device for providing raw material powder to a powder application device of a powder bed fusion apparatus is provided. The powder delivery device comprises a powder supply section configured to receive raw material powder, the powder supply section comprising an outlet for providing the raw material powder to the powder application device. The powder delivery device further comprises a first physical parameter determining unit arranged at a first location of the powder supply section and configured to determine a first physical parameter in the powder supply section, and a controller configured to determine whether the first physical parameter meets a first tolerance criterion, and a powder treatment unit. The controller is configured to instruct the powder treatment unit to perform a powder treatment in case it determines that the first physical parameter does not meet the first tolerance criterion. |
US11052599B2 |
Stereolithography with thermoplastic photopolymers
Stereolithography using solid thermoplastic photopolymer plates/sheets/films provides a new technique to make 3D printed objects. In this new additive manufacturing process, objects are built layer-wise using thermoplastic photopolymers and actinic radiation. The thermoplastic photopolymer compositions consist of a thermoplastic photopolymer layer sandwiched between a transparent flexible base without an anchoring layer and a release film. Un-crosslinked portions of the 3D printed object are removed by heat. Preferred method of radiation exposure is digital light processing (DLP) |
US11052597B2 |
Additive manufacturing of viscoelastic materials
Described is a method of forming a structure having viscoelastic properties. The method can include a) depositing a layer of droplets of a solidifying material and a non-solidifying material, the droplets being deposited according to an occupancy matrix specifying voxels for the solidifying and non-solidifying materials, the solidifying and non-solidifying material being interspersed within the occupancy matrix, the occupancy matrix being generated by a probabilistic function; b) exposing the droplets of solidifying material to ultraviolet radiation to cure the solidifying material; and c) repeating a) and b) to deposit additional layers of droplets of solidifying and non-solidifying materials, thereby forming the structure having viscoelastic properties. |
US11052594B2 |
Molded foam
The present invention relates to molded foam having no hollow space caused in a plate-shaped portion. The molded foam comprises a tube body and a plate-shaped portion joined to the outer side of the tube body. The expansion ratio of the molded foam is lower than two, and a value of a thickness B/a thickness A as a relationship between the thickness A of the tube body at the periphery of a point joined to the plate-shaped portion and the thickness B of the plate-shaped portion is less than 2.82. |
US11052593B2 |
Die head and die tooling spider with spider legs having curved flow guides
The present invention provides a spider for a die head and die tooling that utilizes curved flow guides to direct the flow of plastic through the die head and die tooling. The spider leg splits the stream of plastic flowing through the spider into two independent streams at the upstream end. The downstream end comprises two curved flow guides that are configured to direct the two streams of plastic towards a longitudinal center plane of the spider leg. The turbulence caused by the curved flow guides creates obtuse or acute angled welding lines between the two streams of plastic. These obtuse and acute angled welding lines provide stronger bonds than the known spider legs that create butt welding or right angled welding lines. |
US11052588B2 |
Electrically-driven rotor iron core magnetic steel chamber dispensing device
An electrically-driven rotor iron core magnetic steel chamber dispensing device is introduced. Dispensing units each include a dispensing channel, dispensing head, plunger barrel, plunger and stop-injection opening pin. The dispensing channel is above the dispensing head and in communication with the dispensing head. The dispensing head is disposed at the top of the plunger barrel and in communication with the plunger barrel. The plunger is displaced in the plunger barrel to move up and down relative to the plunger barrel. The stop-injection opening pin includes a pin body disposed vertically, arranged beside the plunger barrel, and fixed to a lower mold from inside. A pin head portion is disposed at the top of the pin body. A barb is disposed between the pin head portion and the pin body. The pin head portion protrudes into the dispensing channel, allowing molten plastic in the dispensing channel to enter the barb. |
US11052582B1 |
Collapsible core devices and method for injection molding
Collapsible core devices, related methods and injection molding tools for use in injection molding processes, the core device configured to collapse upon rotation of a centrally disposed rotating shaft. In some aspects the core device includes a rotatable shaft, moveable outer wall components positioned radially from the shaft, a first disk operatively engaged with the shaft and having at least a first slot configured to receive a first pin connected to a moveable outer wall component, and a second disk secured in a fixed position and having at least a second slot configured to receive the first pin, such that rotation of the rotatable shaft causes the pin to slide within the second slot toward the shaft and causing the outer wall component to move toward the shaft. |
US11052581B2 |
Molding method and molding system for resin molded member
A molding method and a molding system for improving a molding speed of a resin molded member. In the method, firstly a thermoplastic resin composite material is filled in a metal mold (i.e., at time T0), and subsequently a mold-clamping process gets started. As the mold-clamping process progresses, a first decompression circuit starts to decompress an inside of a cavity when the cavity is closed by a sealing member provided on the metal mold. Then, as the mold-clamping process further progresses, the thermoplastic resin composite material thus filled in the metal mold contacts an upper mold of the metal mold (i.e., at time T2). After that, a second decompression circuit starts to decompress the inside of the cavity, thereby to complete the mold-clamping process (i.e., at time T3). |
US11052576B2 |
Hydraulic advancement/postponement assembly
A hydraulic advancement/postponement assembly is operably coupled to a first ejector plate and to a second ejector plate. The hydraulic advancement/postponement assembly includes a first hydraulic cylinder having a first housing defining a first volume and a first piston, the first housing connected to the first ejector plate and the first piston connected to a fixed element. The hydraulic advancement/postponement assembly includes a second hydraulic cylinder disposed in fluid communication with the first hydraulic cylinder, the second hydraulic cylinder having a second housing defining a second volume and a second piston, the second housing connected to the first ejector plate and a second piston connected to the second ejector plate. |
US11052575B2 |
Tri-layer bladder and related systems and methods for fabricating composite structures
Disclosed is an elastomeric bladder tool and related systems and methods. In one embodiment, the elastomeric bladder tool comprises an elastomeric inner layer substantially defining an inner cavity of the elastomeric bladder tool, an elastomeric outer layer substantially defining an outer surface of the elastomeric bladder tool, and a permeable middle layer positioned between the elastomeric inner layer and the elastomeric outer layer. The permeable middle layer has greater permeability than both the elastomeric outer layer and the elastomeric inner layer to allow for evacuating of gases that have entered the permeable middle layer. |
US11052573B2 |
Method of fabricating both a woven fiber preform and a composite material part
A method of fabricating a woven fiber preform that is impregnated with a matrix-precursor resin, the resin, in the raw state, presenting a glass transition temperature Tg0, includes: impregnating yarns or strands with the resin; feeding a loom with the impregnated yarns or strands maintained at a temperature in the range Tg0 to Tg0+10° C.; and weaving the yarns or strands in the loom in order to obtain the resin-impregnated woven fiber preform. |
US11052570B2 |
Process for producing foams based on thermoplastic polyurethanes
A process for producing foamed thermoplastic polyurethane particles comprises the steps of a) melting a thermoplastic polyurethane in a first extruder (E1), b) injecting a gaseous blowing agent in a second extruder (E2), c) impregnating the gaseous blowing agent homogeneously into the thermoplastic polyurethane melt in a third extruder (E3), d) extruding the impregnated thermoplastic polyurethane melt through a die plate and granulating the melt in an underwater granulation device under temperature and pressure conditions to form foamed thermoplastic polyurethane particles. |
US11052567B2 |
Method for liquid treatment of a wood species
The present invention relates to an improved method for impregnating a porous material, such as wood, more specifically a method in which an active ingredient to be deposited within the porous material is dissolved in condensed carbon dioxide and impregnated in the material. |
US11052566B2 |
Pole and method of manufacturing the pole
A pole for supporting a cable. The pole includes a plurality of truncated cones arranged in a linear array to form the pole, wherein each truncated cone receives an adjacent truncated cone within its interior. Each truncated cone in the pole is formed from a veneer by moving the longitudinal edges of the veneer towards each other. A method of manufacturing the pole and various uses of the pole are also provided. |
US11052558B2 |
Adapter for a handle and a cartridge of different razor systems
An adapter for coupling each of a razor handle and a razor cartridge together is provided. The adapter includes a cartridge engaging portion and a handle engaging portion. The handle engaging portion comprises at least one wall that defines a receptacle for receiving a razor handle and at least one handle protrusion extending from the at least one wall and configured to engage a central recess of a razor handle. The cartridge engaging portion is coupled with the handle engaging portion. The cartridge engaging portion comprises a stem that defines a first recess and a second recess for selectively engaging a first cartridge protrusion and a second cartridge protrusion and a tongue member slidably coupled with the stem and configured to contact a cartridge. |
US11052555B2 |
System and method for sensing debris accumulation in shaving razor cartridge
A system for determining a level of debris accumulation in a region adjacent to at least one blade of a razor cartridge. The system includes a sensing unit to detect a measurement parameter which is one of an amount of light reflected from at least one area adjacent to the at least one blade, and an image of the at least one area adjacent to the at least one blade. A processing unit compares the detected measurement parameter to at least one reference threshold parameter and determines a level of debris accumulation in the at least one area adjacent to the at least one blade based on an amount of deviation of the detected measurement parameter from the at least one reference threshold parameter. Information regarding the determined level of debris accumulation is provided by at least one of a light indication, an aural indication, and a haptic indication. |
US11052552B2 |
Safety utility blades, assemblies and methods of manufacturing
A safety blade for use with a knife assembly comprises a blade body, a bade attachment having a cutting edge and a top edge opposite the cutting edge, a blade attachment having a first half and a second half connected together via a hinge and extending beyond the top edge of the blade body to define a clamshell for receiving the blade body, and a handle adaptor having a handle engagement portion for removably securing the blade attachment to a handle. |
US11052544B2 |
Safety device for machine tools
A safety device for machine tools, such as a panel-sizing circular saw or an edge-gluing machine, with a machining tool used for machining a workpiece supplied to the machine tool, comprises a detection device and a hazard reduction device. The detection device is designed to detect a hazardous situation of an operator of the machine tool and the hazard reduction device is designed to initiate a safety measure to reduce the risk of injury to the operator when a hazard signal characterizing a hazardous situation of the operator is received. |
US11052543B2 |
Control device, robot system, and robot
A control device includes a control section configured to control a motion of a robot arm using values detected by a plurality of distance sensors. The plurality of distance sensors include a first distance sensor and a second distance sensor disposed in a first direction orthogonal to the axial direction of a dispenser. The second distance sensor is disposed in a position further apart from the dispenser than the first distance sensor. The control section executes, on a robot, a first instruction for causing the robot to execute discharge of a discharge object by the dispenser when a distance acquired by the first distance sensor is a distance in a predetermined range and a distance acquired by the second distance sensor is a distance larger than the distance in the predetermined range. |
US11052542B2 |
Robot system and control method of robot
A robot system and a control method of a robot are provided. A robot, a liquid application part, an application thickness measurement part and a control part are provided, the liquid application part being provided on the robot, the application thickness measurement part measuring an application thickness of a liquid applied by the liquid application part, the control part, in a case where the application thickness measured by the application thickness measurement part is greater than a predetermined thickness, driving the robot in a manner of moving the liquid application part closer to an application object, and in a case where the application thickness measured by the application thickness measurement part is less than the predetermined thickness, driving the robot in a manner of moving the liquid application part away from the application object. |
US11052541B1 |
Autonomous robot telerobotic interface
An indication of a task to be performed in a network data center is received. A robotic manipulator of an autonomous robot is controlled to autonomously perform at least a portion of the task. It is determined that an assistance is required in performing an identified limited portion of the task. A notification of a request for the assistance is provided. A remote assistance from an operator in performing the identified limited portion of the task is received. Autonomous performance of the task is resumed after completion of the remote assistance for the identified limited portion of the task. |
US11052535B2 |
Floor-to-height object retrieval robot
Provided is a robot for retrieving objects with different sizes, shapes, weights, placements, configurations, and/or other characteristics from a floor or raised height. The robot may include a motorized base, a lift that raises to a plurality of heights from the base, an upper platform attached over the lift, a vertical extension extending downwards from a frontside of the upper platform and in front of the lift, a lower platform with a proximal end coupled to the vertical extension and a distal end extending in front of the robot and directly over a ground surface on which the motorized base moves when the lift is in a lowered position, and a retriever for retrieving an object onto the lower platform. |
US11052530B2 |
Electric work machine
Provided is an electric work machine that can suppress a temperature increase of a component controlling an electric motor. The electric work machine including a brushless motor that operates a tip tool includes a rectification circuit that converts a voltage to be applied to the brushless motor from an alternating current voltage to a direct current voltage, and a switching circuit that controls the brushless motor, and the rectification circuit is arranged upstream of the switching circuit in a circulation path of the air that cools the rectification circuit and the switching circuit. |
US11052526B2 |
Hand-held power tool device
A hand-held power tool device, in particular a hammer drill and/or chisel hammer device, includes at least one operating element and at least one locking unit. The at least one locking unit includes at least one locking element and at least one controllable actuator element. The at least one locking element can be moved from at least one storage position into at least one locking position, and vice versa, and locks the operating element in at least one operating state in the locking position. The at least one controllable actuator element influences motion of the locking element. |
US11052520B2 |
Seal installation tool
A method of installing a seal in a bore of a component includes securing a base plate to a component. The method includes arranging the seal onto a pusher. The method also includes inserting the pusher into a hole in the base plate. The method further includes installing a hub onto the base plate and over the pusher. The method further includes rotating a rod relative to the hub to advance the pusher and seat the seal in the bore. |
US11052519B2 |
System and method for installing a manifold plug
The present disclosure relates to an insert and system of installing the same. The insert includes a tapered core and a cylinder. The core releasably secures to an installation device which includes a depth stop or a depth control to control the installation depth of the insert. The insert may be provided in a tray that allows for easier handling of the inserts and installation thereof in installation holes, for example in a hydraulic manifold. In some cases, the core includes a threaded hole to releasably secure the insert to the installation device, thus allowing the installation device to pull the core into the cylinder. The core and cylinder may be made of metallic materials such as steels, steel alloys and others. In some cases the insert can withstand blow out pressures of 40,000 psi or higher. |
US11052515B2 |
90 degree socket adapter
The 90 Degrees utilizes dual ratio constant mesh gears which provides suitable use for ratchets in hard to access spaces, and particularly well suited for automotive use. The mesh gears are configured to be used either with manual or pneumatic tools. A female socket element recedes into the housing having gears therein and a male socket element meshes with the female socket element and is shaped to accommodate a female socket element at 90 degrees or the adapter element of a drive ratchet. You can use an elongated drive shaft to accommodate distance. Positioned within the housing of the adapter body are gears secured to mesh within the housing of the adapter. Rotation of the female socket element by a drive ratchet in one direction will rotate the male socket element in the opposite direction without any change in direction is governed by the ratchet use. |
US11052511B2 |
Outer blade cutting wheel and making method
An outer blade cutting wheel is provided comprising an annular thin disc base and a blade section of bonded abrasive grains on the periphery of the base. Provided that an imaginary range is delineated by two imaginary planes extending parallel to the planar surfaces of the base and tangent to widthwise side portions of the blade section and two imaginary circumferences defined about the rotational axis and extending tangent to inner and outer perimeters of the blade section, the blade section occupies 10-40% by volume of the imaginary range minus the region of the base, and the widthwise side portions of the blade section have a dented shape relative to the imaginary planes. The cutting wheel is capable of cutoff machining at a high feed speed while maintaining a high accuracy and a low cutting load. |
US11052510B2 |
Imprint device for imprinting a surface of an object to create an identification mark
The present invention is an imprint device for imprinting a unique identification mark on a surface of an object with imprinting particles of different sizes that increase uniqueness and without the need for electric power. The imprint device includes a vertical member, a hammer member, a trigger assembly, a charging unit, a barrel and at least one pocket. In the operative configuration, a trigger of trigger assembly is activated such that hammer member impacts a cartridge filled with at least one munition of imprinting particles and releases imprinting particles. The imprinting particles travel through the barrel where acceleration is increased and impact on surface is made to form microcraters and unique identification marks. The imprinting particles can be of same size, material and shape or they can be of different sizes, material and shapes or the combination thereof for increasing uniqueness. |
US11052504B1 |
Temperature regulation system and temperature regulation method for machine tool
A temperature regulation system and a temperature regulation method are applicable to a machine tool. The temperature regulation system includes a cooling fluid storage tank, a heating fluid storage tank, an internal circulation subsystem, an external circulation subsystem and a computing unit. The internal circulation subsystem includes a first valve. The external circulation subsystem includes a plurality of flow channels and a second valve and a third valve disposed on the plurality of the flow channels. The computing unit controls the first valve, the second valve and the third valve to switch flow directions of the plurality of the flow channels among the cooling fluid storage tank, the heating fluid storage tank and machine tool. Therefore, a thermal balance of the machine tool can be effectively maintained. |
US11052503B2 |
Spindle device
A spindle device includes a spindle housing, a spindle shaft rotatably supported inside the spindle housing, a spindle mount having an insertion cavity into which the spindle housing is inserted along the axial direction of the spindle shaft, and a mount cover covering the spindle mount. A temperature regulator for adjusting the temperature inside the mount cover is provided inside the mount cover. |
US11052502B2 |
Power-tool cooling apparatus
A power-tool cooling apparatus for a portable power tool includes a first fan configured to generate a first cooling fluid flow to cool a drive unit of the portable power tool, and a second fan that generates a further cooling fluid flow to cool an electronics unit of the portable power-tool. A third fan generates a third cooling fluid flow to cool a second electronics unit of the power-tool, and supplies cooling fluid to the first cooling fluid flow. |
US11052500B2 |
Platform for robots
A feeding system for feeding workpieces to a device by means of a robot comprises a feeding station and at least one transport carriage, wherein the feeding station comprises a robot fastening section and is designed that a workpiece holder can be held in the feeding station in a holding position defined in relation to the robot fastening section from which a robot attached to the robot fastening section can grasp the workpieces. The transport carriage also has at least one holding device for holding a workpiece holder in a first holding position. The feed system comprises a coupling section wherein the transport carriage can be coupled to the feeding station using a coupling device in such a way that a workpiece holder held in the transport carriage in the first holding position is brought into the receiving position after the transport carriage has been coupled with the coupling section. A method for feeding workpieces to a device and the use of a feed system is provided. |
US11052492B2 |
Use of an alloy as a brazing alloy for an electric switch braze joint, an electric switch braze joint, an electric switch and a method of producing an electric switch braze joint
Embodiments of the present disclosure relate to an alloy as a brazing alloy for an electric switch braze joint, an electric switch braze joint, an electric switch and a method of producing an electric switch braze joint. The alloy composition of said the alloy consists of at least one element selected from each of group I and group II listed below, and a balance of impurities, Ag, and at least one of Cu, and Zn. Group I encompasses Cd, Mn, Ni, P, Sb, Si, Sn, Ti, and oxides thereof in a total amount of 0.5 to 45.0 wt. %. Group II encompasses Bi, Mo, Te, W, and oxides thereof, oxides of Cu and Zn in a total amount of 0.1 to 15.0 wt. %. |
US11052490B2 |
Inner barrel of an engine inlet with laser-machined acoustic perforations
A forming system includes a femtosecond laser and a control unit that includes one or more processors operatively connected to the femtosecond laser. The femtosecond laser is configured to emit laser pulses onto an inner surface of a face sheet of an acoustic inner barrel. The acoustic inner barrel includes an acoustic core comprising an array of hexagonal cells attached to an outer surface of the face sheet that is opposite the inner surface. The control unit is configured to control the femtosecond laser to laser drill a plurality of perforations in the face sheet via emitting laser pulses at pulse durations between about 100 femtoseconds and about 10,000 femtoseconds and at frequencies over 100,000 Hz such that the perforations are formed without burning portions of the face sheet or the acoustic core surrounding the perforations. |
US11052478B2 |
Method for tapping an engine component to orient a spark plug
A device and method of tapping an engine component to orient a spark plug includes measuring a tap pitch, measuring a first distance between a tap end surface and a full tap tooth center at a first rotational location, calculating a phantom first tap tooth based on the pitch and first distance, determining a tap rotational offset from the first location to a location where the end surface intersects the phantom first tooth, calculating a tap rotational starting orientation that is the first location minus the tap rotational offset minus a spark plug offset, rotating a tool head to the rotational starting orientation, positioning the tap so the end surface is a pitch incremental distance away from the engine component, synchronizing a rotating speed of the tool head and a feed rate to the tap thread pitch, and operating the tool to cut or form threads in the engine component. |
US11052472B2 |
Cutting insert and indexable edge rotary cutting tool
A cutting insert includes a rake face configuring one of polygonal surfaces, a seating surface configuring the other one of the polygonal surfaces, and a side surface connecting the rake face and the seating surface to each other. The cutting insert has a cutting edge portion including a main cutting edge located in a side portion of the rake face, a subsidiary cutting edge connected to the main cutting edge, and a corner cutting edge connected to the subsidiary cutting edge and located in a corner portion of the rake face. The side surface includes a flank face and a connection surface which are adjacent to each other in a thickness direction via a boundary line. The connection surface is located on the seating surface side, and is located outside than an extension line of the flank face. |
US11052466B2 |
Cutting tool and manufacturing method thereof
A cutting tool according to an aspect of the present disclosure includes a cutting edge portion which contains at least one of cubic boron nitride and polycrystalline diamond. The cutting edge portion includes a rake face, a flank face, and a cutting edge. The flank face is contiguous to the rake face. The cutting edge is provided as a ridge line between the rake face and the flank face. The radius of curvature of the cutting edge is 2 μm or more and 8 μm or less. |
US11052457B2 |
Casting nozzle
A casting nozzle for feeding molten metal into a moving casting mold of a caterpillar casting machine, including an elongated housing body having a slot-like outlet side (A), wherein multiple flow passages are formed in the housing body along its longitudinal direction (x) and over its width direction (B), through which passages molten metal can be channeled in the direction of the outlet side (A) and can be fed from there into the moving casting mold, wherein the housing body is of an at least two-part design in the direction of its height and has at least one upper shell and at least one lower shell, wherein the upper shell and the lower shell are spaced apart from one another by separating webs and the individual flow passages extend between the separating webs. |
US11052456B1 |
Casting mold and manufacturing method of cast part
The casting mold is provided with: the molding wall portion forming the internal space; and the filling ports that open to the molding wall portion and that allow the molten metal to flow into the internal space. In this configuration the channel center lines of the filling ports intersect the surface of the heater at the non-perpendicular contact angle. |
US11052452B2 |
Riveting method for aircraft
A riveting method that includes riveting a first aircraft part to a second aircraft part. The method includes capturing a plenoptic image of the rivet and at least one of the first part and the second part in the vicinity of the rivet, by a plenoptic imaging device secured to a riveting head, after riveting the first part to the second part. The method includes detecting the positioning and the surface condition of the rivet, from the plenoptic image captured by the imaging device. |
US11052451B2 |
Gear manufacturing method and gear manufactured thereby
A gear manufacturing method includes a step of preparing a gear blank; a step (teeth cutting step) of cutting the gear blank to form a half-finished gear having a plurality of gear teeth; a step (heat treatment step) of heat-treating the half-finished gear having the gear teeth; and a step (form rolling step) of rolling the half-finished gear which is subjected to the heat treatment, in which the gear teeth of the half-finished gear which is subjected to the teeth cutting step is formed with protuberances on both sides in a circumferential direction, and at the form rolling step, the protuberances are pressed by a rolling die, so that the half-finished gear becomes a gear. |
US11052449B2 |
Method for manufacturing grid-stiffened structure and grid-stiffened structure
A method for manufacturing a grid-stiffened structure includes: regularly arranging triangular or quadrangular cells on one surface of a sheet member and setting a lattice-like pattern which is provided with rib configuring regions, each of the rib configuring regions being provided between the cells; providing through-holes in positions in the sheet member, where the rib configuring regions intersect, so as to separate the rib configuring regions; forming ribs which protrude from the one surface of the sheet member by folding the rib configuring regions of the sheet member; and mutually connecting ends of the rib in a position of each of the through-holes. |
US11052441B2 |
Meandering control device for rolling line
There is provided a meandering control device for a rolling line capable of setting temperature of a material to be rolled so as to suppress meandering of the material to be rolled. The meandering control includes a tail end roll force calculation unit that calculates a predictive value of roll force when entry side tension is not applied, an allowable meandering amount roll force calculation unit that calculates a reference value of the roll force applied to the material to be rolled when a meandering amount of the material to be rolled is an allowable amount, and a temperature rise amount calculation unit that calculates a temperature rise amount of the material to be rolled, based on a difference between the predictive value of the roll force and the reference value of the roll force. |
US11052437B2 |
Reaction force nozzle
A nozzle for water jet equipment and a method of use thereof. The nozzle has a body including a base with a shaft extending outwardly therefrom. The shaft is inserted through a bore of a sleeve that rotatable about the shaft. The base and shaft define a bore therein. At least one opening is defined in the shaft and one or more grooves are milled into the shaft's exterior surface. Each opening places the body's bore in fluid communication with one of the grooves and the sleeve's bore. Water flowing through the body's bore will flow through each opening, into the associated groove and into a space between the shaft and sleeve. The grooves create turbulence in water in this space and thereby reduce leakage from the nozzle. The shaft terminates in a conical section usable as a battering ram to break up blockages in pipes during cleaning operations. |
US11052436B2 |
Laser cleaning apparatus and laser cleaning method
A laser cleaning apparatus and a laser cleaning method are furnished, for switching the wavelengths of laser beams furnished by a single laser module using a wavelength switching module and cleaning a test piece using the laser beams having wavelengths and energy suitable for manufacturing needs. The laser cleaning method includes: creating a laser beam; switching the wavelength output by the laser based on process requirements; propagating the laser beam via an optical path propagating module for laser cleaning the test piece; and removing debris. A transfer platform allows movements of the laser beams with respect to the test piece to achieve cleaning of the entire test piece. A control module controls the wavelength switching unit, the laser beam regulating module, and the transfer platform. Total laser cleaning with improved laser cleaning quality is achieved by using these laser beams with the appropriate wavelengths and energy. |
US11052435B2 |
Narrowband de-icing and ice release system and method
A way of using narrowband irradiation to de-ice or release ice from a surface is provided. The methodology can be applied to a range of different types of de-icing from windshield de-icing to aircraft wing de-icing to releasing ice from the ice tray of an ice making machine. While there are many different specific applications, the concept and methodologies taught remain similar across all of them. |
US11052431B2 |
Compositions and methods for GRAS compliant cleaners for ethanol production equipment
The present technology relates to various cleaning compositions and their methods of use in industrial facilities such as ethanol and biofuel producing vessels. Cleaning compositions according to the present technology may be Generally Recognized As Safe (GRAS) as designated by the U.S. Food and Drug Administration (FDA). The cleaning compositions of the present technology may effectively remove biofilm buildup and/or spent grain residue from industrial fermentation vessels and associated apparatus. Various embodiments of the cleaning composition may comprise various surfactants, chelators, acids, bases, and/or defoamers. Some embodiments of the cleaning composition may comprise a gluconate, a glucoside, a strong acid or base, and/or a defoamer. |
US11052424B1 |
Paint trencher
A paint trencher includes a main body, an abrasive body, and a handle. The main body includes a top panel, a bottom panel, and a support. The abrasive body, preferably a beveled-elongated body, is adjacently mounted to the support in order to cut into the wall. The handle is mounted to the top panel so that applied pressure of the main body can be transferred into the abrasive body thus cutting a trench into the wall. A felt pad is perimetrically attached around the bottom panel so that the surrounding wall area of the trench can be protected from unnecessary scratches. |
US11052422B2 |
Electronic component manufacturing method and apparatus
An electronic component manufacturing method includes a blotting process of bringing a conductive paste applied to an end portion of each electronic component body held by a jig into contact with a surface of a surface plate. The blotting process includes simultaneous performance of a distance changing process of changing the distance between an end face of each electronic component body and the surface of the surface plate and a position changing process of changing a two-dimensional position where the end face of the electronic component body is projected on the surface of the surface plate in such a manner that the direction of the movement of two-dimensional position in parallel to the surface of the surface plate successively varies (e.g., along a circular path). |
US11052420B2 |
Layer-by-layer coating apparatus and method
Apparatus and method are described and useful for, among other things, providing a layer by layer coating of materials on a belt. A directional gas curtain producing element is used to provide a gas curtain blowing on the belt in an upstream direction that simultaneously meters liquid from the belt and dries the belt. |
US11052418B2 |
Pressure-fed accessories adapter for an airless spray gun
A spray gun adapter establishes fluid communication between a fluid pump of a handheld airless spray gun and an applicator accessory. The adapter comprises an adapter body, a head attached to the adapter body, and a protrusion. The adapter body comprises an upper portion, a lower portion, a radial inlet located in a sidewall of the adapter body between the upper and lower portions, and an adapter bore having a first diameter in fluid communication with the radial inlet. The head attached to the adapter body is attached at the upper portion of the adapter body. The head comprises a cavity in fluid communication with the adapter bore and having a second diameter larger than the first diameter, an adapter outlet located in the upper portion of the adapter body and in fluid communication with the cavity, and a handle extending radially from the head. The protrusion extends radially from the adapter body between the upper portion and the lower portion of the adapter body. |
US11052417B2 |
Cleaning station for needle nozzles
A cleaning apparatus for cleaning a nozzle of a liquid dispensing device is disclosed. The cleaning apparatus includes a base member supporting a receiving head including a receiving opening for receiving a portion of the nozzle to be cleaned, a gas inlet for receiving pressurized gas, and an outlet at the receiving head for applying pressurized gas to the nozzle for flushing the nozzle. The receiving opening can include a sealing edge for sealing the receiving head against the nozzle when the nozzle is received in the receiving opening. The cleaning apparatus can also include at least one of a discharge tube, a collection vessel and a filter element. |
US11052415B2 |
Measured dosing and spray bottle for multi-use applications and associated method of using
Embodiments include a bottle and method for cleaning a grill. An exemplary method may be applied to grills having an upper grill and a lower grill. Methods can include providing a bottle having a dosing chamber with a first outlet, a reservoir chamber configured to store a solution and including a second outlet, and a sprayer for dispensing solution via the second outlet. The sprayer includes a spray head and a trigger that, when actuated, draws solution from the reservoir chamber and dispenses it by spraying the solution from the spray head. Methods can include filing the dosing chamber with a predetermined dose of solution from the reservoir chamber and dispensing the solution onto the lower grill from the first outlet, and dispensing the solution onto the upper grill by spraying the solution onto the upper grill from the second outlet. |
US11052414B2 |
Valve for an end piece including a shut-off device
Some embodiments are directed to a valve, including a rigid end piece that defines a center; a rod at the center of the end piece defining an axis; and a flap, wherein the flap is in one piece and has a flexible wall situated opposite a free end of the rod, the flexible wall is perforated by an orifice concentric with the end of the rod, the orifice has a contour substantially homothetic with that of the contour of the end of the rod in a plane perpendicular to the axis of the rod, the orifice has a surface below a projected surface of the end of the rod in the plane, the flap is connected to the end piece by a non-deformable fixed connection, and the flexible wall presses against the end of the rod at any point of its surface in contact with the end. |
US11052413B2 |
Remote trigger head for dispensing a liquid and dispensing device
A remote trigger head for dispensing a liquid includes a rewindable tube (2) having a predefined length and a winder unit (70) for the automatic spring rewinding of the tube (2). |
US11052412B2 |
Handheld texture spray gun with hopper
A sprayer includes a spray gun and a hopper. An air source provides compressed air to the sprayer to both eject fluid from the spray gun as a spray and to pressurize the hopper. The spray gun includes an airflow controller for controlling the flow of the compressed air to a nozzle of the spray gun, a pressure regulator for regulating a pressure of the compressed air flowing to the hopper, and a relief valve between the pressure regulator and the hopper. The hopper receives the compressed air through a port in the hopper, and the compressed air assists the flow of material out of the hopper and into the spray gun. |
US11052407B1 |
Dielectrophoretic in-droplet material concentrator
A dielectrophoresis-based in-droplet cell concentrator is disclosed herein. The concentrator can include a concentration microchannel having an input port and two or more outlet ports. The input port introduces cell-encapsulated droplets or particle-encapsulated droplets into the microchannel; a first outlet port receives droplets including most of the cells or particles and a second output port receives droplets including few cells or particles. The concentrator also can include a pair of electrodes. When voltage is applied, the electrodes will create an electric field across the microchannel. The concentrator adds new capabilities to droplet microfluidics operations, such as adjusting concentrations of cells in droplets, separating cells of different properties from inside droplets, and solution exchange. |
US11052404B1 |
Apparatus for remediation of a copper and nickel co-contaminated soil and a method for using the same
An apparatus for remediation of a copper and nickel co-contaminated soil includes a housing. A crushing device is arranged at the upper part of the inside of the housing. A stirring device is arranged below the crushing device. An anode electrode and a cathode electrode are provided at both ends of the inner bottom of the housing, respectively. In the present invention, the soil contaminated by copper and nickel is first poured from the top of the crushing device, and then crushed thoroughly under the action of the crushing device. The crushed soil facilitates the movement of copper and nickel metal ions therein toward the electrodes under the action of the anode electrode and the cathode electrode, thereby achieving optimal soil remediation. |
US11052403B2 |
Protection device for tool-holders for tools for shredding, cutting and collecting material
A protection device for tools for cutters and shredders and the like, arranged on a tool-holder seat for a tool-holder rotor rotatable about the axis of the rotor, said tool being housed in a seat arranged on the tool-bolder rotor, and formed by a first surface arranged at the front in the cutting direction and a second surface onto which the tool is fixed with its opposite surface to the cutting direction, the tool having a body that has a front surface in the rotation direction of the rotor, and a rear surface opposing the front surface. The tool and/or the seat having lateral projections and a protection device is dismountable connected to the seat of the tool, laterally as a protection for the tool and the plates being arranged partially between the lateral projections, of the tool and/or the seat of the tool, and the tool-holder rotor. |
US11052397B2 |
Device and a method for collecting and transferring samples of biological material
A device for collecting, transferring and/or conserving samples of biological material, comprising at least: a support body having at least a housing seating for a conserving element for samples, the housing seating being configured for enabling removably housing the conserving element for samples of biological material, the support body being configured for maintaining at least a conserving portion of the conserving element accessible for depositing a sample when the conserving element is housed in the housing seating; an operating portion, movable between a first closed position in which it is arranged in proximity of said housing seating and at least an open position in which it is arranged in a distanced position from the housing seating; and engaging portion configured for selectively and removably engaging a sampling element for samples, in particular an element for buccal sampling, to the support body and/or to the operating portion. |
US11052396B2 |
System and method for isolating and analyzing cells
A system and method for isolating and analyzing single cells, comprising: a substrate having a broad surface; a set of wells defined at the broad surface of the substrate, and a set of channels, defined by the wall, that fluidly couple each well to at least one adjacent well in the set of wells; and fluid delivery module defining an inlet and comprising a plate, removably coupled to the substrate, the plate defining a recessed region fluidly connected to the inlet and facing the broad surface of the substrate, the fluid delivery module comprising a cell capture mode. |
US11052392B2 |
Microfluidic device for cell separation and uses thereof
Methods for separating cells from a sample (e.g., separating fetal red blood cells from maternal blood) include introducing a sample including cells into one or more microfluidic channels. In one embodiment, the device includes at least two processing steps. For example, a mixture of cells is introduced into a microfluidic channel that selectively allows the passage of a desired type of cell, and the population of cells enriched in the desired type is then introduced into a second microfluidic channel that allows the passage of the desired cell to produce a population of cells further enriched in the desired type. The selection of cells is based on a property of the cells in the mixture, for example, size, shape, deformability, surface characteristics (e.g., cell surface receptors or antigens and membrane permeability), or intracellular properties (e.g., expression of a particular enzyme). |
US11052384B2 |
Chrome compound, catalyst system using same, and method for preparing ethylene oligomer
The present invention relates to a chrome compound composed of non-coordinating anions and a trivalent chrome cation, a reactant of the chrome compound and a bidentate ligand, an ethylene oligomerization reaction catalyst system using the chrome compound and the reactant, and a method for preparing an ethylene oligomer using the catalyst system. Through the above conformation, the present invention can selectively produce 1-hexene and 1-octene with high activity while omitting the use of methylaluminoxane (MAO), and can provide an ethylene oligomerization process more suitable for mass production. |
US11052370B2 |
Method and device for producing printed microarrays
Method for manufacturing microarrays and verifying the quality of said microarrays, wherein the method comprises: a) providing at least one reagent, b) loading said at least one reagent in a dispensing print head, in a predetermined arrangement, c) in a first print pass, generating instructions for the print head and moving said print head with respect to a substrate to print said at least one reagent on the substrate to obtain microarrays, d) obtaining an image of the printed microarrays by means of a camera, e) processing the obtained images of the printed microarrays, to calculate parameters indicative for the quality of the printed microarrays, f) comparing, at the end of the first print pass, the calculated parameters for the printed microarrays with predetermined criteria for the microarrays, to identify possible printing defects, g) comparing, for the printed microarrays, the identified printing defects of step f), h) using the outcome of the comparison of step g) to select a corrective action to improve the quality of the microarrays, prior to the printing of a subsequent print pass. |
US11052367B2 |
Reflecting spherical microcapsules
Each of monodisperse spherical microcapsules for seeding a transparent fluid to track movements of the fluid both in translational and rotational directions comprises a core; a shell; and 1 to 5 light reflecting solid integral particles. Each of the particles reflects incoming light in a defined direction; and each of the particles is embedded in the core and fixed in its orientation with regard to the shell. The shell and the core are transparent for the incoming light to be reflected by the particles entering and exiting the microcapsule. The shell has a thickness of not more than λ, λ being a wavelength of the incoming light, so that the shell does essentially not deflect the incoming light entering and exiting the microcapsule. The core includes a main component of the fluid such that a refraction index of the core essentially matches a refraction index of the fluid. |
US11052366B2 |
Erosion monitoring system for components for fluid bed catalytic cracking plants
An erosion monitoring system of components exposed to wear for use in systems equipped with a fluidized catalyst comprising a bundle of fiber optic sensors, said optical fibers being provided with one or more Bragg gratings, a processing unit and the fiber optic sensors depart off from the bundle and are positioned transversely to the wall exposed to erosion wear due to the erosion of the components to be monitored. |
US11052365B2 |
Process and apparatus for the production of synthesis gas
Reactive diluent fluid (22) is introduced into a stream of synthesis gas (or “syngas”) produced in a heat-generating unit such as a partial oxidation (“POX”) reactor (12) to cool the syngas and form a mixture of cooled syngas and reactive diluent fluid. Carbon dioxide and/or carbon components and/or hydrogen in the mixture of cooled syngas and reactive diluent fluid is reacted (26) with at least a portion of the reactive diluent fluid in the mixture to produce carbon monoxide-enriched and/or solid carbon depleted syngas which is fed into a secondary reformer unit (30) such as an enhanced heat transfer reformer in a heat exchange reformer process. An advantage of the invention is that problems with the mechanical integrity of the secondary unit arising from the high temperature of the syngas from the heat-generating unit are avoided. |
US11052363B1 |
Resaturation of gas into a liquid feedstream
A method for enabling gas exchange and chemical reactions with one or more liquid streams contained in a reactive process vessel are provided. One or more exchange layers within the process vessel can be composed of both collector media and releaser media. The exchange layers allow elements to facilitate increased performance of vessel operations by promoting gas component mixing and diffusion. Improved rates of gas component exchange mean less coking and more gas components available for reaction. |
US11052359B2 |
Blending station apparatus and method for using the same
A blending method is described for preparing a blended mixture. The blending method for preparing a blended mixture, the method includes: providing a control system having at least a processor, a computer-readable memory, and a display, wherein the memory contains software configured to receive a formula defining instructions for preparing a blended mixture using one or more blending materials and amounts for producing a batch size of the blended mixture on a scale; monitoring a weight on the scale as blending materials are added to a receptacle on the scale, both individually and in total; indicating on the display the amounts of the blending materials that have been added to the scale, both individually and in total, to prepare an amount of a custom blended mixture based upon the selected blending materials; determining an end weight of the custom blended mixture after a user has used the custom blended mixture; and recalculating a needed amount of the custom blended mixture by subtracting the end weight of the custom blended mixture from the prepared amount of the custom blended mixture. |
US11052357B2 |
Deployable stirring member
The invention relates to a stirring member (9) for using in a system for preparing a food product, the product being prepared by the stirring member (9) moving inside a container (8), the stirring member (9) being configured in such a way that it can adopt different configurations depending on its direction of rotation inside the container (8). Preferably, the stirring member (9) can adopt a spoon configuration or a whisk configuration. The invention further relates to a method for using such a stirring member (9) in a system for preparing a food product, the method varying the direction of rotation of the stirring member (9) so that it adopts a different configuration depending on the type of product prepared in the container (8). |
US11052353B2 |
Catalyst-containing oxygen transport membrane
A method is described of producing a catalyst-containing composite oxygen ion membrane and a catalyst-containing composite oxygen ion membrane in which a porous fuel oxidation layer and a dense separation layer and optionally, a porous surface exchange layer are formed on a porous support from mixtures of (Ln1−xAx)wCr1−yByO3−δ and a doped zirconia. Adding certain catalyst metals into the fuel oxidation layer not only enhances the initial oxygen flux, but also reduces the degradation rate of the oxygen flux over long-term operation. One of the possible reasons for the improved flux and stability is that the addition of the catalyst metal reduces the chemical reaction between the (Ln1−xAx)wCr1−yByO3−δ and the zirconia phases during membrane fabrication and operation, as indicated by the X-ray diffraction results. |
US11052349B2 |
Apparatus for membrane distillation using solar absorber and heat pump
The present disclosure to an apparatus for membrane distillation using a solar absorber and a heat pump, in which in the implementation of a membrane distillation process for producing treated water using a temperature difference between raw water and a coolant, raw water is heated using the solar absorber with improved heat collection efficiency, and through this, the treated water production efficiency of the membrane distillation process is improved. |
US11052340B1 |
Cylindrical filter cartridge cleaning device
A cartridge cleaning device comprising a cleaning nozzle joined to means for vertically displacing the nozzle, a power unit, and a rotatable platform. Fluid is introduced to the device and split into two streams, one stream providing fluid to the cleaning nozzle and the other stream directed to the power unit and effectuating rotation of a power wheel, thereby generating a torque which is transferred to the means for vertically displacing the nozzle and the rotatable platform. The torque to the means for vertically displacing the cleaning nozzle effectuates vertical displacement of the nozzle. The torque to the rotatable platform effectuates rotation of the rotatable platform on which at least one cartridge is placed during cleaning operations. The cleaning nozzle directs a stream onto the cartridge surface and perpendicular to the cartridge longitudinal axis and is displaced vertically in concert with cartridge rotation. |
US11052339B2 |
Backwashable depth filter
A hollow cylindrical depth filter formed of fibers of a thermoplastic resin and having a thickness of a filter medium of 5 to 25 millimeters, in which the filter medium has a compression ratio of 0.2 or less when a load of 0.5 MPa is applied thereto, the filter medium has a fiber layer of at least three layers from a fluid inflow side toward an outflow side, porosity of the three layers are adjusted to a specific range, respectively, and intersection points of the fibers forming the filter medium are bonded, a mean interval between the intersection points is 2 to 100 times a mean fiber diameter of the fibers in a length direction, and a ratio of the mean fiber diameter on a surface on an upstream side to the mean fiber diameter on a surface on a downstream side of the filter medium is 0.9 to 1.2. |
US11052337B2 |
Filtration filter and filtration filter device
A filtration filter includes a porous metal film that filters out a filtration object contained in a fluid, and a support base member that is disposed on at least one main surface of the porous metal film and that supports the porous metal film. The support base member has an opening that exposes a part of the porous metal film. An inner peripheral surface of the opening has undulations formed along its periphery. |
US11052333B2 |
Filter interconnect using a correlated magnet torque design
A filtration system interconnection structure having manifold with a rotatable manifold magnet of correlated magnets, a shroud with alignment tracks, an actuating valve for water ingress, and a filter cartridge having a rotatable filter magnet of correlated magnets, where the manifold magnet and the filter magnet are in magnetic communication with one another when the filter cartridge is inserted with the shroud, and are at least partially rotatably compatible, where the manifold magnet rotates with the filter magnet until the manifold magnet experiences a rotational stop beyond a predetermined rotation of the filter magnet, thus allowing the filter magnet to shift polarity with respect to the manifold magnet and present a repulsion force for removal of the filter cartridge from the shroud. |
US11052331B2 |
Diffusiophoretic water filtration device with closed channel structure
A diffusiophoretic water filtration device has a pressurizable gas chamber for receiving a pressurized gas; an inlet manifold for receiving a colloidal suspension including colloidal particles in water; a flow chamber having an inlet and an outlet, the flow chamber for receiving the colloidal suspension at the inlet from the inlet manifold, the colloidal suspension flowing between the inlet and at least one outlet in a flow direction; and a gas membrane separating the gas chamber and the flow chamber, the sheet being made of a gas permeable membrane, the pressurized gas capable of permeating the membrane, the membrane being water impermeable, the gas membrane having a first side facing the pressurized gas chamber, and a second side facing the flow chamber, the flow chamber having a plurality of channels, each channel contacting the second side of the membrane; and an outlet splitter separating a first outlet from a second outlet and splitting the plurality of channels, the first outlet for receiving water having a higher concentration of some of the colloidal particles than the second outlet. |
US11052329B1 |
Launder cover system
A launder cover system for reducing or eliminating sunlight exposure so as to prevent algae growth in a tank such as a clarifier tank. The launder cover system generally includes a plurality of support members and a plurality of launder covers which are each independently pivotably connected to a tank wall of a tank, such as by using a mount. The support members are each pivotably connected to the tank wall by a pivot connector and the launder covers are each pivotably connected to the tank wall by a hinge connector. Each support member is positioned between a pair of launder covers, and each launder cover is positioned between a pair of support members. The support members function to support the launder covers in a raised or lowered position. A launder support may be connected to the channel wall to support the launder covers in their lowered positions. |
US11052326B2 |
Feedback control optimization of counter-flow simultaneous heat and mass exchange
A counter-flow simultaneous heat and mass exchange device is operated by directing flows of two fluids into a heat and mass exchange device at initial mass flow rates where ideal changes in total enthalpy rates of the two fluids are unequal. At least one of the following state variables in the fluids is measured: temperature, pressure and concentration, which together define the thermodynamic state of the two fluid streams at the points of entry to and exit from the device. The mass flow rate of at least one of the two fluids is changed such that the ideal change in total enthalpy rates of the two fluids through the device are brought closer to being equal. |
US11052321B2 |
Applying participant metrics in game environments
A system that collects, analyzes, and applies physical metrics from participants in game environments. Participants (players and/or spectators) in a game may wear or hold devices that collect physical data from the participants via sensors, generate metrics data from the sensor data, and provide the metrics data to a participant metrics module. The module may receive the metrics data from the devices, analyze the metrics data to generate game inputs based on the participants' physical metrics, and provide the game inputs to the game system to affect game play. The module may also receive alerts or other information from the game system or from players, determine feedback for participants according to the received information, and signal the devices to provide feedback or alerts to the participants in the game. The devices may include indicators that are activated by the signals to provide visual, audio, and/or haptic indications to respective participants. |
US11052319B2 |
Guest management in an online multi-player virtual reality game
A guest management method and system for an online multi-player virtual reality environment or social networking site. A network interface receives guest access requests from guest clients and input data from a plurality of remotely-located clients. The input data is operative to control avatars associated with the clients in a modeled virtual reality environment. A memory holds program instructions for determining whether the guest access is associated with a member client. If the guest access request is associated with the member client, then the guest client is allowed to access the virtual reality environment via a guest avatar. The guest avatar's movements in the virtual reality environment are restricted based on a location of a member avatar controlled by the associated member client. For example, the guest avatar may only be permitted to move within an area that is bounded by a perimeter about the member avatar. |
US11052318B2 |
System and method for predicting in-game activity at account creation
This disclosure relates to a system and methodology for dynamically adjusting a game based on predictions made during game account creation in accordance with one or more implementations. The system may be configured to receive user information included in platform level accounts which were previously created by users on an online platform and assign one or more user types to the user based on that user information. The system may be configured such that game adjustments associated with one or more user types for future play by users associated with that user type may be modified over time based on historical and ongoing game activities undertaken by users associated with one or more user types. |
US11052317B1 |
Performing simulation of stretchable character in computer game
Embodiments relate to generating a character with a stretchable body part in a computer game. A pose of a body part of the character is received. The body part includes at least one base joint, bones connected via the at least one base joint, and an end effector coupled to one of the bones. An end effector position is received. The end effector position is where an end effector of the body part is to be placed in an updated pose. Inverse kinematics operations are performed to determine the updated pose of the body part by at least changing a length of one of the bones to place the end effector at the end effector position responsive to receiving the pose of the body part and the end effector position. |
US11052316B2 |
Method and apparatus for generating image parameter for reproducible virtual character
A method for generating an image parameter for a reproducible virtual character includes: receiving a trigger signal for generating a virtual character; acquiring a generation rule of an image parameter of the virtual character, the image parameter comprising n characteristic parameters configured to indicate an image of the virtual character; and generating a gene sequence of an ith characteristic parameter in the n characteristic parameters according to the generation rule. |
US11052313B2 |
Using connection quality history to optimize user experience
Methods and systems for assigning a data center to service a request from a user account include receiving a login request to a cloud gaming server. The login request is examined to identify a user account. A use history of the cloud gaming server is examined to identify a data center. The user account is assigned to the data center to start a session of streaming game play at a server within the data center. The data center is identified without performing a connection testing operation. |
US11052312B2 |
Non-transitory computer readable medium, method of controlling a game, and information processing device
A non-transitory computer readable medium including program instructions, a method of controlling a game, and an information processing device make a game more amusing. When executed, the program instructions cause the information processing device to store information related to objects and information related to game contents in a storage, associate positioning information in a virtual space with each object, associate positioning information with the game contents, cause the objects and the game contents to be displayed at the position indicated by the positioning information associated with each of the objects and the game contents, change the positioning information associated with an object and the positioning information associated with each game content associated with the object, determine whether a predetermined condition is satisfied, and finalize the positioning information associated with the objects and the positioning information associated with the game contents when the predetermined condition is determined to be satisfied. |
US11052309B2 |
Wireless interactive game having both physical and virtual elements
Embodiments of the invention provide a unique interactive game that connects both physical and virtual play environments and includes multiple dynamic layers in which a participant may complete a variety of challenges and/or tasks. For example, the participant may obtain a physical gaming item such as a toy from a retail phase that is usable in an interactive entertainment phase that provides virtual play via computer animation. The interactive entertainment phase may include multiple interrelated layers such that progress in one or more layers may affect the participant's experience in one or more other layers. The participant may also receive training on how to use and improve the physical gaming item to help achieve one or more special effects or complete one or more adventures and/or quests. During or following the interactive entertainment phase, the participant may use accumulated points and/or powers to redeem prizes and/or compete against other participants, such as in a duel or other face-off challenge. |
US11052308B2 |
Object control system in location-based game, program and method
An object control system in a location-based game, in which a character in a virtual world is linked with and moved along with a movement of a user in a real world, is provided with: a location information acquiring unit which detects a current location and displacement in the real world of the user; a virtual display data generating unit which selects a boundary line on real map information so as to be an area and a shape according to the current location of the user in the real world and information density on the real map information corresponding to the current location, and generates a virtual fantasy block that partially covers the real map; and a synthesis processing unit which superimposes and displays the fantasy block generated by the virtual display data generating unit on the real map information. |
US11052306B2 |
Wisdom ring puzzle
The wisdom ring puzzle includes a first member and a second member being an annular member, the first member including a connection post, a first small ring, a second small ring, and a first large ring, and a disconnection prevention part, a first post, and a second post sequentially provided to extend from the connection post toward a substantially same direction, the first post including a first ring catching part, the second post including a second ring catching part, the first small ring swingably caught in the first post by the first ring catching part, the second small ring and the first large ring swingably caught in the second post by the second ring catching part, the disconnection prevention part passing through the first small ring and the first large ring, the first post passing through the second small ring. |
US11052304B2 |
Management system of gaming chips and storage box
A system that manages a package of shuffled playing cards and gaming chips includes a storage box and a control apparatus. The storage box is provided in association with a game table and stores a plurality of shuffled playing cards and a plurality of chip cases and also includes a card reader that reads playing card ID codes of the shuffled playing cards and a chip reader that reads case ID codes of the chip cases. The control apparatus outputs total numbers of the shuffled playing cards and the chip cases stored in the storage box and the playing card ID codes and case ID codes stored in the storage box by monitoring read playing card ID codes and case ID codes. |
US11052303B2 |
Guard for in-line roller skate
There is provided a guard for an in-line roller skate, which includes an elongated member defining a wheel receiving channel. The channel has a bottom and a pair of opposed sidewalls, which extend upwardly from the bottom terminating in a remote edge. The remote edge of the sidewalls define a wheel insertion opening to receive wheels of an in-line roller skate. At least one transverse roller is positioned across the channel near the remote edge of the sidewalls. |
US11052302B2 |
Leg guard with adjustable strap
The leg guard for protecting at least a shin of a wearer includes a shin guard body and a strap. A peripheral edge of the shin guard body defines part of a perimeter of the shin guard body. The shin guard body includes a first coupling base and a second coupling base disposed on one of the interior and exterior surfaces. A first coupler is disposed at a first end of the strap and is releasably attachable to the first coupling base at a plurality of first attachment points, and a second coupler is disposed at the second end of the strap and is releasably attachable to the second coupling base at one of a plurality of second attachment points. A length of a wrappable segment is adjustable by releasably attaching the second coupler to the second coupling base at another one of the plurality of second attachment points. |
US11052301B2 |
Securing garment for a shoulder-pad system
A shoulder-pad system includes various components, including an impact-plate assembly and one or more sub-layers. The shoulder-pad system may be substantially retained in an arrangement or configuration using one or more securing garments. An exemplary securing garment includes an upper-body garment that at least partially wraps over, and attaches to, the impact-plate assembly. |
US11052300B1 |
Flying disc launcher
A flying disc launcher includes a frame body including a loading seat and a side wall. The loading seat includes a carrying portion and a receiving portion. A flying disc inlet and a flying disc outlet are respectively defined in both ends of the carrying portion. The side wall includes a guiding wall opposed to the receiving portion. A turntable is installed in the receiving portion and protrudes from an upper surface of the carrying portion. The power component is connected with the turntable to drive the turntable to rotate. When the turntable rotates and a flying disc is placed on the carrying portion from the flying disc inlet, the guiding wall and the turntable can contact the flying disc to drive and guide the flying disc to fly out toward the flying disc outlet. |
US11052298B2 |
Golf ball position gauging assembly and method
A golf ball position gauging assembly allows for a method of improving results based on a user's existing swing without modifying the existing swing. The assembly includes a pair of feet. Each foot has an associated aperture extending therethrough. Each of the feet has a bottom edge downwardly spaced from the associated aperture. A beam is insertable into or through each of the apertures such that the beam extends between the feet in an upwardly spaced position relative to the bottom edges of the feet. Each of a plurality of markings is incrementally spaced along the beam between the feet. The beam is insertable through a guide wherein the guide is slidable along the beam to be positioned adjacent to a selectable one of the markings. |
US11052289B2 |
Swim cap for persons with long hair
A swim cap for persons having long hair includes a shell preferably having at least two interconnected compartments for receiving and encapsulating the hair of a user. The swim cap is secured around the head of a user by at least one draw string or adjustable band positioned within a channel near the open end of the swim cap as well as a chin strap extending downwardly from the cap. The interconnected compartments can be inflated to provide buoyancy. The shell further includes an outer layer and an inner layer defining a space therebetween that can also be inflated, or comprised of buoyant material, to provide buoyancy. A pump, compressed air canister or manual filler tube in communication with the interconnected compartments or space within the shell can be used to provide inflation. A pair of ear flaps extends downwardly from the swim cap around a user's head. |
US11052288B1 |
Force measurement system
A force measurement system is disclosed herein. The force measurement system includes a force measurement assembly configured to receive a subject thereon, and one or more data processing devices operatively coupled to the force measurement assembly. In one or more embodiments, the one or more data processing devices are operatively coupled to the force measurement assembly, the one or more data processing devices configured to receive one or more signals that are representative of forces and/or moments being applied to a top surface of the force measurement assembly by the subject, and to convert the one or more signals into output forces and/or moments, the one or more data processing devices further configured to predict one or more balance parameters of the subject using a trained neural network. |
US11052286B2 |
Smart performance footwear and system
A footwear system that includes a left having a left toe region, left forefoot region, a left arch region and a left heel region, a left outsole, a left upper secured to the left outsole, and a left sensor system that includes at least a first left heel pressure sensor positioned in the left heel region, and at least a first left forefoot pressure sensor positioned in the left forefoot region. The footwear system also includes a right shoe that includes a right toe region, a right forefoot region, a right arch region and a right heel region, a right outsole, a right upper secured to the right outsole, and a right sensor system that includes at least a first right heel pressure sensor positioned in the right heel region, and at least a first right forefoot pressure sensor positioned in the right forefoot region. |
US11052284B2 |
Method, system and non-transitory computer-readable recording medium for supporting shooting a golf swing
The present invention relates to a method, system, and non-transitory computer-readable recording medium for supporting photographing of a golf swing. According to one aspect of the invention, there is provided a method for supporting photographing of a golf swing, the method comprising the steps of: (i) determining a user device matched with information on a user who is to perform a golf swing, among a plurality of user devices, with reference to a scenario associated with the golf swing; and (ii) causing a photographing module of the determined user device to photograph the golf swing of the user. |
US11052283B2 |
Hand grip
The present invention relates to a hand gripper including a first arm, a second arm, a pair of spring members, a first spring member coupling shaft, and a second spring member coupling shaft, wherein a plurality of first elastic force adjusting grooves and a plurality of second elastic force adjusting grooves, to which the first spring member coupling shaft and the second spring member coupling shaft are selectively coupled, respectively, to adjust strength of elastic force provided by the spring members, are formed in a first body of the first arm and a second body of the second arm, respectively. |
US11052282B2 |
Neckbalance
A device and method for influencing the movement and muscular function in the neck, includes a helmet, the helmet has a rim, said rim has notches along the edge, on top of the helmet there is attached a vertical rod, on top of this vertical rod there is attached at least two laser sights pointing forward, at least one rod is attached at one end to the vertical rod, and the at least one rod can rotate around the vertical rod. |
US11052281B2 |
Multi-purpose exercise device
A multipurpose exercise device is provided. The device includes features which allow the device to exhibit self-stabilizing features. The device includes a weighted body characterized by at least three substantially-loop-shaped handles which have dimensions and arrangements that are effective to cooperatively urge the device into one of several predetermined self-stabilizing rest positions. The rest positions are characterized by engagement portions of two of the provided handles resting against a support surface, while an elongated device bore extending along a center axis of the device is maintained in a substantially-horizontal orientation. The device may be stored safely in a variety of arrangements, including on a rack typically used for dumbbell storage. |
US11052279B1 |
Exercise machine
An exercise machine has a base housing and a boom that extends from a proximal end to a distal end. The boom is able to pivot between a rowing configuration wherein the boom is generally horizontal, and a skiing configuration wherein the boom is generally vertical. A rowing assembly includes a row handle attached to a row chain which extends into the base housing, to a row recoil device. A ski assembly includes a pair of ski handles, each ski handle being attached to a ski rope which extends into the base housing, to a ski recoil device. A transmission system has a shaft that is operably connected to a resistance device, the shaft having a row sprocket and a pair of ski spools, and the respective cables contact the spools so that movement of one of the cables rotates the respective spool, thereby rotating the shaft. |
US11052278B2 |
Pipe exercise device
A pipe exercise device designed to allow a user to transport a weight variable exercise device. The pipe exercise device includes an elongated member with an outer shell having a hollow interior designed to receive items therein. The elongated member has an open end disposed opposite a sealed end, wherein the open end is in communication with the hollow interior, such that a weight can be received therethrough to sit within the hollow interior. An end cap is designed to seal the open end, such that the weights therein are removably secured. At least one handle is disposed on the outer shell, such that the user can grasp the pipe exercise device. In this way, a user is able to transport a weight training device that can quickly and simply change the amount of weight used. |
US11052276B1 |
Weight plate and barbell component system
A barbell comprises a substantially cylindrical elongated bar having a plurality of connectors located along the length thereof. A generally disk shaped weight plate having a central aperture and a peripheral handle is provided, and the barbell is received within the central aperture. A fastening assembly is formed on the weight plate and extends between the central aperture and the peripheral handle. The fastening assembly is selectively movable between a first position in which it engages with one of the connectors on the barbell, and a second position in which it is disengaged from the connector on the barbell. |
US11052274B2 |
Method and apparatus for exercise energy utilization
A system for capture, storage, and usage of electric energy generated by humans during exercise activities, including exercise devices having a modular control-power storage unit that incorporates energy conversion units arranged to transform mechanical energy of the at least one human participant into different storable forms of energy, at least one energy storage module arranged to store energy in at least one storage medium, and at least one control unit arranged to provide digital or analog control for the at least one modular control-power storage unit. The system may also have a communication and networking subsystem structured as a networking device and arranged to connect to and communicate bay exchanging information with at wired and/or wireless network. |
US11052272B2 |
Multiple position adjustable exercise device
A multiple position adjustable exercise device includes a first plate, a second plate and an elastic member. The second plate is pivotally connected with the first plate. The elastic member is disposed between the first plate and the second plate, and when the second plate rotates relative to the first plate, the elastic member is twisted for providing an elastic recovering force. An initial position of the second plate relative to the first plate is adjustable for adjusting the elastic recovering force. |
US11052266B2 |
Method and apparatus for beam energy measurement
Apparatus for measuring radiation beam energy output from a radiation beam source, comprising a first beam energy sensor at a first distance from the radiation beam source along the radiation beam axis; a second beam energy sensor located at a second distance from the radiation beam source along the radiation beam axis; and an energy absorbing layer, for example a layer that removes a part of the low energy content of the beam or a layer that absorbs at least 1% of the beam energy, located between the first and second sensors, and positioned such that radiation passing through the first sensor also passes through the energy absorbing layer before entering the second sensor. |
US11052265B2 |
Fluence map optimization for field-in-field radiation therapy
Improved radiation therapy with field-in-field multi-leaf collimator, utilizing leaf sequencing Field-in-Field's (FIF) to accurately reproduce the input fluence map or original optimized dose distribution. The number of apertures used is constrained to a user-specified value all the way down to as few as 2 apertures which significantly magnifies the effect of poorly formed apertures. The disclosed invention further includes producing fluence maps with a homogenous dose throughout the treated volume utilizing leaf-sequencing Field-in-Field that reproduces more precise input fluence maps to yield optimized dose distribution. |
US11052262B1 |
Stimulation of subcortical brain regions using transcranial rotating permanent magnetic stimulation (TRPMS)
A method of affecting a biological, cellular or biochemical function or structure in a targeted subcortical location in a brain of a patient using a TRPMS apparatus placed on a head of the patient includes positioning two or more of a plurality of magnetic assemblies on locations of the head mount selected to stimulate the targeted subcortical location in the brain of the patient, and activating the plurality of magnetic assemblies at the selected locations to generate magnetic fluxes of a selected strength, frequency and duration directed into the brain of the patient, wherein the magnetic flux directed into the brain of the patient from each of the assemblies is operative to generate induced electric field in regions of the brain and the regions of induced electric fields generated by each of the plurality of magnetic assemblies converge in the targeted subcortical location and combine to a magnitude sufficient to affect the biological, cellular or biochemical function or structure in the targeted subcortical location. |
US11052260B2 |
Implantable electrode coupled to an optoelectronic device
An optoelectronic electrode element includes an electrode module (40) having at least a first and second electrodes (41, 42) each having an electrode surface (41s, 42s). An an optoelectronic module (20) is provided and having a photovoltaic cell (21a) suitable for transforming optical energy into electrical energy. A feeding fibre optic (31a) is also provided. A coupling module (10) is provided and having a circuit receiving portion (12) for inserting, positioning, and rigidly fixing the optoelectronic module (20) to the coupling module (10); and a feeding fibre cavity (11a) for inserting and coupling the feeding fibre optic to bring it in optimal optical communication with the photovoltaic cell. The coupling module (10) is coupled directly to a fixing area of the electrode module (40), such that the photovoltaic cell be in electrical contact with the first and second electrodes (41, 42). |
US11052258B2 |
Methods and systems for detecting atrial contraction timing fiducials within a search window from a ventricularly implanted leadless cardiac pacemaker
A ventricularly implantable medical device that includes a sensing module that is configured to identify a search window of time within a cardiac cycle to search for an atrial artifact. Control circuitry in the ventricular implantable medical device is configured to deliver a ventricular pacing therapy to a patient's heart, wherein the ventricular pacing therapy is time dependent, at least in part, on an atrial event identified in the search window of time. |
US11052254B2 |
Methods and systems of electrode polarity switching in electrical stimulation therapy
Methods for electrically stimulating body tissues to improve function or reduce symptoms provide an electrical stimulation system having two or more electrodes that are capable of being switched independently from a hyperpolarizing (depolarizing) state to a hypopolarizing state. Multiple combinations of hyperpolarizing electrodes and hypopolarizing electrodes are created by polarity switching to determine a polarity configuration having the best performance as determined by symptom reporting and clinical diagnostic tests. Polarity switching is triggered manually or is programmed to be switched automatically. Determining the configuration providing electrical stimulation resulting in the greatest benefit allows the system to be operated with one or more electrodes in a hypopolarizing state, thereby reducing energy requirements, tissue tolerance, and tissue fatigue. |
US11052251B2 |
Device for the transcutaneous electrical stimulation of the trigeminal nerve
A device for the transcutaneous electrical stimulation of the trigeminal nerve is provided. The device has an elongated symmetrical support with at least one electrode pair, and the support can be applied on a person's forehead in the supraorbital region to cover the afferent paths of the supratrochlear and supraorbital nerves of the ophthalmic branch of the trigeminal nerve. Each electrode pair contacts a self-adhesive conductive gel that at least partially covers one surface of the support for attaching the support to the forehead to be applied to two lateral zones with the exception of an insulating central zone. Each lateral zone has one electrode of the electrode pair, an electric circuit for supplying to the electrode pair electric pulses that have a predefined intensity, and a measurement means for measuring the intensity of the supplied pulses that is connected to the electric circuit. |
US11052248B2 |
Device and implantation system for electrical stimulation of biological systems
The present specification discloses devices and methodologies for the treatment of achalasia. Individuals with achalasia are treated by implanting a stimulation device within the patient's lower esophageal sphincter and applying electrical stimulation to the patient's lower esophageal sphincter, in accordance with certain predefined protocols. The presently disclosed devices have a simplified design because they do not require sensing systems capable of sensing when a person is engaged in a wet swallow and have improved energy storage requirements. |
US11052247B2 |
Skin treatment system
A skin regeneration therapy combining precise bioelectric signals, light, and biologics for skin treatment and regeneration. Precise bioelectric signals give clear instructions to the stimulated cell DNA/RNA to produce specific regenerative proteins on demand. Bioelectric signals give clear instructions to cell membranes on what to let in and what to let out and serve as an equivalent or surrogate of environmental stimuli to cause a cell action in response. |
US11052240B2 |
Electro kinetic transdermal and trans mucosal delivery accelerator device
A medical device for administering a medicament is disclosed that includes a reservoir for storing the medicament, a current driver electrically coupled to an electrode, and an oscillation driver electrically coupled to a vibrational element. The electrode forms multiple channels in fluid communication with the reservoir. A method of administering a medicament is also provided. |
US11052239B2 |
Cannula, cannula system, heart pump system and method for relieving the volume of a heart
A cannula for relieving the left side of the heart is provided, the cannula having a cannula shaft comprising a heart-side inlet and a pump-side outlet. A lumen extends between the inlet and the outlet, and a suture ring for connecting the cannula to a left atrium is arranged on an outer side of the cannula shaft. The outlet is configured such that the outlet can be connected to a pump and the length of the cannula shaft between the suture ring and the outlet is such that the cannula shaft can be guided outwards through an intercostal space. |
US11052238B2 |
Vena-caval sleeve
Apparatus and methods are described for use with a tributary vessel of a subject that supplies a vein of the subject. Blood within the tributary vessel is mechanically isolated into a compartment that is separated from blood within the vein. Blood flow from the tributary vessel to the vein is controlled by pumping blood from the compartment to the vein. Other applications are also described. |
US11052237B2 |
Swivel hub
The present disclosure relates to a connector for medical devices. The connector may have two interfaces facing different planes. The two interfaces may provide access to the connector's core and hub. The hub may be free to rotate relative to the core to increase accessibility and/or angle attachment while maintaining a fluid pathway between the core and the hub. |
US11052236B2 |
Conduit connector for a patient breathing device
In an embodiment, a connector or connector assembly for attaching a nasal cannula with a gas delivery hose includes a sensor port for a sensor probe positioned near an end of a nasal cannula, which can allow the sensor probe to be placed closer to the patient's nostrils than previous connector parts allowed. The connector can be configured to advantageously allow the nasal cannula to rotate relative to the gas delivery hose, thereby allowing a patient or healthcare provider to untangle or otherwise straighten the hose or the cannula. The connector assembly can be configured to automatically align locking protrusions on a first component with locking recesses on a second component, where insertion of the second component within the first component causes the second component to rotate relative to the first component, thereby aligning the locking protrusions with associated locking recesses. |
US11052235B2 |
Lever lock-type male connector and male connector assembly
Levers (30) are connected to a base end portion (13) of a male luer via a base (15). Each lever includes a locking portion (31) and an operating portion (35). A locking claw (32) protrudes from each locking portion toward the male luer. A lock ring (8) is provided opposing inner surfaces of the operating portions. The lock ring is movable between a first position at which the lock ring is located close to the base and a second position at which the lock ring is located away from the base. When the lock ring is at the first position, the levers are pivotable such that the locking claws move away from the male luer. When the lock ring is at the second position, the lock ring restricts the levers from pivoting such that the locking claws move away from the male luer. |
US11052234B2 |
Connector with integrated non-return check valve for extension tubing and urology collection systems
A connector-with-integrated-check-valve for minimizing microbial migration to catheter-tubing is formed from three parts: a connector-for-catheter-tubing that is hollow and with an internal valve seat; an elastomer gate (sometimes with disc and stem); and a connector-for-extension-tubing that is hollow and with support-surfaces. When one end of the connector-for-catheter-tubing is attached to one end of the connector-for-extension-tubing, a pocket is formed where the seat is disposed opposite and facing the support-surfaces; the gate is disposed within this pocket; such that when the gate contacts this seat due to urine backflow (reflux), the connector-with-integrated-check-valve is closed to such urine backflow; and where a remaining end of the connector-for-catheter-tubing is attachable to catheter-tubing; and where a remaining end of the connector-for-extension-tubing is attachable to the extension-tubing, such that there is a continuous urine flow path from the catheter-tubing, to the connector-with-integrated-check-valve when open, and to the extension-tubing. |
US11052233B2 |
Tube for a medical container
A tube for a medical container has a tube wall which consists of at least two layers. According to the invention, at least one layer contains a styrene-containing thermoplastic polymer (S-TPE), in particular a styrene-butadiene block copolymer (SBC) or a copolyester, a copolyester ether or a cyclic olefin copolyester. The at least one other layer contains ethylene-vinyl acetate copolymer (EVA), preferably with a vinyl acetate (VA) portion in the ethylene-vinyl acetate copolymer of from 10% to 30%, preferably 14% to 28%. The EVA can be mixed with a thermoplastic polybutene and/or SEBS to improve the tube properties. The tube wall can have a two-layer structure with an inner or an outer layer which contains the S-TPE, copolyester, copolyester ether or cyclic olefin copolyester, or a three-layer structure with an outer and inner layer containing the S-TPE or copolyester or copolyester ether. |
US11052230B2 |
Implantable encapsulation devices
The present disclosure relates to implantable encapsulation devices for housing a biological moiety or a therapeutic device that contains a biological moiety. Particularly, aspects of the present disclosure are directed to an implantable apparatus that includes a distal end, a proximal end, a manifold including at least one access port positioned either at the distal end or the proximal end, and a plurality of containment tubes affixed to the manifold and in fluid communication with the at least one access port. Additionally, the encapsulation device may contain a flush port and a tube that are fluidly connected to the manifold. The containment tubes may contain therein a biological moiety (e.g., cells) or a therapeutic device (e.g. a cell encapsulation member). |
US11052229B2 |
Devices and methods for guidewire extension in spinal surgery
A guidewire system for spine surgeries includes a first guidewire portion having an elongate first guidewire body with a distal end and a proximal end. A threaded male fastener at the distal end of the first guidewire body is configured to fasten to a vertebra of a spine of a subject and a threaded female coupler at the proximal end of the first guidewire body defines a threaded opening. The guidewire system includes a second guidewire portion having an elongate second guidewire body with a distal end and a proximal end. A threaded male coupler at the distal end of the second guidewire body is configured to thread into the threaded female coupler of the first guidewire portion to fasten the second guidewire portion to the first guidewire portion to form an elongate guidewire. |
US11052227B2 |
Deflectable catheter shaft section, catheter incorporating same, and method of manufacturing same
A deflectable catheter shaft section is disclosed comprising an elongated body extending along a longitudinal axis and comprising a distal end and a proximal end; and a plurality of lumens extending along the longitudinal axis of the elongated body, wherein at least one of the lumens is abutting at least another one of the lumens. A catheter comprising the deflectable catheter shaft section and a method of manufacturing the deflectable catheter shaft section are also disclosed. A catheter incorporating a deflectable catheter shaft section can further comprise first and second compression coils disposed over pull wires located within the catheter, wherein the compression coils are unattached to the catheter or components thereof, but can be constrained by a shaft coupler at a distal end of each of the compression coils and by at least a portion of a handle assembly at a proximal end of each of the compression coils. |
US11052226B2 |
Steerable medical devices, systems, and methods of use
Steerable medical devices and methods of use. In some embodiments, the steerable medical devices can be steered bi-directionally. In some embodiments the steerable medical devices include a first flexible tubular member and a second flexible tubular member secured together at a location distal to a steerable portion of the steerable medical device. |
US11052222B2 |
Sleep induction device and method for inducting a change in a sleep state
A sleep induction device includes at least one sensor for detecting a physiological characteristic of the user, a stimulator configured to provide successive stimuli to the user to anticipate on the detected physiological characteristic, which successive stimuli define a guidance path, and which guidance path is to be followed by the user to induce a change during the sleep session of the user, a memory which is arranged to store values of detected physiological characteristics, and provided stimuli during the sleep session, and a processing unit including a control programme which is programmed to determine a current sleep state of the user, which current sleep state is based on at least one detected physiological characteristic measured by the at least one sensor and which control programme is programmed to generate an initial guidance path to induce a change from the determined current sleep state to another sleep state. |
US11052221B2 |
Infant calming/sleep-aid device
An infant calming/sleep-aid device that includes a moving platform and a sound generator, the sound and motion adapted to calm a fussy baby, induce sleep, and maintain sleep under normal conditions. The device makes a determination as to whether sound signals represent sound coming from inside the device or outside the device. If the sound signals are coming from the inside the device, then the signals are evaluated in a specified frequency band to determine whether the sound is a baby cry. If a determination is made that there is a baby cry, then a threshold analysis is performed to quantify the cry and compare it to a threshold value. If the cry is above a specified threshold, the device moves the platform and/or generates sound. |
US11052220B2 |
System and method for adjusting the volume of auditory stimulation during sleep based on sleep depth latencies
The present disclosure pertains to a system configured to adjust a volume of auditory stimulation delivered to a subject during sleep. The system is configured to determine a deepening time indicative of a rate at which sleep of the subject deepens during the sleep session. The deepening time is determined based on (i) a ratio of power in a high frequency band of an EEG signal to power in a low frequency band, (ii) a density of slow waves, or (iii) a hypnogram, indicative of sleep depth in the subject during the sleep session. The system is configured to determine a rate of volume increase for auditory stimulation during a subsequent sleep session based on the deepening time; and control the one or more sensory stimulators to adjust the volume of auditory stimulation provided to the subject during the subsequent sleep session based on the determined rate of volume increase. |
US11052219B2 |
Sensory activity sack
A sensory activity sack provides a garment with pleasant tactile features offering safe sensory stimulation for persons with developmental or sensory disabilities and an isolation bag for the wearer's arms and hands. The isolation bag prevents the wearer from engaging in self-injurious behavior or other harmful behaviors. Multiple fabrics and textures in the isolation bag, including mesh and denim, provide a pleasing tactile experience, which can be furthered by the placement of toys into the isolation bag. Sensory panels made with a sturdy, textured material such as denim provide tactile stimulation and resistance against wear and biting, as well as adding a comforting weight to the sensory activity sack for wearers with sensory issues. |
US11052212B2 |
Capnoxygen masks
An oxygen mask configured for CO2 sampling and oxygen delivery, the oxygen mask having an oxygen inlet, a nasal breath-sampling element and a breath sampling port configured to receive breath samples, sampled by the breath-sampling element, wherein the breath-sampling element is configured to reduce dilution of exhaled breath by the delivered oxygen. |
US11052211B2 |
Interchangeable mask assembly
A system of breathing arrangements for delivering breathable gas to a patient includes at least first and second cushion components, e.g., full-face, nasal, nasal prongs, nose tip, and/or a combination of any of the above, including a nasal or full-face cushion and nasal prongs/nozzles combination, etc., that are different from one another in at least one aspect, and a common frame assembly configured to support each of the first and second cushion components. Various embodiments are directed to a full-face or nasal mask used with a frame having lateral connector portions having a stiffening member. The mask assembly may include a nose height adjustment device for the height of the cushion, or a cushion adjustment member by which the position of the cushion may be adjusted relative to the frame. The mask assembly may include a chin strap assembly. |
US11052210B2 |
Patient interface with blowout prevention for seal-forming portion
One form of the present technology includes a sealing structure to seal against a user's face around the user's airways. The sealing structure includes a flap or membrane that extends inward towards the user's airways and includes a structure that prevents an inner boundary of the flap or membrane from being blown outwards (e.g., folded backwards upon itself) due to internal pressurization. |
US11052207B2 |
Gas sensing apparatus
The present disclosure pertains to an apparatus configured to facilitate monitoring of gas in a therapeutic gas delivery system with a catalytic sensor. The gas delivery system comprises a pressure generator having an inlet and an outlet, and a gas delivery flow path configured to communicate the gas between the pressure generator and a subject. The apparatus comprises a receiver body configured to receive the catalytic sensor such that the catalytic sensor removably couples with the receiver body, the receiver body located remotely from/outside the gas delivery flow path; a delivery port configured receive a portion of gas obtained from the gas delivery system that has passed through the pressure generator outlet and guide the received portion of gas toward the catalytic sensor; and a return port configured to exhaust the received portion of gas from the receiver body to the gas delivery system through the pressure generator inlet. |
US11052202B2 |
Drug delivery device for the treatment of patients with respiratory diseases
Drug delivery devices that include a microphone and processing circuitry that can detect operating events, such as peak inspiratory flow (PIF) and Breath Actuated Mechanism (BAM) in dry powder inhalers can be used to improve clinical trials by providing information about the way in which the inhalers under test are being used. |
US11052199B2 |
Auto-injector
An autoinjector having a body (1) receiving a reservoir (S), the reservoir containing fluid and including a piston (P); a piston rod (5) adapted to co-operate with the piston (P) of the reservoir (S), the piston rod (5) movable by an injection spring (8) between a primed position and an injection position in which the piston rod (5) has moved the piston (P) of the reservoir (S); and an indicator device for indicating that the autoinjector may be removed from the injection site. The autoinjector includes a retarding system for delaying actuation of the indicator device relative to the end of injection, the retarding system including a dashpot (16) containing a fluid and a piston (19) arranged in the dashpot (16). The retarding system has the dashpot (16), the piston (19), a retarding spring (18), a locking key (20), and the piston rod (5), and the piston rod (5). |
US11052198B2 |
Rotary sensor assembly with axial switch and redundancy feature
A sensor assembly comprising a first rotary sensor part with a plurality of individual electrically conducting axial position sensor segments arranged in a circumferential pattern, and a second rotary sensor part arranged rotationally relative to the first portion and comprising a plurality of circumferentially arranged electrically interconnected axial position contacts adapted to be arranged in contact with the axial position sensor segments. The assembly further comprises actuator means for axially moving the axial position contacts between a connected and a dis-connected position, wherein the axial position contacts and the axial position sensor segments are arranged such that for a given rotational position at least two axial position contacts each are in contact with a different axial position sensor segment. |
US11052187B2 |
Packaging for a reel of medical injection devices
A packaging for a reel of medical injection devices includes a base tray configured for supporting the reel and at least a first flat rib and a second flat rib. Each rib includes a respective slot arranged such that the ribs can be interlocked with one another by mutual engagement of the slots. The base tray includes at least two pairs of peripheral openings. Each opening is configured to receive an end of the ribs, so that the base tray and interlocked flat ribs engaging the base tray form a frame configured for enclosing the reel. |
US11052183B2 |
Devices for urea electrolysis and methods of using same
The present disclosure provides devices and methods of using same for cleansing a solution (e.g., a salt or used dialysis solution) of urea via electrooxidation, and more specifically to cleansing a renal therapy solution/dialysis solution of urea via electrooxidation so that the renal therapy solution/dialysis solution can be used or reused for treatment of a patient. In an embodiment, a device for the removal of urea from a fluid having urea to produce a cleansed fluid includes a urea decomposition unit and an electrodialysis unit. |
US11052182B2 |
Method and apparatus for checking a dialyzer for the presence of a leak
The present invention relates to a method for checking a dialyzer for the presence of a leak in the semipermeable membrane of the dialyzer, wherein the membrane divides the inner dialyzer space into a least one blood chamber and into at least one dialyzate chamber, wherein the blood chamber is flowed through by blood in the operation of the dialyzer and is in fluid communication with a blood-side line system and the vascular system of the patient, and wherein the dialyzate chamber is flowed through by dialysis fluid in the operation of the dialyzer and is in fluid communication with a dialyzate-side line system, wherein the method comprises the following steps: a) emptying the blood chamber or the dialyzate chamber of blood and of dialysis fluid respectively and keeping the fluid (blood or dialyzate) in the non-emptied dialyzate chamber or blood chamber; b) building up a test pressure by means of a gas, in particular by means of air, in the emptied blood chamber or in the emptied dialyzate chamber; and c) measuring the pressure drop over time in the emptied blood chamber or in the emptied dialyzate chamber or in the line system respectively in fluid communication therewith and/or measuring the pressure increase in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in the line system respectively in fluid communication therewith or measuring the number of air bubbles or of a parameter correlated with the number of air bubbles in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in a line system respectively in fluid communication therewith, wherein the steps a) to c) are carried out subsequent to the blood treatment of the patient and subsequent to the disconnection of the patient from the blood-side line system. |
US11052181B2 |
Cassette system integrated apparatus
A cassette integrated system. The cassette integrated system includes a mixing cassette, a balancing cassette, a middle cassette fluidly connected to the mixing cassette and the balancing cassette and at least one pod. The mixing cassette is fluidly connected to the middle cassette by at least one fluid line and the middle cassette is fluidly connected to the balancing cassette by at least one fluid line. The at least one pod is connected to at least two of the cassettes wherein the pod is located in an area between the cassettes. |
US11052178B2 |
Arrangements and methods for avoiding spreading of infectious agents and improving electric safety and suction performance of a medical aspirator
Vacuum pump (18) for a medical aspirator (10), the pump (18) comprising a tubular member (20); a piston (22) slidably arranged within the tubular member (20); a piston rod (24) connected to the piston (22); and a coupling mechanism (36) for detachably and functionally connecting the piston rod (24) to a motor (38) for driving the pump (18), wherein the piston rod (24) is configured to reciprocate linearly during operation of the pump (18). |
US11052176B2 |
Gradient coatings of biopeptides that promote endothelial cells selective adhesion and directional migration and methods of using the same
A two-layer gradient coating article is provided that is operable to cause selective adhesion and directional migration of endothelial cells. The first layer includes cell-resisting polymers that repels cells, the second layer includes one layer of peptides that has affinity to and binds specifically to endothelial cells. Furthermore, the peptides are distributed in a gradient, in which attached ECs migrate towards the direction of increased concentration, thus enriching the ECs to a desired locus. The combination of a cell-repelling layer and a graded affinity peptide produces a unique result of selective adhesion, directional migration, thus local enrichment of endothelial cells. A method for using such gradient coating article and its potential use in treating cardiovascular diseases are also provided. The invention provides an inexpensive, stable and effective means for attracting ECs to desirable locations. |
US11052175B2 |
Cartilage-derived implants and methods of making and using same
Cartilage fibers and implants made therefrom are disclosed, with and without cartilage particles. Methods for making the cartilage fibers and the implants containing them are also disclosed. The implants may be pre-shaped and may be reshapable and provide good shape retention and little swelling when placed into a cartilage defect. |
US11052173B2 |
Conductive biomaterial for enhancement of conduction in vitro and in vivo
The present disclosure relates to a biocompatible, electrically conductive polymer capable of carrying the electrical potential of a cardiac impulse. The present disclosure also relates to treatments using the electrically conductive polymer, such as for atrial fibrillation. |
US11052170B2 |
Temporary dressing for an internal wound
The invention relates to a device for treating blood flow in an internal wound, including a handling member connected to a series of successively narrower tubes, each tube including a liquid-expandable article. The tubes can be pivotably connected to each other, allowing the tubes to conform to the contours of the wound, or fixed together. The tubes can be encased in a liquid-soluble layer that keeps the liquid-expandable article sequestered from liquids.The stepwise-tapering profile of the device allows for its insertion into the internal wound with little or no resistance until fully seated. Upon encountering liquids within the wound, the liquid-soluble layer can dissolve to expose the liquid-expandable article. When exposed to the wound liquids, the liquid-expandable element can expand in volume, providing compressive pressure against internal wound surfaces and minimizing blood loss.The tubes and the liquid-expandable element can include therapeutic agents for treating the wound. |
US11052169B1 |
Systems, apparatus and methods for purifying air
Systems, apparatus and methods for disinfection of airflow. An apparatus for disinfecting air-conditioned airflow in a confined space includes: a modular housing; and a disinfection chamber enclosed within the housing. The disinfection chamber includes a plurality of disinfection sheets. Each disinfection sheet comprises a plurality of ultraviolet (UV) light sources. The airflow is configured to be routed along a serpentine pathway within the housing to expose microorganisms in the airflow to far UV-C light emitted by the UV light sources for an extended and optimal duration. |
US11052168B2 |
Air germicidal device
An air germicidal treatment device and system for removing or eliminating unwanted pathogens or bacteria in an airstream is shown. The device or system has a removable irradiation chamber that divides an interior area of the device into an air pre-chamber area, an air post-chamber area and an irradiation area therebetween. The removable irradiation chamber is generally trapezoidal in shape and has end walls that are inclined with respect to an interior divider wall. |
US11052167B1 |
Glass aroma diffuser
A glass aroma diffuser is provided, including a base, a water tank and a top cover. The bottom of the water tank is fixed on the base, the opening of the water tank is upward, and the bottom of the water tank is provided with an atomizer, and the water tank is configured to carry the liquid to be atomized; the top cover is provided with an exhaust nozzle for discharging mist. The top cover and the water tank of the aroma diffuser of the present disclosure are made of glass material, the atomizer is arranged under the water tank, and the exhaust nozzle is arranged on the top cover, which greatly reduces the use of plastic materials, thus reducing the plastic taste carried in the mist, reducing the probability of mist affecting human health, greatly improving the use experience, and making users feel more comfortable to use. |
US11052166B1 |
Frequency selective viral inactivation through bond breaking
An apparatus is provided for delivering IR and/or UV radiation, to an area or a surface in which virions, such as SARS-CoV-2 (the virus that causes the disease, COVID-19), may exist, wherein the IR radiation is intended to degrade the viral envelope of the virions and wherein the UV radiation is intended to break specific molecular bonds in order to degrade the RNA of the virion contained within a viral envelope. |
US11052165B2 |
Method for virus clearance
The invention discloses a method for virus clearance of a cell culture medium, comprising the steps of: i) providing a bulk medium portion, comprising amino acids and glucose, and a first additive portion, comprising vitamins in aqueous solution; ii) subjecting the bulk medium portion to a high temperature short time treatment (HTST); iii) passing the first additive portion through a virus retentive filter or an ultrafilter; and iv) after steps ii) and iii), mixing the bulk medium portion with the first additive portion to obtain a cell culture medium. |
US11052163B2 |
Homing agents
The present disclosure provides peptide constructs for diagnostic imaging and therapeutic applications, using pegylated peptides which exhibit specific binding for a target molecule of interest, such as a biomarker of a disease or disorder. |
US11052162B2 |
Liposomal gadolinium (GD) contrast agent “NMRX” for T1-MRI
The present invention is directed towards new chemical entities based on a lipid-paramagnetic metal ion chelate. The lipid portion of the compound intercalates into the membrane of a liposome. The compounds of the invention find particular use as paramagnetic contrast media for magnetic resonance imaging. It has been surprisingly discovered that the liposomal contrast media do not substantially cross the placental barrier into the vasculature of the fetus(es) when administered to a pregnant subject. These novel compounds are useful in the diagnosis of disorders and diseases in both gravid and non-gravid subjects. The invention is also directed towards pharmaceutical compositions comprising these compounds and the uses of these compounds. |
US11052158B2 |
Delivery of urea to cells of the macula and retina using liposome constructs
Provided are liposome constructs for delivery of urea to the vitreoretinal interface of the eye. The liposome constructs are agglomerates of small lamellar vesicles (SUVs) and have a greater density than the vitreal fluid, such that they sink to the back of the eye rather than dispersing throughout the vitreous. |
US11052148B2 |
Compositions and methods for generating an immune response to hepatitis B virus
The compositions and methods are described for generating an immune response to a hepatitis B virus. The compositions and methods described herein relate to a modified vaccinia Ankara (MVA) vector encoding one or more viral antigens for generating a protective immune response to a hepatitis B virus, in the subject to which the vector is administered. The compositions and methods of the present invention are useful both prophylactically and therapeutically and may be used to prevent and/or treat an infection caused by hepatitis B virus. |
US11052147B2 |
Stable virus-containing composition
Described herein are compositions and pharmaceutical compositions including poxviruses, in particular vaccinia virus such as modified vaccinia Ankara (MVA) virus, a sulfate salt at a concentration between about 5 mM and 300 mM and a buffer, wherein the composition has a pH of between about 6.0 and 8.5. Also described are methods for stabilizing a poxvirus composition by preparing said viral formulation. |
US11052142B2 |
Modified endotoxic bacteria lipopolysaccharide (variants), combination of modified lipopolysaccharides (variants) and, containing same, a vaccine (variants) and a pharmaceutical composition (variants)
For the first time individual (free from impurities of penta- and hexa-acetylated derivatives) di-, tri- and tetra-acetylated S-LPS of endotoxic bacteria and combinations thereof were obtained and their immunobiological, physical-chemical and chemical-pharmaceutical properties were studied.For the first time the principal possibility of their clinical application was directly demonstrated as vaccines and pharmaceutical compositions containing the modified S-LPS individual as monocomponent or combinations thereof as two and three component active substance, respectively.The modified S-LPS and combinations thereof have high safety profile and provide low pyrogenicity and high immunogenicity. Developed on their basis vaccines and pharmaceutical compositions demonstrate anti-shock activity, high efficiency and specificity, broad-spectrum action and also good chemical-pharmaceutical parameters. |
US11052140B2 |
Methods of treatment using conditional superagonist CTL ligands for the promotion of tumor-specific CTL responses
What is described is a method of treatment of a patient with a tumor, comprising administering a cell responsive to a peptide comprising a tumor epitope, wherein the tumor epitope comprises an amino acid substitution in a tumor antigen. The tumor antigen is preferably selected from the group consisting of NYESO-I157-165, NYESO-II157-170, or MART-126-35, preferably SEQ ID NOS: 1-351, 361-376, and 392-401. |
US11052135B2 |
Methods and compositions for treating hunter syndrome
The present invention provides, among other things, compositions and methods for CNS delivery of Idursulfase-beta, a human recombinant iduronate-2-sulfatase protein, for effective treatment of Hunter Syndrome. The compositions and methods provided by the present invention effectively reduce symptoms not only in brain and spinal cord but also in peripheral tissues including heart, liver, spleen, lung, and kidney. |
US11052133B2 |
Glucose responsive insulins
This disclosure provides a composition containing a conjugate with a modified insulin molecule. The conjugate has an insulin molecule, which can be insulin or an insulin analog, glucagon, GLP-1, GLP-2 or a GLP-1 agonist. The conjugate also contains one or more polymers. Each of the one or more polymers is covalently linked to the insulin molecule. Additionally, each of the one or more polymers is covalently linked to between 0 to 50 copies of a decoy ligand, and to between 0 to 50 copies of a glucose-binding agent, such that the combined total number of glucose-binding agents and decoy ligands covalently linked to each of the one or more polymers is at least 1. The conjugate can reversibly bind to soluble glucose and in which the extent of its glucose-binding controls the extent to which the modified insulin is able to bind to and activate the insulin receptor. Methods of making the conjugate, as well as use of the conjugate in treatment, are also provided. |
US11052131B2 |
Methods and pharmaceutical compositions for the treatment of kidney cancer
Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated. |
US11052129B2 |
Ornithodoros moubata complement inhibitor for use in the treatment of complement-mediated diseases in patients with C5 polymorphism
The present invention relates to methods of treating or preventing a complement-mediated disease and/or disorder in a subject with a complement C5 polymorphism, including administering to a subject in need thereof a therapeutically or prophylactically effective amount of an agent that a) inhibits the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibits eicosanoid activity. The invention also relates to methods of identifying patient populations with C5 polymorphisms that are treatable with specific agents that a) inhibit the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibit eicosanoid activity. |
US11052127B2 |
HSP for use in treatment for imiquimod related side effects
The invention relates to a healthcare product comprising (i) a component selected from the group of heat shock proteins from alfalfa and heat shock protein hydrolysates from alfalfa, the product further comprising imiquimod or a pharmaceutically acceptable salt or derivative thereof. Further, the invention relates to a healthcare product for use in the prophylactic or therapeutic treatment of a skin disorder. Further, the invention relates to HSP for use for use in preventing the occurrence of a negative-side effect of a treatment with imiquimod, or alleviating such side effect. |
US11052120B2 |
Method of committed differentiation of human induced pluripotent stem cells into Leydig cells and application of Leydig cells
The present application provides an in-vitro committed differentiation method for inducing human induced pluripotent stem cells (hiPSCs) into Leydig cells (LCs) by neural crest stem cells (NCSCs). The hiPS-derived LCs is verified by an animal model to have the capacity of regenerating senile or injured LCs, so that a new treatment for supplementing testosterone is provided for patients suffering from hypogonadism, particularly for patients suffering from late-onset hypogonadism (LOH). |
US11052115B2 |
Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
The present invention provides improved and/or shortened methods for expanding TILs and producing therapeutic populations of TILs, including novel methods for expanding TIL populations in a closed system that lead to improved efficacy, improved phenotype, and increased metabolic health of the TILs in a shorter time period, while allowing for reduced microbial contamination as well as decreased costs. Such TILs find use in therapeutic treatment regimens. |
US11052114B2 |
Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. |
US11052113B2 |
Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. |
US11052108B2 |
Amorphous calcium carbonate for treating a leukemia
The present invention provides compositions and methods of treating a leukemia, including chronic lymphocytic leukemia, wherein the method comprises administering a stabilized amorphous calcium carbonate to a person in need thereof. |
US11052107B2 |
Amorphous calcium carbonate stabilized with polyphosphates or bisphosphonates
The present invention provides solid compositions of amorphous calcium carbonate (ACC) and a polyphosphate, bisphosphonate or pharmaceutical salts thereof as a stabilizer. Said stabilizers stabilizes the ACC and prevent crystallization to crystalline calcium carbonate ((′( (″) for a long period of time, even in an aqueous suspension. The invention further provides pharmaceutical composition comprising the solid ACC compositions as well their use in treating of certain diseases and conditions. |
US11052105B2 |
Methods for treating hepatitis B infection
This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections. |
US11052104B2 |
Methods for treating hepatitis B infection
This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections. |
US11052099B2 |
Use of cimicifugae rhizoma triterpenoid saponin extract, actein, and deoxyactein
The present invention provides the use of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, or a composition formed by actein and deoxyactein in the preparation of a medicament or a functional health product for autoimmune diseases. The present invention also provides a pharmaceutical composition for autoimmune diseases and a pharmaceutical composition for inhibiting inflammatory cytokines. The invention provides new applications of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, etc., and widens the application field of medicines or functional health products for autoimmune diseases. The raw materials source is plenty, the cost is low, and it has a broad market application value. |
US11052098B2 |
Composition containing araloside for external application to skin
The present invention relates to a composition comprising an araloside-based compound and, more particularly, to a composition for external application to skin, the composition comprising, as an active component, an araloside-based compound, including araloside X, araloside V and araloside VII. Thus, the composition restores skin markers damaged by external environmental stress, such as harmful substances or fine dusts, and reduces the expression of skin inflammatory factors to help the recovery of damaged skin, thereby providing effects, such as anti-oxidation, skin trouble suppression, anti-inflammation, or skin barrier improvement. |
US11052096B2 |
Steroidal compositions
Provided herein are steroid containing compositions suitable for providing therapeutically effective amounts of at least one steroid to individuals. Also provided herein are compositions comprising testosterone and/or testosterone derivatives suitable for providing therapeutically effective and safe amounts of testosterone over periods of time. Further provided are methods of treating andro- and/or testosterone deficiency in individuals by administering to the individuals compositions described herein. |
US11052094B2 |
D2O stabilized pharmaceutical formulations
Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein. |
US11052093B2 |
Aryl-or heteroaryl-substituted benzene compounds
The present invention relates to aryl- or heteroaryl-substituted benzene compounds. The present invention also relates to pharmaceutical compositions containing these compounds and methods of treating cancer by administering these compounds and pharmaceutical compositions to subjects in need thereof. The present invention also relates to the use of such compounds for research or other non-therapeutic purposes. |
US11052092B2 |
N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating autoimmune diseases
The present invention provides e.g. N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating e.g. autoimmune diseases, autoimmune-related diseases, inflammatory diseases, metabolic diseases, fibrotic diseases or cholestatic diseases, such as e.g. arthitis and asthma. |
US11052091B2 |
BRK inhibitory compound
The present invention relates to a Brk inhibitory compound represented by general formula (I) (wherein, all symbols represent the same meanings as the symbols set forth in the specification), a salt thereof, an N-oxide thereof, a solvate thereof, or a prodrug of any of these. |
US11052090B2 |
Use of TREM-1 inhibitors for treatment, elimination and eradication of HIV-1 infection
Compounds, compositions, and methods of treatment and prevention of HIV, including HIV-1 and HIV-2, Dengue, and Chikungunya infection are disclosed. The compounds are TREM-1 inhibitors. Combinations of these TREM-1 inhibitors and additional antiretroviral compounds, such as NRTI, NNRTI, integrase inhibitors, entry inhibitors, protease inhibitors, JAK inhibitors, macrophage depleting agents, and the like, are also disclosed. In one embodiment, the combinations include a combination of adenine, cytosine, thymidine, and guanine nucleoside antiviral agents, optionally in further combination with at least one additional antiviral agent that works via a different mechanism than a nucleoside analog. This combination has the potential to eliminate the presence of HIV, Dengue, or Chikungunya virus in an infected patient. |
US11052089B2 |
Methods for inhibiting alpha-v beta-3 expression on cancer stem cells and inhibiting progression to a cancer stem cell phenotype
In alternative embodiments, provided are compositions and methods for treating, enhancing the drug sensitivity of, and preventing the formation of cancer stems cells, including preventing or slowing the development or generation of a beta-3 (β3)-expressing, or integrin β3 (ITG-B3)-expressing cancer or tumor cells. In alternative embodiments, provided are methods using histone acetyl transferase inhibitors and/or histone methyl transferase inhibitors to determine therapeutic values in cancer cells that induce an integrin β3 (ITGB3) polypeptide expression. In alternative embodiments, provided are kits, blister packages, lidded blisters or a blister card or packet, clamshells, trays or shrink wraps, comprising at least one compound, composition or formulation used to practice a method as provided herein, and at least one Growth Factor Inhibitor. |
US11052084B2 |
Pharmaceutical capsule compositions comprising lumateperone mono-tosylate
The present disclosure relates to pharmaceutical capsules comprising lumateperone, in free, or pharmaceutically acceptable salt form, optionally in combination with one or more additional therapeutic agents, processes for manufacture thereof and methods of use in the treatment or prophylaxis of disease. |
US11052077B2 |
Methods of treating lung cancer
The present disclosure provides for methods of treating a patient with a CYP3A4 substrate drug, wherein the patient is treated with posaconazole. In some embodiments, the patient stops posaconazole treatment, waits for at least 2 days, and then is treated with the CYP3A4 substrate drug as soon as it is safe to do so. In some embodiments, treatment with the CYP3A4 substrate drug is delayed for about 2-42 days after stopping posaconazole. In some embodiments, the patient is treated with a reduced dose of the CYP3A4 substrate drug for about 2-42 days. |
US11052075B2 |
Pharmaceutical compositions of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl) cyclopropanecarboxamido)-3-methylpyridin-2-yl) benzoic acid and administration thereof
A pharmaceutical composition comprising Compound 1, (3-(6-(1-(2,2-difluorobenzo [d][1,3]dioxol-5-yl) cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid), and at least one excipient selected from: a filler, a diluent, a disintegrant, a surfactant, a binder, a glidant and a lubricant, the composition being suitable for oral administration to a patient in need thereof to treat a CFTR mediated disease such as Cystic Fibrosis. Methods for treating a patient in need thereof include administering an oral pharmaceutical formulation of Compound 1 to the patient. |
US11052070B2 |
Riluzole prodrugs and their use
Pharmaceutical compositions of the invention include substituted riluzole prodrugs useful for the treatment of cancers including melanoma, breast cancer, brain cancer, and prostate cancer through the release of riluzole. Prodrugs of riluzole have enhanced stability to hepatic metabolism and are delivered into systemic circulation by oral administration, and then cleaved to release riluzole in the plasma via either an enzymatic or general biophysical release process. |
US11052065B2 |
Compositions and methods for treating cancer with a combination of programmed death receptor (PD-1) antibodies and a CXCR2 antagonist
The present invention relates to methods of treating a cell proliferation disorder (e.g., cancer) comprising administering: (a) a compound having the Formula (I), wherein R1 or R2 are as herein defined, or a pharmaceutically acceptable salt thereof; and (b) an anti-human PD-1 antibody or antigen binding fragment thereof to a human patient in need thereof. Also disclosed are therapeutic combinations and kits containing such agents for the treatment of cancers. |
US11052064B2 |
Compositions, methods and systems for the treatment of cutaneous disorders
Devices, systems, methods, and kits for treating cutaneous diseases, such as warts, with a cantharidin formulation are generally described. The cantharidin formulations, described herein, may have many advantages over traditional cantharidin formulations, including removal of highly volatile and corrosive solvents, improved safety, and improved compatibility with common plastics for ease of delivery. The devices, systems, methods, and kits can be used for the precise application of the cantharidin formulation for the treatment of cutaneous diseases and other topical indications. Treatment of cutaneous diseases with cantharidin, using the devices, systems, methods, and/or kits may have many advantages over traditional therapies, including high single application efficacy, lack of scaring, and a mild pain profile. |
US11052063B2 |
Methods of reducing RLP-C
In various embodiments, the present invention provides methods of treating and/or preventing cardiovascular-related disease and, in particular, a method of blood lipid therapy comprising administering to a subject in need thereof a pharmaceutical composition comprising eicosapentaenoic acid or a derivative thereof. |
US11052060B2 |
Compounds and methods for treating autoimmunity
Compounds and compositions useful in methods of treating, ameliorating, or inhibiting the development of autoimmune diseases or Celiac disease by modulating the binding of DQ8 MHC class II molecules to antigenic peptides or fragments of antigenic peptides. |
US11052057B2 |
Use of cysteamine and derivatives thereof to suppress tumor metastases
The present Disclosure is directed to methods for inhibiting or suppressing metastasis of a tumor in a mammalian subject using a cysteamine product, e.g., cysteamine or cystamine or a derivative thereof. Also described herein is a method for treating pancreatic cancer in a mammalian subject by administering a cysteamine product described herein. |
US11052053B2 |
Nanoparticle comprising a bio-resorbable polyester, a hydrophilic polymer and an acylated human lactoferrin-derived peptide
A nanoparticle includes a core. The core includes a bio-resorbable polyester and a hydrophilic polymer. The hydrophilic polymer is a portion of the bio-resorbable polyester or a separate polymer. An acylated human lactoferrin-derived peptide is coated onto the core. The acylated human lactoferrin-derived peptide is a peptide with the amino acid sequence SEQ ID NO. 1: KCFQWQRNMRKVRGPPVSCIKR or an amino acid sequence, which does not differ by more than 8 amino acid positions from the sequence SEQ ID NO: 1. The N-terminus of the human lactoferrin-derived peptide is acylated with a C16-monoacyl group. |
US11052051B2 |
Coating composition, drug-containing particle, solid preparation and method for preparing drug-containing particle
Provided are a drug-containing particle capable of suppressing dissolution of a drug in the oral cavity to suppress an unpleasant taste thereof and having excellent dissolution of the drug in the digestive tract after passing through the oral cavity; a method for preparing the drug-containing particle; a coating composition used for preparing the drug-containing particle; and a solid preparation having the drug-containing particle. More specifically, provided are a coating composition having 100 parts by weight of a cellulose-based enteric base and 50 parts by weight or less of a water-soluble cellulose ether; a drug-containing particle having a drug-containing core and a coat portion obtained by coating the core with the coating composition; a solid preparation having the drug-containing particle; and a method for preparing a drug-containing particle having a step of coating the drug-containing core with the coating composition. |
US11052048B2 |
Esomeprazole-containing complex capsule and preparation method therefor
Provided are a composite capsule and a method of preparing the composite capsule. The composite capsule includes a first dissolving part including a core, an inner coating layer on the core, and a first enteric coating layer on the inner coating layer, wherein core contains, as an active ingredient, esomeprazole or a pharmaceutically acceptable salt thereof. The composite capsule further includes a second dissolving part including a core, which contains, as an active ingredient, esomeprazole or a pharmaceutically acceptable salt thereof, an inner coating layer on the core, and a second enteric coating layer on the inner coating layer. |
US11052047B2 |
Oral tablet suitable for fast release of active pharmaceutical ingredients
The invention relates to an oral tablet suitable for fast release of active pharmaceutical ingredients comprising a population of particles, the population of particles comprising directly compressible (DC) and non-directly compressible (non-DC) sugar alcohol particles, the non-DC particles providing the tablet with a plurality of discrete non-DC areas, and the non-DC areas promoting fast release of active ingredients upon mastication of the tablet. |
US11052046B2 |
Method for preparing micro-particles by double emulsion technique
Methods for preparing micro-particles using a double emulsion technique combining a membrane and a micro-sieve are provided. Particularly the present invention relates to method for preparing micro-particles comprising: preparing a first phase comprising an active agent; preparing a second phase comprising a carrier and a solvent; passing the first phase and the second phase through a membrane to form a primary emulsion; passing the primary emulsion through a micro-sieve in a continuous phase to form a secondary emulsion; and removing the solvent to form the micro-particles. |
US11052040B1 |
Topical application and method of administration and absorption
The present invention relates to a composition for boosting immunity in a person comprising a plurality of minerals, a plurality of vitamins, activated charcoal, coffee beans, vitamin B complex and a carrier, wherein the carrier is an oil-based substance. The composition is an aggregation of the active agents/ingredients conventionally prepared. The present invention allows absorption of multiple active agents/ingredients in the body, consistently. The blend of vitamin and minerals get easily absorbed in the body of a patient without affecting the function of the liver. |
US11052034B2 |
Cosmetic for correcting bumps and dips
A subject of the present invention is to provide a cosmetic for unevenness correction which has an excellent effect of concealing wrinkles and pores and correcting skin unevenness and has good compatibility with a makeup cosmetic.The present inventors have found that the cosmetic for unevenness correction which conceals wrinkles and pores and has good compatibility with a makeup cosmetic at the time of application can be easily provided by using a polyacrylate water-absorbing polymer having a specific water absorption capacity, but not a water-soluble macromolecule having a thickening effect commonly used in cosmetics, and they thus have completed the present invention. That is, the present invention provides a cosmetic for unevenness correction comprising the polyacrylate water-absorbing polymer which has an excellent effect of concealing wrinkles and pores, and the polyacrylate water-absorbing polymer has an average swollen particle size of 10 to 150 μm, an average dry particle size of 10 to 50 μm and a water absorbency of 5 to 50 g/g. |
US11052031B2 |
Cleansing composition comprising a nonionic / cationic surfactant mixture
An aqueous cleansing composition comprising a cationic surfactant, a nonionic surfactant, and a thickener comprising an alkoxylated methyl glucose ether, wherein a weight ratio of cationic surfactant to nonionic surfactant is greater than 0.9:1. The combination of the cationionic:nonionic surfactant ratio with the alkoxylated methyl glucose ether thickener provides the composition with cold weather stability. Cold weather stability is observed when the composition remains transparent after cold storage. |
US11052028B2 |
Process for depigmenting keratin materials using thiopyridinone compounds
The invention relates to cosmetic processes and compositions for depigmenting, lightening and/or whitening keratin materials, in particular the skin, which comprises the application of a cosmetic composition comprising thiopyridinone compounds to keratin materials. |
US11052026B2 |
Multi-capsule containing pigment for cosmetic material or functional component, and method for producing same
The present invention relates to a method for producing a multi-capsule, the method including steps of: (a) preparing a coating solution by mixing purified water, titanium dioxide, mica, a hydrophobic polymer, cellulose gum, and sucrose; and (b) drying the coating solution prepared in step (a) while spraying the coating solution through a spray nozzle of a fluid bed dryer after introducing a spherical seed of a colorant component for a cosmetic; or a starch or sucrose spherical seed coated with a functional component into the fluid bed dryer, a multi-capsule produced by the method, and a cosmetic composition containing the multi-capsule as an active component. |
US11052025B2 |
Perfumes in the form of aqueous microemulsions
Disclosed is a microemulsion of oil-in-water type including, preferably consisting of, by weight relative to the total weight of microemulsion: •70% to 94% of water, •1% to 15% of at least one hydrophobic fragrancing substance, •4% to 20% of at least one preferably volatile solvo-surfactant, and •0.1% to 15%, preferably 1% to 13%, of at least one hydrotropic agent or at least one surfactant selected from anionic surfactants, cationic surfactants, amphoteric surfactants and non-ionic surfactants. The solvo-surfactant is selected from monoalkylated glycerol derivatives of following formula (I): wherein the “alkyl” group is a linear or branched alkyl group including from 1 to 8 carbon atoms, and R and R′ are each independently H or a linear or branched alkyl group including from 1 to 5 carbon atoms, with the proviso that R is different from R′, and mixtures thereof. |
US11052024B2 |
Feeding system for gastric tube patients
A feeding system for medical patients comprises a storage assembly, dispensing assembly, and extension set including, in part, a reservoir, a pump, a feeding tube, a check valve and an adapter. The reservoir is configured to hold at least one feeding of nutritional substance. The dispensing assembly is connected to the storage assembly and pumps the at least one feeding of nutritional substance from the reservoir to the feeding tube connected to an outlet of the pump. The check valve unit is connected to a second end of the feeding tube by means of a check valve connection point and is configured to allow the flow of nutritional substance in only one direction. The at least one feeding of nutritional substance is passed through the adapter unit connected to the check valve unit. |
US11052022B1 |
Reloadable antiseptic vial
Medical vials and bottles containing medications dispensable syringes and needles are interfaced to replaceable caps having alcohol infused wipes therein to sterilize the rubber hubs through which the needles will be inserted into the vials to draw out the medication therefrom. |
US11052021B2 |
Medicine container, method of assembling the container, and method of dispensing the medicine from the container
A child-resistant medication container assembly that includes a blister card including a plurality of compartments each configured to support a dosage of medication, and a puck including a body portion, a recess that defines a partition wall in the body portion, and a plurality of openings defined in the partition wall. Each opening corresponds to one of the plurality of compartments in the blister card. The assembly further includes a carton including a first wall opposite a second wall. An access opening is defined in the first wall and a plurality of perforations are defined in the second wall. The access opening is sized to provide access to the plurality of compartments, and each perforation corresponds to one of the plurality of compartments in the blister card. |
US11052016B2 |
Devices, systems and methods for reducing motion artifacts during imaging of a neonate
Generally, a system for soothing a baby during imaging by an imaging device is provided. The system can include: a capsule incubator for positioning the baby within the imaging device, the capsule incubator can include: a bottom portion having an inner surface, a bed positioned on top of the inner surface for positioning the baby thereon, and one or more members coupled to the bottom portion that are positioned in a first position to open the capsule incubator and a second position to close the capsule incubator; a vibrational device including a vibrational element that extends from outside of the capsule incubator into the capsule incubator and is coupled to the bed to cause the bed to vibrate with a predetermined vibrational frequency, thus causing the baby to vibrate with the predetermined vibrational frequency. |