| Document | Document Title |
|---|---|
| US10852071B2 |
Method of operating an energy recovery system
A method of operating an energy recovery system includes providing a flow of fresh air from an energy recovery ventilator through a supply port into a component of a heating and cooling system. Stale air is blown from the component through a return port into the energy recovery ventilator, the return port including a shield configured to at least partially prevent fresh air flowing from the supply port into the component from recirculating through the return port. |
| US10852064B2 |
Channel type induction furnace
A channel type induction furnace with a furnace floor that is inclined downwards from an operative rear of the furnace hearth towards an opposing operative front of the hearth, with a wall at the front comprising a bottom section and a top section, with the bottom section extending further into the hearth than the top section, and the bottom section terminating in an upper edge in abutment with the top section, with a down-passage to an induction heater, located proximate the front wall, having an inlet in the floor at a location proximate the base of the front wall and up passage(s) having an outlet in the floor at a location in abutment with the base of the bottom section and with the bottom section being provided with a vertical slot extending upwards above the or each up-passage through it and opening onto the upper edge of the bottom section. |
| US10852061B2 |
Apparatus and process for liquefying gases
A liquefier device which may be a retrofit to an air separation plant or utilized as part of a new design. The flow needed for the liquefier comes from an air separation plant running in a maxim oxygen state, in a stable mode. The three gas flows are low pressure oxygen, low pressure nitrogen, and higher pressure nitrogen. All of the flows are found on the side of the main heat exchanger with a temperature of about 37 degrees Fahrenheit. All of the gasses put into the liquefier come out as a subcooled liquid, for storage or return to the air separation plant. This new liquefier does not include a front end electrical compressor, and will take a self produced liquid nitrogen, pump it up to a runnable 420 psig pressure, and with the use of turbines, condensers, flash pots, and multi pass heat exchangers. The liquefier will make liquid from a planned amount of any pure gas oxygen or nitrogen an air separation plant can produce. |
| US10852051B2 |
Method of forming a heat switch
A method for forming a gas gap heat switch is provided comprising the following steps: (a) providing first and second conductors, and first and second connecting members, wherein the connecting members each have a thermal conductivity at least five times smaller than that of the conductors when at a temperature of 100K; (b) fusing the first conductor to the first connecting member and the second conductor to the second connecting member; (c) aligning the conductors such that the first and second conductors extend along a common major axis; (d) bringing proximal ends of the aligned conductors into contact with each other when said conductors are at a first temperature; and (e) joining the first connecting member to the second connecting member so as to form a chamber around at least the proximal ends of the conductors. |
| US10852043B2 |
DC varaiable speed compressor control method and control system
The present disclosure relates to the field of air conditioning technology. In particular, it involves a control method and control device based on a DC variable speed AC compressor. |
| US10852039B2 |
Directional solar panel assembly
A solar panel assembly (10) having a stand (30), a solar panel platform (20, 120) and one or more directional mechanisms (40; 404, 414) connecting the stand (30) with the solar panel platform. One or more optical elements (50; 161, 162) are provided at all or portions of the edges (24) of the platform around the solar panel directing the light under the platform (20, 120) or towards its underside (22), and then to the ground (31) under or near the solar panel assembly. One or more of the optical elements (161, 162) are mounted on an inner side of a profile (160). The profile (160) is connected via a web (164) to the solar panel platform (120) and the web is connected with a drive within the platform. The connection of the web extends the profile from the platform creating a passage (124) between the profile and the platform. |
| US10852038B2 |
Bonding jumper clip for solar panels
A bonding jumper clip for electrically and mechanically joining two or more solar panel frames has a jumper portion with a first and second clip portion on opposably disposed on the outer edges of the jumper portion. The clip is made of one piece of metal and the clip portions have teeth that are punched, deformed and bent to form a selected clip geometry with a plurality of inwardly pointing teeth that penetrate through a protected surface of the solar panel frames, such as an anodized aluminum coating in order to electrically connect the frames together when the edges of the frames are inserted therein. A single ground is provided that it then electrically connected through the conductive frames to commonly ground the entire installation. The length of the jumper portion is selected to match the size of the frames being installed. |
| US10852036B2 |
Heating and hot water supply apparatus
A distribution valve controls a distribution ratio of a heat transfer medium between a hot water supply path including a heat exchanger for hot water supply and a beating circulation path through which the heat transfer medium is supplied to a heating terminal. A bypass flow rate control valve controls a bypass ratio which is a ratio of a flow rate of low temperature water introduced into a bypass pipe that bypasses the heat exchanger for hot water supply to a flow rate of low temperature water introduced into a water inlet pipe. The bypass ratio is regulated so that a hot water temperature detected by a temperature sensor reaches a hot water target temperature. During a simultaneous operation of hot water supply and heating, the distribution valve is controlled so that, when a bypass ratio is low, a distribution ratio is higher than when a bypass ratio is high. |
| US10852035B2 |
Heat exchange system with siphon for draining a condensate
A heat exchange system includes a heat exchange main unit having a gas channel and a fluid channel configured such that a fluid in the fluid channel can exchange heat with a flue gas in the gas channel, a housing, a drain collecting part arranged to collect condensate from the flue gas, and a siphon detachably attached to the drain collecting part to prevent release of the flue gas from a condensate outlet formed in the siphon. The siphon has a tubular body, a condensate inlet formed on one end side, and the condensate outlet formed on an other end side. The tubular body has an attaching part to detachably attach the tubular body to the drain collecting part through a hole formed within a wall of the housing, and a grip located outside the housing when the tubular body is attached to the drain collecting part. |
| US10852033B2 |
Hot water tank insulation system and method with flexible insulation top
An insulation system for a water heater storage tank containing water heated to a temperature higher than ambient is provided. The water heater tank has a substantially cylindrical shape and a generally circular top portion from which one or more pipes extend. A top insulation structure having two half-moon shaped insulation segments lies on the top portion insulating most of it against heat loss to the ambient environment. The insulation segments each comprise an envelope of pliable heat-resistant sheet material enclosing shapeable insulating filler material of particles. The envelopes are deformable to conformingly fit between and around pipes projecting up from the top of the water heater. An insulating jacket extends around and covers a substantial portion of a radially outwardly disposed surface of the water heater tank. |
| US10852032B2 |
Heat exchanger
A heat exchanger includes front and back walls forming a flue gas space such that a fluid flowing through a channel formed in the front and back walls can exchange heat with flue gas in the flue gas space, in use. The front wall includes a lower portion extending along the back wall, and an upper portion extending upwardly from an upper end of the lower portion and outwardly away from the back wall to form a combustion space of a flammable gas between the upper portion and the back wall. A length of the upper portion along a longitudinal direction thereof is longer than a length of the lower portion along a longitudinal direction thereof. |
| US10852028B2 |
Heat exchanger block and heat recovery ventilation unit comprising it
The invention relates to a heat exchanger block 2 and to a heat recovery ventilation unit 1 comprising such a heat exchanger block. In the heat exchanger block 2, the individual flow cross-section (Q1) of flow passages of said plurality of first air flow passages (AFP1) in said parallel flow region (PF) and the individual flow cross-section (Q2) of flow passages of said plurality of second air flow passages (AFP2) in said parallel flow region (PF) gradually, preferably linearly, decrease along a straight line (x-x) perpendicular to the parallel air flow passages (AFP1 and AFP2) and from said first wall (W1) to said second wall (W2) of the block. |
| US10852026B2 |
Controller, method and computer program product for controlling an environmental condition in a building
The present environmental condition controller and method provide for controlling an environmental condition in an area of a building. For doing so, a communication interface receives an environmental condition target value (xref), and an environmental condition measured value (x). A processing unit calculates an environmental condition adjustment value (yn) with a recursive function based on the environmental condition measured value (x), the environmental condition target value (xref) and an adaptive proportionality value (k). The processing unit also generates and transmits a command based on the environmental condition adjustment value (yn). The processing unit further stores in a memory the environmental condition adjustment value (yn) as a previously calculated environmental condition adjustment value (yn−1). Specific steps of the method are executed recursively. The present method may further be performed by a computer program product. |
| US10852017B2 |
Air umbrella device
Disclosed is an air umbrella apparatus including an air suction pipe having an air suction hole in an upper end thereof, a water collection pipe disposed concentrically with the air suction pipe and having an upper end coupled to a water-collection-inducing pipe for guiding rain or snow downward, an exhaust pipe disposed concentrically with the water collection pipe and having an upper end coupled to an exhaust-guiding pipe for guiding air outward, a communication pipe coupled to the air suction pipe, the water collection pipe, and the exhaust pipe for communicating the air suction pipe with the exhaust pipe, and a blower disposed between the exhaust pipe and the water collection pipe for the introduction and exhaust of air. The exhausted air forms an air curtain having a predetermined area above the exhaust-guiding pipe, thereby preventing rain and snow from falling from the exhaust-guiding pipe. |
| US10852008B2 |
Water heater with mix tank fluid time delay for causal feedforward control of hot water temperature
A water heater includes a heat exchanger. A controllable three-way proportional valve provides a proportionally controllable flow to the hot water inlet of the heat exchanger and a boiler return water outlet. A mixing tank mixes a cold water and a hot water. The mixing tank provides a time delayed mixed water. A temperature sensor is disposed in or on the mixing tank to measure a temperature of the time delayed mixed water to provide a time delayed mixed water temperature. A feedforward control process running on a processor adjusts a proportional operating position of the controllable three-way proportional valve to regulate a temperature of hot water at the hx domestic hot water outlet based on the temperature of the time delayed mixed water temperature. A method for controlling a hot water temperature of a water heater a water heater using a flowmeter based feedforward control are also described. |
| US10852007B2 |
Heat pump device
A heat pump device can discharge air in a heat medium circuit regardless of the height positions of two bodies of the heat pump device and prevents refrigerant outflow when the refrigerant enters the heat medium circuit in the liquid heat exchanger. A pump causes the liquid heat medium to flow in a predetermined circulatory direction in a heat medium pipe, and a liquid heat exchanger, a first air vent valve and a second air vent valve are arranged in this order along a circulatory direction. |
| US10852005B2 |
Method and household appliance for controlling humidity
Household appliance (1) for cooking and/or baking food stuffs or bakery ware (2) comprising a heatable cavity (3) for placing the food stuffs or bakery ware (2), an access door (4) for accessing the cavity (3), a compartment (5) located exterior of said cavity (3), said compartment being in fluid communication with said cavity (3) by at least one duct (6), a control unit (10), at least one first sensor (8) located in the compartment (5) and being connected to the control unit (10), and wherein the at least one first sensor (8) is capable of measuring a first input value in said compartment (5), and at least one second sensor (9) capable of measuring a second input value, wherein said second input value is a temperature value wherein said control unit comprises a matrix of humidity index values, said matrix being deposited in said control unit (10), and wherein said control unit (10) is capable of correlating said input value of said at least one first sensor (8) to a humidity index value from said matrix. |
| US10851997B2 |
Combustor device for a gas turbine engine and gas turbine engine incorporating said combustor device
A combustor device for a gas turbines engines includes first and a second tubular members telescopically fitted in axially sliding manner to one another with interposition of annular centering and sealing which include at least a centering annular shoulder and a sealing ring arranged coaxial to one another. The sealing ring is axially spaced apart from the centering annular shoulder so that an axial distance between the centering annular shoulder and the sealing ring is greater than a maximum axial movement allowed between the first and said second tubular members. |
| US10851995B2 |
Hygienic birthday cake candle extinguisher
A candle blowing device for assisting a person in generating a strong airflow stream while also providing a filter to minimize the spread of germs emanating from the mouth of the person during blowing. The blowing device includes a plurality of body sections forming a mouthpiece, a hollow body, a nozzle, filter media and a shelf configured on one of the plurality of body sections between the mouthpiece and the nozzle for securing the filter media. |
| US10851994B2 |
Electronic cigar lighter
An electric cigar lighter for lighting a cigar having an electrical power supply with positive and negative terminals attachable to a tubular body, the battery disposed in the body, and a resistor plate connected to the electrical power supply, the resistor plate defining a plurality of parallel circuits connected in series with one another. |
| US10851993B2 |
Gas valve with overpressure diagnostics
This disclosure relates generally to valves, and more particularly, to gas valve assemblies. In one example, a gas valve assembly may include a valve body with one or more valves movable between an opened position and a closed position, one or more valve actuators configured to operate the valves, and one or more pressure sensors to sense a pressure within a fluid path of the valve assembly. A valve controller may receive a measure related to a sensed pressure from the one or more pressure sensor(s). The valve controller may compare the received measure related to the sensed pressure to an overpressure threshold. In the event the measure related to the sensed pressure surpasses the overpressure threshold value, the valve controller may be configured to provide a signal that indicates an overpressure event has occurred. |
| US10851989B2 |
Cooker and steam generator
A cooker includes a steam generator that supplies steam into a cooking chamber of the cooker. The steam generator includes a heating chamber having a heating space; a steam discharge port through which steam in the heating space is discharged; a residual water discharge port through which steam water in the heating space is discharged; a heater that heats the heating space; and a residual water discharge pipe connected with the residual water discharge port and that selectively discharges steam water from the heating space to an outside. A first end of the residual water discharge pipe is connected with the residual water discharge port, a second end of the residual water discharge pipe is arranged lower than the residual water discharge port, and a portion of the residual water discharge pipe between the first and second ends is arranged higher than the residual water discharge port. |
| US10851988B2 |
Integrated lighting and power for cabinetry
An integrated lighting and power system for cabinetry includes a controller, a power lead connectable to the controller, and a powered light strip coupled to the power lead. The powered light strip has multiple channels. A plurality of light strip segments is connected to one another forming the powered light strip. Each light strip segment has one or more illumination elements. The controller is connected or connectable to a power source. The one or more illumination elements of a first segment of the plurality of light strip segments is connected to a first channel of the multiple channels and the one or more illumination elements of a second segment of the plurality of light strip segments is connected to a second channel of the multiple channels. The first and second channel and the first and second segments of the plurality of light strip segments are independently controllable via the controller. |
| US10851986B2 |
Waterproof lamp
A waterproof lamp includes a housing having an inner cavity for receiving a lamp body, and at least one end forming a wiring opening for drawing out wiring; a wiring end cover is sealed on the wiring opening and can be threaded out; a first sealing member is formed between the wiring end cover and the interior surface of the housing and engages with the wiring end cover for the wire to pass through; the wiring end cover includes a fixed cover and a movable cover, the movable cover is detachably coupled to the outer side of the fixed cover; and a second sealing member is disposed between the movable cover and the fixed cover. The first sealing member of the waterproof lamp is filled with liquid and can be solidified to form a waterproof rubber layer sealed between the first sealing member and the inner wall of the housing. |
| US10851985B2 |
LED module and LED lighting device comprising same
An LED module that includes a light source unit which includes one or more LEDs mounted on one surface of a circuit board, a heat sink which includes a base substrate configured to support the light source unit and radiate heat generated from the light source unit and an insulating heat radiation coating layer applied on an outer surface of the base substrate, a protective cover which includes a convex portion formed in a region corresponding to the LED and is coupled to one surface of the heat sink to protect the light source unit from an external environment, an air flow space formed between the light source unit and the protective cover and provides a space through which air can flows, and one or more air vents which perform a function as a passage through which the air is moved to the outside from the air flow space and balance internal pressure of the air flow space with pressure of outside air. |
| US10851981B1 |
Cordless LED headlight and control thereof
A wireless headlight assembly for attachment to an eyewear frame is disclosed. The wireless headlight assembly comprises a battery pod containing a battery connected to an electronic circuit element, which controls the application of power from the battery to an attached headlight assembly containing a headlight, wherein control of the application of power to the headlight assembly is determined, in part, based on the stability of the headlight assembly. |
| US10851978B1 |
Christmas tree illumination assembly
A Christmas tree illumination assembly includes a tube that is comprised of a flexible material. The tube has a green color for concealing the tube in a Christmas tree. A light emitter is coupled to the tube to emit light outwardly from the tube for illuminating an ornament that is positioned on the top of the Christmas tree. A power cord is coupled to and extends away from the tube. The power cord has a green color for concealing the power cord in the Christmas tree. A clamp is coupled to the power cord. The clamp is biased into a closed position to engage the Christmas tree for retaining the tube at a selected position in the Christmas tree. |
| US10851976B2 |
Site light
A site light includes a body, an arm coupled to the body having an adjustable arm length, a light assembly coupled to the arm opposite the body, and a drive mechanism with a crank arm rotatable about a first axis. Rotating the crank arm in a first direction causes the arm length to increase. Rotating the crank arm in a second direction causes the arm length to decrease. The drive mechanism is adjustable between a first configuration, where the crank arm can only rotate in the first direction, and a second configuration, where the crank arm can be rotated in the first direction and the second direction. |
| US10851970B2 |
Casing, electronic device, and method of fabricating casing
A method of fabricating a casing including steps of providing a polycarbonate substrate, printing a first material on the polycarbonate substrate to form a light shielding layer by using a first screen, and printing a second material on the light shielding layer to form a light transmission layer by using a second screen is provided. The light shielding layer has at least one patterned transmissive region. The light transmission layer covers the at least one patterned transmissive region and a portion of polycarbonate substrate exposed by the at least one patterned transmissive region. Mesh counts of the first screen is greater than that of the second screen. A casing including a polycarbonate substrate, a light shielding layer, and a light transmission layer is provided. A thickness of the light transmission layer is greater than a thickness of the light shielding layer. An electronic device adopting the casing is provided. |
| US10851969B2 |
Reflector and lighting apparatus
The present disclosure provides a reflector and a lighting apparatus, which belongs to a field of lighting technology. The reflector is provided with a mounting table and a reflecting chamber, the mounting table is connected with a periphery of a light incident port of the reflecting chamber and extends outwards along a radial direction of the reflecting chamber, and the mounting table is provided with a lens connecting portion and a light source connecting portion for implementing positioning or connection of a light source module and a lens, so that in the assembling process, the light source module and the lens can be mounted on a housing together with the reflector without being mounted in an accommodating chamber of the housing one by one. |
| US10851962B2 |
Backlit 3D lamp
A backlit three-dimensional lamp for a vehicle includes an indicia rendering disposed on a transparent lenticular sheet, an outer lens positioned in front of the transparent lenticular sheet, and a light source positioned behind the transparent lenticular sheet. The light source provides backlighting of the indicia rendering such that the lenticular sheet projects a forward image that hovers beyond the outer lens. A vehicle light assembly includes a light source adapted to produce a substantially homogeneous light, a rendering of indicia located adjacent the light source and facing away from the light source such that the rendering of indicia is backlit by the light source, and an array of light-modifying elements aligned with the light source to at least partially cover the rendering of indicia for creating a projection of the rendering of indicia outside the vehicle light assembly. |
| US10851961B2 |
Optoelectronic module having an OLED and method for producing an optoelectronic module
The invention relates to an optoelectronic module, comprising a housing (11) having a first housing part (11) having a first cover surface (11a) and an opening (4); a mechanically flexibly designed organic light source (2) having an illuminating surface (2a); and a cover element (3) which is mounted on the illuminating surface (2a) and has a light-transmissive surface (3a) facing away from the illuminating surface (2a), wherein the organic light source (2) is introduced at least at some points into the opening (14), the first cover surface (11a) is curved and/or bowed, the size of the illuminating surface (2a) is at least 1 cm2, preferably at least 5 cm2, and the distance between the illuminating surface (2a) and the first cover surface (11a) is at most 1 cm, preferably at most 5 mm. |
| US10851958B2 |
Motor vehicle lighting module, and lighting and/or signalling device provided with such a module
The invention concerns a lighting module for motor vehicles, including at least one first row of first illumination units configured to produce a first exit beam, each first illumination unit including a first light source and a first optical element configured to produce a first unitary beam from light rays coming from the first light source, characterized in that the first optical element of each of the first illumination units is configured to produce: a first total internal reflection of the rays coming from the first light source so as to form a reflected beam of collimated rays; a second total internal reflection of the collimated rays so as to generate the first unitary beam. |
| US10851957B2 |
Headlight module and headlight device
A headlight module includes a light source, a light distribution control element and a projection optical element. The light source emits light. The light distribution control element forms a light distribution pattern by changing a divergence angle of the light incident therein. The projection optical element projects the light distribution pattern. The light distribution control element includes a first light distribution formation part configured to form a high luminosity region in the light distribution pattern and a second light distribution formation part configured to form a low luminosity region in the light distribution pattern. The low luminosity region is lower in luminosity than the high luminosity region. |
| US10851955B2 |
Wall pack light fixtures
A wall pack light fixture including a front cover having a recess with a contact surface and at least one electronic component mounted on the contact surface, a rear enclosure having a forward-facing open front with a forward-facing front edge, and a hinge having a first portion connected to the front cover and a second portion pivotably coupled to the first portion, the second portion connected to the rear enclosure on an exterior side surface of the rear enclosure behind the forward-facing front edge, wherein the front cover is rotatable about the hinge between a closed configuration, in which the contact surface is against the forward-facing front edge, and an open configuration. |
| US10851952B2 |
Reflective ink lighting assembly
A reflective-ink lighting assembly includes a light transferring medium, a reflective-ink marking in the light transferring medium, and a light source adapted to insert light into the light transferring medium. In a lit state, light from the light source propagates through the light transferring medium by total-internal reflection. As propagated light reflects off the reflective-ink marking, some light exits through a façade of the light transferring medium to produce an illuminated marking. In an unlit state, the reflective-ink marking remains visible due to ambient light reflecting off the reflective-ink marking. |
| US10851951B2 |
LED tube lamp
An LED tube lamp comprises a lamp tube, two light boards disposed in the lamp tube having a plurality of light sources mounted thereon, two lamp caps respectively disposed at both ends of the lamp tube and having a power supply disposed in the lamp caps, and a support unit. The power supply comprises a circuit board. The support unit is configured to fix the light board and comprises a main body and a support arm. The support arm is disposed on the main body and abutted to the inner surface of the lamp tube, so that the support unit can support the inner surface of the lamp tube. |
| US10851944B2 |
CNG fueling system
A compressed natural gas (CNG) fueling system has a single compressor comprising a first compression stage and a subsequent compression stage, wherein the first compression stage feeds the subsequent compression stage when filling a storage tank, the storage tank is configured to receive CNG from at least one of the first compression stage and the subsequent compression stage of the compressor when filling the storage tank, a CNG feedback to the subsequent compression stage of the compressor from the storage tank, the CNG being introduced back into the compressor at a location downstream relative to an output of the first compression stage, and a first heat exchanger associated with the CNG feedback. |
| US10851942B1 |
Vibratory system lubrication remaining useful life
A work machine includes a compactor drum, a controller, and an output device. The compactor drum includes a vibratory system, which includes at least one bearing that supports rotation of the vibratory system within the compactor drum, and lubricant received by the at least one bearing. The controller is configured to monitor at least one physical property of the vibratory system over a specified time and project a remaining useful life of the lubricant based on the at least one physical property. The output device is configured to generate an output indicative of the remaining useful life. |
| US10851938B2 |
Adjustable support arm
An adjustable support arm capable of providing users with a wide range of height, depth, tilt, and swivel options. The adjustable support arm may comprise an arm assembly releasably mounted to a base assembly. In further embodiments, the adjustable support arm may also comprise an articulating joint connected to the arm assembly, and an accessory bracket assembly connected to the articulating joint. A quick-release joint comprising a spring-loaded pivot latch may be utilized to releasably connect the arm assembly to the base assembly. To dampen side-to-side movement of the arm assembly, the adjustable support arm may also comprise a friction cartridge assembly comprising a taper-lock bushing and one or more set screws. A ring-shaped, adjustable panning insert can be coupled to the arm assembly to restrict the range of side-to-side motion of the support arm. The adjustable arm can further comprise a quick-release accessory fastening mechanism for easy removal and attachment of a mounted object (e.g., an electronic display, keyboard, or other item) to the support arm. |
| US10851936B1 |
Camera mount plate and module access slide for poles used for roadside electronic systems
A system comprises a pole, a conduit track, and a sliding assembly that slides along the conduit track. The pole is configured to support an optical system that includes a camera or antenna. The sliding assembly and conduit track are disposed within an interior of the pole. The sliding assembly supports electrical components used in operation of the optical system, such as power components, storage devices, and communication modules. Cables extend from the optical system, through the conduit track, and to the electrical components supported by the sliding assembly. An access opening along the pole provides an operator easy access to the electrical components. Moreover, all of the electrical components and cables are disposed within the pole and protected from outside elements. The system allows electronic systems power and optics to be deployed in a cost effective, efficient and secure manner in locations alongside roads and other access ways. |
| US10851934B2 |
Mobile pump house
A pump support assembly includes a skid having a top surface and a bottom surface configured to movably rest on the ground; and a frame for supporting a pump, the frame having a main body, and two wings extending from opposite sides of the main body substantially perpendicular to the main body, the frame supported on the top surface of the skid and connected to the skid at an end of one of the wings to isolate a pump support surface of the frame from deformations of the skid. |
| US10851932B2 |
Connection unit
A connection unit having a connector and at least one fluid line that is connected to the connector, wherein the connector has at least two connection ends and a connector section that connects the connection ends to one another. A fluid line end of a fluid line engages with at least one connection end of the connector. At least one compensation element is connected to the fluid line in the area of the fluid line end of the fluid line, the compensation element being supportable on at least one support stop via at least one spring element. Due to a pressure increase in the connector section, the compensation element is movable against the restoring force of the spring element in the direction of the support stop, with an increase in the internal volume of the connector section. |
| US10851929B2 |
Fluid coupling
The invention relates to a fluid coupling having coupling elements, each coupling element respectively having: a body, a main valve, movable to open and close a main passage through the body, a safety valve, movable to open and close a secondary passage through the main valve, and a plunger for moving the safety valve. To reduce leaks and reduce the pairing force, the fluid coupling is configured so that, during a pairing of the coupling elements, a sealing gasket cooperates with the body before the safety valves of the two coupling elements are moved toward their open position, and at least one of the plungers pushes its main valve back toward its open position, once the associated safety valve is in the open position. |
| US10851922B2 |
Adjustable collar
An adjustable collar for inserting a pipe therein, in particular for positioning and securing a pipe to an apparatus. The adjustable collar accepts pipes of any diameter within a pre-determined range instead of only accepting pipes of certain standard diameters. Furthermore, pipes can be secured into the adjustable collar according to the invention without the need for hand tools, adapters, or other accessories. |
| US10851920B2 |
Pipe connection
A pipe connection (101a, 101b) for providing a connection to a pipe, the pipe connection comprising: a sleeve (103) which receives a pipe and has a seat (109); a first sealing or gripping element (111) which is disposed adjacent the seat; an intermediate member (115) which is disposed adjacent the first sealing or gripping element; a second sealing or gripping element (123) which is disposed adjacent the intermediate member; an end member (131) which is disposed adjacent the second sealing or gripping element; at least one fixing (159) which engages the end member and is configured to displace the same axially inwardly relative to the sleeve on torquing; and at least one support (151, 153) which is disposed between one of the sleeve (103) and the intermediate member (115) or the intermediate member (115) and the end member (131), wherein the at least one support is configured to maintain the sleeve and the intermediate member or the intermediate member and the end member with a predetermined spaced relation until application of a torquing force between the sleeve and the intermediate member or the intermediate member and the end member which exceeds a predetermined threshold, whereby the end member is displaced relative to the intermediate member to displace the second sealing or gripping element ahead of displacement of the intermediate member relative to the sleeve to displace the first sealing or gripping element or the intermediate member is displaced relative to the sleeve to displace the first sealing or gripping element ahead of displacement of the end member relative to the intermediate member to displace the second sealing or gripping element. |
| US10851917B2 |
Seismic clamp for non-structural components in a building
A seismic clamp for securing a utility pipe to a rigid rod includes a pipe holder that secures the utility pipe to the seismic clamp. A rod fitting secures the rigid rod to the seismic clamp so that the rigid rod extends transverse to the utility pipe. A spacer is disposed between the holder and the rod fitting. The spacer inhibits the rigid rod from contacting the utility pipe when the utility pipe is secured to the seismic clamp, and the rigid rod is secured to the seismic clamp. |
| US10851913B2 |
Systems and methods for a plug head assembly
A plug head assembly having a ceramic plug head having an annular retention groove, wherein the ceramic plug head has a proximal terminus and a distal terminus, a first clamp portion having a first annular retention protrusion conforming to the annular retention groove, a second clamp portion having a second annular retention protrusion conforming to the annular retention groove, and an annular retention sleeve conforming to the annular retention groove, the annular retention sleeve disposed between the annular retention groove and at least one of the first clamp portion and the second clamp portion. |
| US10851912B2 |
Detecting inadequate valve seat integrity of a control valve
A method is detect inadequate valve seat integrity in a control element of a control valve is proposed, wherein during a calibration time interval the position of the control element of the control valve in the closed position are repeatedly measured and recorded. Measuring of the position in the closed position continues during operation, and a moving average value is determined over a specified number of values. A threshold is determined from the calibration data set and the specified number. If the moving average deviates from the average of the calibration data by more than this threshold, a message is output. In particular, no additional sensors or scanning devices are required and a sensible compromise between early fault detection and avoidance of false diagnoses is achieved. |
| US10851904B2 |
Check valve
Disclosed herein is a check valve. The check valve includes a valve housing having upper and lower ends opened and having an inlet formed along the circumference of the valve housing, the inlet linked to a inlet fluid path, an upper cap coupled to seal up an open upper portion of the valve housing, a lower holder coupled to an open lower portion of the valve housing, having an outlet formed along the circumference of the lower holder, the outlet linked to a outlet fluid path, and having a guide hole in the lower portion of the lower holder, and a plunger installed to move up or down to selectively open or close an orifice while elastically supported by an elastic member supported by the lower holder, wherein the plunger comprises guides at upper and lower ends of the plunger to guide the plunger to make stable linear motion. |
| US10851901B2 |
Stream switching valve with synchronizing mechanism
A stream switching valve for alternatively feeding two fluids to an object of interest comprises a housing having first, second and third cavities, first, second and third ball members sealably placeable into said first, second and third cavities, first and second inlet passages being in fluid communication with said first and second cavities, an outlet passage being in fluid communication with said third cavity; said outlet passage connectable to an object of interest; first and second intermediate passages fluidly connecting said first and second cavities to said third cavity, first, second and third vent passages fluidly connecting said into first, second and third cavities to environment. The first and second ball members are configured to connect said first and second intermediate passages to first and second inlet passages and first and second vent passages, respectively, in turn. The third ball member is rotatable and configured to connect said outlet passage to said first intermediate passage, said second intermediate passage and said third vent passage, in turn. |
| US10851897B2 |
Joint seal system with winged barrier
An integral multilayer joint seal. Layers of foam, layered co-planar to the adjacent surface, are interspersed with a barrier layer which extends beyond the foam layers to provide a protective surface, a surface for attachment atop adjacent substrates, or a connecting tab for use with adjacent joint seals. The foam layers may be uncompressed or partially compressed at the time of joint formation and may be composed of open or closed, or hybrid, cell foam. The foam may be impregnated with a fire retardant or may be composed of a fire retardant material, if desired. The barrier may have a tensile strength greater than the adjacent foam. The joint seal may have an elastomer, such as silicone, at its top and/or bottom, and may even include an elastomer layer within or about the barrier. |
| US10851894B2 |
Compressor assembly for a compressed-air feed of a compressed-air supply system
A compressor assembly for a compressed-air feed of a compressed-air supply system for operating a pneumatic system includes a compressor having a con-rod, a con-rod bearing, and a cylinder. The con-rod has a compressor piston. The compressor assembly further includes a drive having a drive shaft and a drive housing. The drive shaft is mounted in a drive bearing that is disposed within the drive housing. The drive bearing and the con-rod bearing partially or completely overlap one another in the axial direction, or the axial central plane of the drive bearing and the axial central plane of the con-rod bearing lie in one bearing plane. A crank disk is fixedly connected to an end portion of the drive shaft, the crank disk having a con-rod receptacle portion that is disposed so as to be eccentric to the drive shaft, the crank disk being rotatably connected to the con-rod. |
| US10851893B2 |
Piston arrangement
A piston arrangement comprises a circumferential piston groove that can accommodate a seal for sealing between the piston and the cylinder bore when the piston moves in a reciprocal movement. The piston arrangement comprises a first fluid flow passage, defined at least in part by the piston body that fluidly connects the forward side of the cylinder bore with a space within the piston groove underneath the seal and a second fluid flow passage, defined in part by the piston body, which fluidly connects the rear side of the cylinder bore with the space within the piston groove underneath the seal. The two fluid flow passages allow a controlled fluid flow around the piston seal and comprise a channel provided in a lateral wall of the piston groove or an orifice provided in the piston body. |
| US10851887B2 |
Pulley propulsion device of automatic transmission and control device for automatic transmission
A pulley propulsion device for an automatic transmission, which includes a fixed pulley, and a movable pulley constituted capable of relative displacement along a rotation axis of a pulley with respect to the fixed pulley, is provided. The pulley propulsion device includes a movable member constituted capable of relative rotation around a rotation axis of the pulley with respect to the movable pulley, a fixed member whose rotation with respect to a pulley case is regulated and adapted to give linear displacement to the movable member along the rotation axis of the pulley on the basis of rotation thereof, a driving mechanism having an electric motor and adapted to cause an output torque of the electric motor to be transmitted to the movable member and to cause the movable pulley to generate a predetermined pulley thrust, and a load sensor adapted to detect a load applied on the fixed member. |
| US10851885B2 |
Planetary transmission
A planetary transmission, comprising a housing, a drive part, an output part having an output shaft that is rotatable about an output axis of rotation, and at least one gear stage between the drive part and the output part. The drive part, the at least one gear stage, and the output part are mounted in the housing, the housing has an output flange on the output side, wherein the output flange has a first lateral surface with circularly symmetrical in radial planes about an axis of symmetry, wherein the first lateral surface is arranged eccentrically with respect to the output axis of rotation. |
| US10851884B2 |
Super charger components
A pulley assembly having a body, a shaft mount and a plurality of bolts is disclosed. The body is aligned to the shaft mount by providing a tight tolerance between a shoulder portion of the bolt and a neck portion of a counter sunk hole formed in the body. Additionally, an outer surface of the body may have a pattern of friction lines or patches formed by fusing particulate matter to the outer surface with heat generated by a laser beam. |
| US10851883B2 |
Method for shifting an automatic transmission
A method for shifting an automatic transmission, including a drive region, a hydrodynamic converter, an output region, and exactly one planetary gear that acts in a first operating state and a second operating state. In order to shift to different gears of the automatic transmission, different transmission ratios are set in the strictly mechanical power branch by disengaging and engaging clutches and/or brakes in the drive region. The planetary gear set in the output region in the case of at least two different transmission ratios in the strictly mechanical power branch, the rotational movement transmitted by the strictly mechanical power branch is stepped up, in order to always set additional gears. |
| US10851881B2 |
Four-speed transaxle for electric vehicle
A four-speed transaxle for an electric vehicle comprises four planetary gear sets that is operatively connected to an electric motor, four electric caliper brake systems and one stage gears. The four-speed transaxle produces its first speed ratio when a first and third electric caliper brake systems are disengaged and a second and fourth electric caliper brake systems are engaged. Second speed ratio results when the first and fourth electric caliper brake systems are engaged and the second and third electric caliper brake systems are disengaged. Third speed ratio results when the second and third electric caliper brake systems are engaged and the first and fourth electric caliper brake systems are disengaged. Fourth speed ratio is produced when the first and third electric caliper brake systems are engaged and the second and fourth electric caliper brake systems are disengaged. |
| US10851877B2 |
Power delivery devices for reciprocating engines, pumps, and compressors, and related systems and methods
In some aspects, reciprocating engines can include a first reciprocating mechanism that includes an axially translating y-axis component configured to reciprocate substantially along a y-axis with a reciprocating motion of a piston assembly relative to a base to which the y-axis component is slidingly attached. The first reciprocating mechanism can include an x-axis component slidingly coupled to and translating with the y-axis component along the y-axis, the x-axis component being: i) configured to reciprocate substantially perpendicularly to the y-axis relative to the y-axis component, ii) comprising an orbital output component, and iii) comprising an orbital linking component disposed substantially concentric with the orbital output component. The first reciprocating mechanism can include a stationary output component and a stationary linking component that are substantially concentric and disposed in a direction that is substantially perpendicular to the x-y plane. |
| US10851871B2 |
Rope swinging device
A rope swinging device includes a strap attached to an optional handgrip, and a clamp attached to the strap. The clamp may be attached to a rope that is swung by a user. |
| US10851860B2 |
Hub and rotor assembly
A disc brake rotor and hub assembly for a heavy-duty vehicle. The disc brake rotor and hub assembly includes a hub portion. The hub portion is receivable on, and rotatable about, an axle spindle of a heavy-duty vehicle. A rotor portion includes a disc segment, a mounting segment and a cylindrical sleeve segment connecting the disc segment to the mounting segment. A flange portion connects with the rotor portion and separately with the hub portion. Optionally, the rotor portion connects directly to the hub portion. A smallest inner dimension of the rotor portion is greater than a largest outer dimension of the hub portion to facilitate removal of the rotor portion without removing the hub portion from the axle spindle. |
| US10851849B2 |
Engine assembly
An engine assembly may include an internal combustion engine and an expander couplable to the internal combustion engine in a force transmitting manner. The engine assembly may also include a pulley mounted rotatably on a shaft of the expander. The pulley may be coupled to the internal combustion engine in a force-transmitting manner via a belt drive. The engine assembly may further include a first driver plate connected non-rotatably to the pulley and a second driver plate arranged adjacent thereto and connected non-rotatably to the shaft. The engine assembly may additionally include a clutch device including at least one actuating device and a coupling wheel. The coupling wheel may contact the first driver plate and the second driver plate when the clutch device is closed such that the pulley is connected with the shaft of the expander in a driving manner. |
| US10851847B2 |
Clutch device for a hybrid drive
A clutch device, comprising a first input side coupled to a first drive motor, a second input side coupled to a second drive motor, a first and second output side, wherein the first and second output sides can and the first and second input sides can be rotated about a common axis. The clutch device further includes a first clutch located between the first input side and the first output side, a second clutch located between the first input side and the second output side, and a third clutch located between the first input side and the second input side, wherein the third clutch is arranged offset relative to the first clutch. |
| US10851839B2 |
Bearing device for axle
A bearing device for an axle has: a first axial gap (G1), which is defined between the inner ring (3) and the back cover (11) in an axial direction, and has the spacer (21) interposed therein; a second axial gap (G2), which is larger than the first axial gap (G1), and has the sealing member (22) interposed therein; and a third axial gap (G3), which is defined on a radially outer side of the second axial gap (G2), and is smaller than the second axial gap (G2). |
| US10851833B2 |
LM guide assembling method using half division and computer-readable record medium having program recorded for executing same
Disclosed is an LM guide assembling method using half division, and a computer readable recording medium having a program for executing the same. The method includes: disposing an LM rail on a base; fastening a first hole and a (2n+1)-th hole; installing an angle measuring device; fastening a (2n-1+1)-th hole at step S130; respectively disposing the LM blocks on the first hole and the (2n-1+1)-th hole; disposing the auxiliary shelf on the LM blocks; setting an angle of the auxiliary shelf to a zero angle; moving the two LM blocks to be on a (2n-1+1)-th hole and a (2n+1)-th hole, and measuring an angle of the auxiliary shelf; calculating a straightness correction amount; and moving a position of the (2n-1+1)-th hole by the straightness correction amount, and fastening the hole, wherein, the steps are repeated until n becomes 1. |
| US10851832B2 |
Rotary gearbox
A rotary gear box for a rotary drill rig having a rotary joint that includes a first conduit having a first end portion defining an exit, a second conduit having a second end portion defining an inlet, and a sealing arrangement positioned radially between the first end portion of the first conduit and the second portion of the second conduit. The second conduit is rotatable relative to the first conduit and is arranged coaxial with the first conduit. The first end of the first conduit is received within the second end of the second conduit such that the exit of the first conduit is downstream from the sealing arrangement. |
| US10851830B1 |
Connecting rod structure
A connecting rod structure includes a first rod, a second rod and a locking element. The first rod includes a first rod portion, a first and a second limiting portion. The first and the second limiting portion extend from a side of the first rod portion, and are spaced apart. The first limiting portion has a first through hole, and the second limiting portion has a second through hole. The second rod includes a second rod portion and a positioning portion. The positioning portion has a through groove, and is located between the first and the second limiting portion. An inner diameter of the through groove is greater than that of the first and the second through hole. The locking element passes through the first through hole, the through groove and the second through hole, to lock the first rod and the second rod together. |
| US10851827B2 |
Vehicle component fastener with enhanced pre-locking
A vehicle component fastener for fastening a first component to a second component of a vehicle, including a first part having a pin socket for receiving a head of a pin of the second component, and a second part having a fastening structure for fastening of the first component. The first part and the second part are connected to each other via a preassembly locking device in a preassembly position from which axial displacement into a final assembly position can occur. The preassembly locking device is releasable by introduction of the head of the ball pin or T pin into the pin socket such that the axial displacement into the final assembly position a) can be carried out with less effort than when the head of the ball pin or T pin is not introduced into the pin socket, or b) can be carried out at all. |
| US10851825B2 |
Metal attachment
The invention concerns a metal attachment for providing an electrically conductive surface through the entire thickness of structural elements to be assembled. The attachment thereby comprises a head (12) and a smooth shank (14) extending along an axis of revolution, characterized in that the shank comprising at least one conductive portion (24) and one lubricating portion (22) disposed along the axis of revolution of the attachment along at least one length of the shank. The attachment according to the invention provides a conductive surface through the entire thickness of the structure in which it is installed. The attachment according to the invention is intended, in particular, for aeronautical applications. |
| US10851822B2 |
Connecting device for improved alignment
A device, system and method to connect a receiving member and a connecting device with a pin such that an asymmetrical configuration after the alignment of the connecting member and the receiving member does not give rise to asymmetrical glue distribution, nor asymmetrical shrinking nor curing drift. The receiving member has a receiving planar surface with at least one opening, and the connecting device has a main body with a contact plane, the main body having at least one opening where the connecting device is placed with the contact plane towards the receiving planar surface so that the at least one opening of the connecting device overlaps the at least one opening of the receiving surface, and the pin is inserted into the overlap. The system having a device for exerting a force between the contact plane of the connecting device and the receiving planar surface of the receiving member. |
| US10851821B2 |
Panel splice connector for linear panels
A panel splice connector configured to splice two adjacent linear panels at their respective longitudinal ends. The connector comprises a longitudinally extending base portion, having a length and a width, and two wall portions each extending from the base portion at opposed, longitudinally extending sides thereof. At least one of the wall portions comprises a resilient section that allows a free, longitudinally extending edge of said wall portion to be resiliently displaceable towards the base portion. |
| US10851819B2 |
Element for positioning a component in space
An adjustable positioning element (1) enabling a component (7) to be positioned and fastened in three dimensions is provided. The element comprises a bolt (2) with which the component (7) can be positioned in an axial direction (z) of the bolt (2), a hollow body (4) presenting an annular end wall through which the bolt passes, and a fastener element (5) with a washer (25) surrounding the bolt and arranged to be movable sideways against the end wall of the hollow body (4). The washer (25) is designed to be pressed against the end wall of the hollow body when the fastener element is attached to the bolt so as to fix the lateral (xy) position of the bolt (2) in the hollow body (4). The fastener element (5) and the bolt (2) are arranged to attach to each other by reversible snap-fastening. |
| US10851818B2 |
Devices, kits, and methods for mounting a multifunctional clip
A device including a first clip portion including a bottom section having a first end and a second end opposite the first end, a first leg section extending from the first end of the bottom section, a second leg section extending from the second end of the bottom section, and a pole adaptor attachment portion; an arm projecting away from the first leg section; and a light string attachment portion located on the first leg section, the light string attachment portion including a substantially C-shaped clip defined by the arm, the first leg section, and the pole adaptor attachment portion. |
| US10851815B2 |
Hydraulic circuit for operating an aircraft landing gear
The invention relates to a hydraulic circuit for operating an aircraft landing gear comprising: a general valve (1) for admitting a supply pressure into the circuit; distributors (4, 6) for supplying undercarriages and/or landing gear doors operating actuators (3) or release actuators for hooks (5) maintaining the undercarriages and/or the doors in the retracted position; a depressurization valve (102) for, in an open position, allowing the selective distribution of supply pressure to an extension chamber (3A) or a retraction chamber (3B) of each operating actuator by the distributors, and, in a depressurization position, forcing the return of a retraction chamber of each operating cylinder. According to the invention, the depressurization valve is returned (105) in a stable manner to the depressurization position, and is moved into the open position only in response to the presence of supply pressure downstream of the general valve. |
| US10851813B2 |
Method for producing piston assembly and hydraulic fluid device
A hydraulic fluid cylinder is equipped with a cylinder tube, a piston unit, and a piston rod. The piston unit has a piston body comprising a plurality of members and provided with a gasket-mounting groove. The piston body has a first piston member and a second piston member which are layered in the axial direction. The gasket-mounting groove is formed from a combination of at least two members. A thin section exhibiting depth in the axial direction is provided in the first piston member and/or the second piston member. |
| US10851810B2 |
Actuator limit controller
In some applications, a piston of a hydraulic actuator may move at high speeds, and large undesired forces may be generated if the piston reaches an end-stop of the hydraulic actuator at a high speed. The undesired forces may, for example, cause mechanical damage in the hydraulic actuator. A controller may receive information indicative of the piston reaching a first position at a first threshold distance from the end-stop, and, in response, may modify a signal to a valve assembly controlling flow of hydraulic fluid to and from the hydraulic actuator. Further, the controller may receive information indicative of the piston reaching a second position at a second threshold distance closer to the end-stop of the hydraulic actuator, and, in response, the controller may further modify the signal to the valve assembly so as to apply a force on the piston in a away from the end-stop. |
| US10851807B1 |
Energy generating system using floor tiles and fluid/gas movement
An energy generating system that utilizes a movement of a fluid/gas includes a plurality of floor tiles, a fluid/gas, and a power generating unit. Preferably, the plurality of floor tiles is layered across an area with high foot traffic. The fluid/gas is confined in a fluid tank positioned underneath the plurality of floor tiles such that a pressure applied on the plurality of floor tiles is transferred onto the fluid/gas, and generates movement in the fluid/gas. The movement allows the fluid/gas to flow towards a plurality of turbines of the power generating unit through a piping network and a plenum passage, and rotate the plurality of turbines. The rotational movement of the turbines is converted into electrical energy by a generator of the power generating unit. The electrical output of the generator is stored in a battery bank. |
| US10851806B2 |
Pressure booster
When a fluid is supplied to a first pressure-boosting chamber and/or a second pressure-boosting chamber of a pressure booster, either a first electromagnetic valve unit supplies a fluid discharged from a first pressurizing chamber to a second pressurizing chamber, or a second electromagnetic valve unit supplies a fluid discharged from a third pressurizing chamber to a fourth pressurizing chamber. |
| US10851805B2 |
Actuator assist apparatus, actuator system and method
An actuator assist apparatus for use with an actuator has a housing and a piston member slidably disposed in the housing. The piston member divides the interior of the housing into a first fluid chamber and a second fluid chamber. The actuator assist apparatus is configurable between a first, primed, configuration and an activated configuration. A force applicator is configured to store energy when the apparatus is in the primed configuration and release the energy to move the piston member relative to the housing. Movement of the piston member applies a force which assists in urging the actuator towards an extended configuration, thereby reducing the minimum operating pressure of the actuator. |
| US10851804B2 |
Accumulator
An accumulator according to an embodiment includes, for example, a base member; a cover member welded to the base member, the cover member and the base member defining a pressure chamber therebetween; a stretchable partition member that partitions the pressure chamber into an inner chamber and an outer chamber; and a labyrinth structure provided in at least one of a first part of the base member and a second part of the cover member. The first part is located closer to the outer chamber than a welded part between the base member and the cover member. The second part is located closer to the outer chamber than the welded part, facing the first part. |
| US10851802B2 |
Method of manufacturing centrifugal pump
A centrifugal blood pump prevents a shaft member from oscillating due to expansion of a pump housing resulting from pressurization of the blood. The centrifugal blood pump is manufactured by assembling a bottom member 21 and a lid member 22, and compressing them in a direction in which the bottom member 21 and the lid member 22 approach each other by a deformation amount along their outer circumferential walls. The lid member and the bottom member are joined while in the compressed state in order to create a preloading force between the shaft member and bearings to resist the expansion due to pressurization of the blood during use. |
| US10851796B2 |
Single-knob air pump
A single-knob air pump includes a housing provided with a first air inlet/outlet and a second air inlet/outlet; an air extracting mechanism arranged in the housing; fan blades of the air extracting mechanism arranged in a fan blade chamber provided with an air inlet and an air outlet; an air channel switching mechanism arranged near the fan blade chamber and provided with an air inlet and an air outlet; the air channel switching mechanism operatively connected to a knob mechanism which can control the displacement of the air channel switching mechanism; the second air inlet/outlet provided with an air valve mechanism capable of closing or opening the second air inlet/outlet; and an ejector rod mechanism capable of closing or opening the second air inlet/outlet through the air valve mechanism under the action of the air channel switching mechanism arranged between the air valve mechanism and the air channel switching mechanism. |
| US10851792B2 |
Diagonal fan
Diagonal fan having a fan housing, within which an external-rotor motor and an impeller are accommodated, wherein the external-rotor motor has a stator and a rotor which at least partly surrounds the stator, and an axial flow duct runs between the fan housing and the external-rotor motor as far as a discharge opening, surrounding the external-rotor motor, of the diagonal fan, through which duct, during operation, air which is drawn in by means of the impeller can be conveyed to the discharge opening, and wherein the impeller is integrated in the rotor. |
| US10851789B2 |
Compressor having improved discharge structure including discharge inlets, communication hole, and discharge outlet
A scroll compressor is provided, that may include a connection groove to reduce discharge resistance. The scroll compressor may include a fixed scroll including a fixed end plate and a feed wrap and an orbiting scroll, rotating with respect to the fixed scroll and including an orbiting end plate and an orbiting wrap, and structure in which a connection groove having a concave groove shape provided at an inner surface of the fixed end plate to allow a refrigerant to flow through the connection groove depending on an overlapping state of the fixed wrap and the connection groove, thereby providing an effect of increasing opening efficiency of discharge holes at a beginning of discharge. |
| US10851788B2 |
Vacuum pump with noise attenuating passage
A vacuum roots blower includes a rotor capable of being rotated to capture a gas from an inlet and further rotated to discharge the captured gas from an outlet. The captured gas is held within a pocket formed between lobes of the rotor and the adjacent housing within which the rotor is rotated. The vacuum roots blower includes a pressure relief system capable of delivering a pressure relief gas to the pocket. The pressure relief system includes a sonic passage structured to produce a choked flow condition as the pressure relief system fills the pocket with pressure relief gas. In one form the pressure relief gas can be a cooling gas, but other forms such as ambient air are also contemplated. |
| US10851786B2 |
Rotary screw compressor with atomized oil injection
The present disclosure is directed to a screw compressor system having a compressor housing with a pair of screw rotors rotatably supported within a compression chamber. A lubricant port is in fluid communication with the compression chamber. A nozzle insert having a longitudinal body extending between a first end and a second end can be positioned within the lubricant port. A swirl chamber formed by the nozzle insert or tangential flow into an offset lubricant port is configured to generate an atomized lubricant flow and discharge the atomized lubricant into the compression chamber. |
| US10851778B2 |
Fuel pump having pump chambers formed between outer gear and inner gear
A casing of a housing of a fuel pump has a bearing surface that rotatably supports an inner gear in an axial direction from a motor side while a plain bearing extends through the bearing surface. The plain bearing includes: an inner-peripheral-side step that is stepped by increasing an inner diameter of the plain bearing on a counter-motor side of the inner-peripheral-side step in the axial direction; and an outer-peripheral-side step that is stepped by increasing an outer diameter of the plain bearing on the motor side of the outer-peripheral-side step at a position that is on the motor side of the bearing surface in the axial direction. |
| US10851777B2 |
Rotary device having a circular guide ring
A rotary device for use with a fluid includes a housing, a rotor, a ring, and at least one vane. The housing includes a tubular surface defining, in part, a tubular volume. The housing is segregated into at least a pumping zone positioned between first and second working zones. The first working zone is configured to receive a fluid and the second working zone is configured to output the fluid. The rotor is mounted for rotation about a rotation axis. The rotor includes a body mounted within the tubular volume. The body includes a plurality of slots. The ring is at least indirectly coupled to the housing by way of a bearing. The at least one vane is associated with one slot of the plurality of slots. The at least one vane is connected at least indirectly to the ring and configured to rotate within the tubular volume. |
| US10851775B2 |
Valve seats and valve assemblies for fluid end applications
In one aspect, valve seats are described herein having structure and design addressing degradative stresses encountered by the seats during installation and operation in fluid ends. In some embodiments, a valve seat for use in a fluid end comprises a first section for insertion into a fluid passageway of the fluid end and a second section extending longitudinally from the first section, the second section comprising a frusto-conical valve mating surface, wherein the second section is encased in a ring imparting a compressive stress condition to the second section. |
| US10851772B2 |
Hydraulic drive
The invention relates to a hydraulic drive having a differential cylinder which has a cylinder piston and a piston rod which is connected to the cylinder piston. The cylinder piston is arranged in a displaceable manner in a cylinder chamber in order to extend and retract piston rod. The cylinder chamber is separated by cylinder piston into a piston side, and a ring side with piston rod, each with a variable volume. The piston side and ring side are separated from one another by the piston and are connected to one another in a fluid conducting manner via a short-circuit line. The short-circuit line includes a switching valve for optionally shutting off short-circuit line in a fluid-tight manner. A switching valve can be switched into its blocking position at least indirectly in dependence on the pressure on piston side of cylinder chamber. |
| US10851771B2 |
Portable battery steam cleaner
The present invention provides a portable battery steam cleaner comprising in combination of a hollow main body, in which a water tank, peristaltic pump, control system and lithium battery; the water tank in connection with the input of the peristaltic pump; the output of the peristaltic pump in connection with one end of silicone hose; and the other end of silicone hose in connection with the steam generator. The present invention can continuously transport liquid from the water tank, through the silicone hose, into the steam generator, and thus eject steam continuously for cleaning purposes. |
| US10851770B2 |
Positive displacement pump with pressure compensating calibration
Illustrative embodiments of positive displacement pumps utilizing pressure compensating calibration, as well as related systems and methods, are disclosed. In one illustrative embodiment, a method of operating a positive displacement pump includes sensing, with a pressure sensor disposed at a fluid outlet of the positive displacement pump, a back pressure at the fluid outlet, transmitting a pressure signal associated with the sensed back pressure from the pressure sensor to a controller of the positive displacement pump, and identifying, on the controller, a volume of fluid pumped by the positive displacement pump using the pressure signal. |
| US10851769B2 |
Pumping cassette
A pumping cassette including a housing having at least two inlet fluid lines and at least two outlet fluid lines. At least one balancing pod within the housing and in fluid connection with the fluid paths. The balancing pod balances the flow of a first fluid and the flow of a second fluid such that the volume of the first fluid equals the volume of the second fluid. The balancing pod also includes a membrane that forms two balancing chambers. Also included in the cassette is at least two reciprocating pressure displacement membrane pumps. The pumps are within the housing and they pump the fluid from a fluid inlet to a fluid outlet line and pump the second fluid from a fluid inlet to a fluid outlet. |
| US10851760B2 |
Liquid potential energy increasing device
A liquid potential energy increasing device includes a first receiving trough, a second receiving trough, a liquid absorbing structure, a first magnetic component, and a second magnetic component. The liquid absorbing structure includes a main body portion and an extending portion. The extending portion conveys a liquid in the first receiving trough into the main body portion. When a sum of a weight of the main body portion and a weight of the liquid in the main body portion is greater than the magnetic attraction, the main body portion hits the second receiving trough by gravity, so that the liquid in the main body portion is at least partially released to the second receiving trough so as to increase potential energy of the liquid. |
| US10851753B2 |
Fuel injector, a fuel injector assembly and an associated method
A fuel injector is provided which has a valve member, a valve member guide and a spring chamber. Discharge of fuel out of a fuel injector outlet is controlled by movement of the valve member within a bore of the valve member guide. The spring chamber contains a biasing member, which is a compression spring, and which biases the valve member into contact with a valve seat when in a closed configuration. The fuel supply passage is provided, which by-passes the spring chamber, to direct a flow of the fuel to an outlet chamber of the fuel injector, and the cleaning fluid supply passage is provided to supply a pressurized cleaning fluid to a second end of the bore to restrict leakage of the fuel from the outlet chamber towards the second end of the bore along a clearance extending between the valve member and the valve member guide. |
| US10851752B2 |
Piston fuel pump and check valve therefore
A piston fuel pump for an internal combustion engine includes a pump housing, a piston, and a non-return discharge valve. The non-return discharge valve has a valve element and a guide element configured to guide the movement of the valve element. The guide element is at least indirectly pressed in a radial manner into an opening in the pump housing. |
| US10851751B2 |
High-pressure fuel pump
Provided is a high-pressure fuel pump which can fix a cylinder to a pump body using a simple structure, and can reduce a displacement amount inward in a radial direction of the cylinder. A high-pressure fuel pump includes a pump body which is formed with a pressing chamber and a cylinder which is inserted in a hole formed in the pump body. The cylinder is swaged to the hole by pressing a convex portion on an outside in a radial direction to fit into the hole on an opposite side to the pressing chamber, by screwing a formed screw thread into the hole, or by being swaged with the opposite side to the pressing chamber. The cylinder is formed with a clearance in the radial direction with respect to the hole of the pump body all over a region from a bonding portion to an upper end. |
| US10851746B2 |
Controller of fuel system for vehicle
A controller of a fuel system for a vehicle is provided in which heat is dissipated outside from a printed circuit board to cool the controller. The dissipated heat is utilized to maximize the efficiency of the purge operation using a canister by waste heat. The controller is integrated with an air filter for removing foreign substances from air to be suctioned into a canister, and is configured to realize heat exchange between air passing through the air filter and a motor driver. |
| US10851745B2 |
Transport membrane assembly system with mixing/swirling component
A combustion system including an ion transport membrane assembly coupled to an internal combustion engine to generate power via oxy-combusting a fuel stream in a combustion chamber of the internal combustion engine, and a method of combusting the fuel stream via the combustion system, wherein a portion of an exhaust stream is recycled to the ion transport membrane assembly. Various embodiments of the combustion system and the method of combusting the fuel stream are disclosed. |
| US10851742B2 |
Intake system for vehicle
An intake system of a vehicle includes: an intake manifold having a plurality of runners for supplying intake gas to a multiple-cylinder engine; a surge tank cover coupled to the intake manifold to define a surge tank communicating with the plurality of runners via the intake manifold; an intake air inlet formed on the intake manifold as a passage through which intake air flows into the surge tank; an intake outlet formed on the intake manifold as a passage through which intake air sequentially passing through the intake air inlet, the surge tank, and the plurality of runners, and is discharged to the engine as the intake gas; a gas inlet which is a passage formed on the intake manifold and selectively receiving recirculation exhaust gas; and a gas chamber formed on the intake manifold so that the recirculation exhaust gas flows in through the gas inlet. |
| US10851738B2 |
Internal combustion engine having dedicated EGR cylinder(s) and improved fuel pump system
A method of improving fuel delivery in an engine having one or more cylinders that are over-fueled related to other cylinders, such as a D-EGR engine. The fueling system uses a mechanical fuel pump, which is cam-driven. The cam has lobes corresponding to the desired displacement for each cylinder. The lobe corresponding to the over-fueled cylinder is shaped differently, such that the filling stroke of the pump is increased. |
| US10851736B1 |
Dual armature purge valve
A purge valve for an EVAP system has a chamber including an inlet conduit for receiving fuel vapors from an EVAP canister, a first outlet conduit to the engine for the fuel vapors, and a second outlet conduit to the engine for the fuel vapors. Energizing the purge valve at a first current actuates a first armature from a closed position to an open position to open a first opening and allow fuel vapors to flow through the first outlet conduit to the engine, without actuating the second armature from a closed position. Energizing the purge valve at a second current that is greater than the first current actuates a second armature from a closed position to an open position to open the second opening and allow fuel vapors to flow through the second outlet conduit to the engine while maintaining the first armature in the fully open position. |
| US10851732B2 |
Controller for internal combustion engine and method for controlling internal combustion engine
The controller includes a fuel amount control unit adjusting amount of fuel supplied to a cylinder through feedback control with an air-fuel ratio deviation as input, a target air-fuel ratio adjustment unit alternately repeating a lean period process and a rich period process, and a learning value correction unit updating a learning value to compensate for a steady deviation in an air-fuel ratio. If an absolute value of an oxygen amount deviation is less than a determination value, the learning value update unit updates a learning value only when one of the lean period process and the rich period process is switched to the other one. If the absolute value of the oxygen amount deviation is greater than or equal to the determination value, the learning value is updated both when one of the processes is switched to the other one and when the switching is reversed. |
| US10851728B2 |
Engine overspeed device and method
Methods, systems and devices for evaluating incoming air to an engine for concentrations of explosive or combustible gases, and shutting down the engine to prevent an overspeed condition when elevated concentrations are detected. In some embodiments engine shutdown may be achieved conventionally via an electronic kill signal and in emergency conditions by the shutoff of incoming air to an air intake. The ability to make decisions based on explosive gas concentrations and species and the use of networking to allow additional systems to take action even before explosive gases reach said other valve-sensor devices can provide additional safety. |
| US10851727B2 |
System and method for selecting a cylinder deactivation mode
Systems and methods for operating an engine with a plurality of deactivating valves for deactivating engine cylinders are presented. In one example, a plurality of different cylinder operating modes may be available to operate the engine. Engine fuel consumption in each of the plurality of different cylinder operating modes is estimated and the engine may be operated in the cylinder mode that provides greatest fuel efficiency. |
| US10851717B2 |
Combined engine braking and positive power engine lost motion valve actuation system
A system for actuating one or more engine valves for positive power operation and engine braking operation is disclosed. In a preferred embodiment, an exhaust valve bridge and intake valve bridge each receive valve actuations from two sets of rocker arms. Each valve bridge includes a sliding pin for actuating a single engine valve and an outer plunger disposed in the center of the valve bridge to actuate two engine valves through the bridge. The outer plunger of each valve bridge may be selectively locked to its valve bridge to provide positive power valve actuation. During engine braking, application of hydraulic pressure to the outer plungers may cause the respective valve bridges and outer plungers to unlock so that all engine braking valve actuations are provided from a rocker arm acting on one engine valve through the sliding pin. |
| US10851716B2 |
Method for operating a system in which a manipulated variable of an actuator element can be controlled
A method (10) is described for operating a system (12), for example a hydraulic or pneumatic system (12), in which a manipulated variable of an actuator element (16) can be controlled, and in which at least one variable (26) which is dependent on the manipulated variable of the actuator element (16) can be determined, wherein the manipulated variable of the actuator element (16) is modulated with a first periodic signal (22), and wherein a measurement signal (30) which characterizes the at least one variable (26) is evaluated using at least one second periodic signal (47). |
| US10851715B1 |
High power epicyclic gearbox and operation thereof
A gas turbine engine for an aircraft including: an engine core including a turbine, a compressor, and a core shaft connecting the turbine to the compressor; a fan located upstream of the engine core, the fan including a plurality of fan blades; a gearbox that receives an input from the core shaft and outputs drive to a fan shaft via an output of the gearbox so as to drive the fan at a lower rotational speed than the core shaft; and a fan shaft mounting structure arranged to mount the fan shaft within the engine, the fan shaft mounting structure including at least two supporting bearings connected to the fan shaft. A fan-gearbox axial distance is defined as the axial distance between the output of the gearbox and the fan axial centreline, the fan-gearbox axial distance being greater than or equal to 0.35 m. |
| US10851714B2 |
Engine accessory drives systems and methods
An accessory drive for an engine includes a power takeoff (PTO) configured to couple power from a rotating shaft of the engine and to convey the power through an opening in a housing of the engine. A gearbox is coupled to and configured to be driven by the PTO. The gearbox is disposed external to the housing and includes a planetary gear train. At least one engine accessory is coupled to and configured to be driven by the planetary gear train. |
| US10851712B2 |
Clearance control device
A clearance control system includes one or more clearance control devices that include features for controlling the clearances between rotating and stationary components of an engine. In one exemplary aspect, a clearance control device utilizes a fluid to pressurize an actuation chamber defined by a compliant member of the clearance control device. The pressurization of the actuation chamber causes the actuation chamber to expand in a direction that changes the clearance between the stationary and rotating components of the engine. |
| US10851706B2 |
Variable nozzle mechanism and variable displacement type exhaust turbocharger
A variable nozzle mechanism includes: a nozzle mount having an annular shape; a plurality of nozzle vanes supported rotatably at a plurality of respective locations along a circumferential direction of the nozzle mount; and a drive ring disposed rotatably with respect to the nozzle mount, the drive ring being configured to transmit a driving force to the nozzle vanes so that a vane angle of the nozzle vanes is variable and to rotate the nozzle vanes. The drive ring includes: a low-rigidity region; and a high-rigidity region including an uneven portion in a thickness direction of the drive ring, and having a greater cross-sectional secondary moment than the low-rigidity region in a cross section along a radial direction of the drive ring. The low-rigidity region and the high-rigidity region are disposed alternately in the circumferential direction. The number of the low-rigidity region and the number of the high-rigidity region are odd numbers, or the low-rigidity region and the high-rigidity region are disposed at an irregular pitch in the circumferential direction. |
| US10851705B1 |
Variable inlet guide vane system for a turbocharger used in a motor vehicle
A variable inlet guide vane system for a turbocharger includes a casing that forms an intake passage along a longitudinal axis. A plurality of vanes extend along corresponding transverse axes that are perpendicular to the longitudinal axis, and each vane is movably disposed within the intake passage between a high-trim position where the intake passage defines a maximum cross-sectional area for supplying airflow at a high-trim velocity and a low-trim position where the vanes define a minimum cross-sectional area for supplying airflow at a low-trim velocity. The minimum cross-sectional area is smaller than the maximum cross-sectional area such that the low-trim velocity is higher than the high-trim velocity at a common flow rate. Each vane includes an outer section rotatably coupled to the casing and an inner section, which extends from the outer section along the transverse axis and is angularly spaced from the outer section about the transverse axis. |
| US10851703B2 |
Variable-flow-rate valve mechanism and turbocharger
A clearance δ between an inner peripheral surface of an attachment hole of an attachment tongue and an outer peripheral surface of a valve shaft is set to be smaller than an allowable displacement amount λ in an axial direction of a valve with respect to the attachment tongue. When a condition is satisfied in which the outer peripheral surface of the valve shaft comes into contact with a front-side periphery and a back-side periphery of the attachment hole of the attachment tongue, and in which a top surface of a valve body comes into contact with a back surface of the attachment tongue, a waste gate valve is constituted so that a metal washer becomes non-contact with a front surface of the attachment tongue. |
| US10851702B2 |
Combustion chamber structure for engine
A combustion chamber structure for an engine includes a combustion chamber where SI combustion by spark ignition and CI combustion by self-ignition are conducted. A crown surface includes a cavity recessed to have a bowl-shape, and a pair of raised portions. The cavity includes a bottom portion which is a lower region of the recessed part, the bottom portion having an outer circumferential edge which is circular in a top view. With a height of the raised portion relative to a height position of a deepest portion of the cavity being represented as H1 and a diameter of an outer circumferential edge of the bottom portion of the cavity being represented as D, H1/D as a ratio of the height H1 of the raised portion to the diameter D of the cavity is set to be in a range of 0.05 or more and 0.36 or less. |
| US10851699B2 |
Heat exchanger for an internal combustion engine
A heat exchanger for an internal combustion engine may include a plurality of first tubular bodies and a plurality of second tubular bodies for being flowed through by a gas. A plurality of first intermediate spaces may be disposed between the plurality of first tubular bodies defining a plurality of first coolant paths for being flowed through by a coolant. A plurality of second intermediate spaces may be disposed between the plurality of second tubular bodies defining a plurality of second coolant paths for being flowed through by the coolant. The plurality of first coolant paths may be fluidically connected to a first coolant distributor configured to distribute the coolant to the first coolant paths and a first coolant collector. The plurality of second coolant paths may be fluidically connected to a second coolant distributor configured to distribute the coolant to the second coolant paths and a second coolant collector. |
| US10851696B2 |
Method and device for operating an exhaust gas aftertreatment device of an engine system including an internal combustion engine
A method for operating an engine system including an internal combustion engine and an exhaust gas aftertreatment device, including: carrying out a fill level control to control a fill level of the exhaust gas aftertreatment device as a function of a predefined fill level setpoint value; operating a pilot control for the fill level control; and adapting the pilot control as a function of a deviation between a measured lambda value and a modeled lambda value. |
| US10851690B2 |
Internal combustion engine with a turbo charger unit
An internal combustion engine, such as a stationary reciprocating piston engine, is provided. The internal combustion engine includes at least one turbo charger unit. At least one supply conduct is configured to convey a medium from the at least one turbo charger unit to at least one separation device, which is configured to separate foreign substances, in particular oil, from the medium. At least one foreign substance conduct is configured to convey the separated foreign substances from the at least one separation device to at least one crankcase. |
| US10851682B2 |
Engine valve actuation systems with lost motion valve train components, including collapsing valve bridges with locking pins
Systems for valve actuation in internal combustion engines provide configurations for collapsing valve train components, particularly collapsing valve bridges. Various configurations for locking a bridge piston to a bridge housing include substantially cylindrical locking pins that may be housed within a substantially cylindrical receptacles defined by a transverse bore in the bridge piston and actuated hydraulically and may include an actuating pin that interacts with the locking pins to synchronize motion and provide positive positioning within an annular recess in the bridge housing to lock or unlock the bridge piston for movement relative to the bridge housing. Various geometries for locking pins and actuating pins provide benefits of manufacturing, ease of assembly, alignment and reduced wear. |
| US10851679B2 |
Natural gas liquid fractionation plant waste heat conversion to potable water using modified multi-effect distillation system
A method of recovering heat from a Natural Gas Liquid (NGL) fractionation plant for production of potable water. The method includes heating a buffer fluid via a heat exchanger in to transfer heat from the NGL fractionation plant to the buffer fluid. The method includes heating water with the buffer fluid discharged from the heat exchanger to produce potable water via train distillation effects. |
| US10851678B2 |
Thermal energy recovery device and startup operation method for the same
A thermal energy recovery device includes a circulation flow path for circulating a working fluid, a thermal fluid circulation flow path for circulating hot water, an evaporator for evaporating the working fluid flowing in the circulation flow path by heat of the hot water flowing in the thermal fluid circulation flow path, a preheater for heating the working fluid before flowing into the evaporator by the heat of the hot water flowing in the thermal fluid circulation flow path, and a control unit for controlling a startup operation of the thermal energy recovery device. The control unit executes a suppression control for suppressing a temperature difference between the hot water and the working fluid in the preheater. |
| US10851677B2 |
Boiler with integrated air compressor
An integrated power generation system is provided. The system includes an heat source that produces a first gas flow to power a turbine operatively coupled to a compressor. The first gas flow can also heat a feedwater flow passing through a boiler. The compressor can produce a second gas flow that may be divided in two portions, the first portion flowing back to the heat source and the second portion flowing to an end user. Also, the second portion may be routed through an air cooler to dissipate heat to the feedwater flow to cool the second portion as well as preheat the feedwater flow prior to entering the boiler. The first portion can also exchange heat with the first gas flow exiting the boiler prior to the first portion entering the heat source. The boiler operation and the compressor operation are operable independently or concurrently. |
| US10851673B2 |
Turbine stator, turbine, and gas turbine including the same
A turbine stator, into which combustion gas supplied from a combustor of a gas turbine flows, has an improved structure capable of preventing circumferential movement of turbine vanes. The turbine stator, which may be included in a turbine of a gas turbine having the improved structure, includes a casing including first and second casings constituting respective casing halves, the first and second casings having a fastening groove formed on at least one contact surface between the first casing and the second casing; a plurality of vane airfoils configured to be installed on an inner peripheral surface of the casing and arranged in a multi-stage manner in a flow direction of the combustion gas; and a stop configured to be fixed with respect to a vane airfoil of the plurality of vane airfoils and to be inserted into the fastening groove to fix the vane airfoil to the casing. |
| US10851669B2 |
Cooling of gas turbine engine accessories using air inlet located on a keel beam
A gas turbine engine for an aircraft is provided. The engine includes an engine core comprising a turbine, a compressor, and a core shaft connecting the turbine to the compressor. The engine further includes core casings surrounding the engine core. The engine further includes an aerodynamic cowl which surrounds the core casings. The engine further includes a propulsive fan located upstream of the engine core, the fan generating a core airflow which enters the core engine and a bypass airflow which enters a bypass duct surrounding the aerodynamic cowl. The engine further includes one or more engine accessories mounted in a space between the core casings and the aerodynamic cowl. |
| US10851667B2 |
Process for producing a thermal barrier in a multilayer system for protecting a metal part and part equipped with such a protective system
The object of the present invention is to produce a metal part equipped with a protection system, particularly for turbine blades for aircraft engines, having a thermal barrier that is improved in terms of thermal properties, adhesion to the part and resistance to oxidation/corrosion. In order to achieve this, the method according to the invention produces in a single step, from specific ceramics, coating layers using SPS technology.According to one embodiment, a metal part is produced according to an SPS flash sintering method and comprises a superalloy substrate (22), a metal sub-layer (21), a TGO oxide layer (25) and the thermal barrier (23) formed by said method from at least two chemically and thermally compatible ceramic layers (2a, 2b).A first ceramic (2a), referred to as the inner ceramic, is designed to have a substantially higher expansion coefficient. The outer ceramic (2b) is designed to have at least lower thermal conductivity, and a sintering temperature and/or maximum operating temperature that is substantially higher. The thermal barrier (23) has a composition and porosity gradient (3) from the metal sub-layer (21) to the outer ceramic (2b). |
| US10851653B2 |
Method for manufacturing or for repairing a component of a rotary machine as well as a component manufactured or repaired using such a method
A method for manufacturing a component of a rotary machine, the component extending to an axial direction and a radial direction vertical thereto, and has an inner channel, extending from a first end of a core of a center of the component and to a second end at a radial limiting surface of the component and which is at least partially closed. A blank includes the core of the component and is limited by an outer surface in the radial direction. The blank is subtractively processed in a first subtractive process step, such that an outer contour is elaborated in the area of the outer surface, which extends in the radial direction, and a part of the channel is manufactured, which radially extends in the blank to the first end. The channel is finished by a build-up process on the blank. |
| US10851652B2 |
Plug for a void, system and method
A plug for a void in a mine to divert water having a rigid closed cell foam which fills the void. The rigid closed cell foam having a plurality of pipes disposed within the foam. The pipes distributed throughout the void. The pipes are positioned in the foam so the pipes are staggered in length vertically with respect to various heights in the void, and the pipes are positioned in the foam every 4′ to 6′ horizontally with respect to the void. Each pipe has a mixing stick. A method for diverting water from a void in a mine. |
| US10851646B2 |
System and method for measuring an indicator diagram of a well
The present invention relates to an oilfield management system. The oilfield management system comprises: one or more devices for measuring working conditions of oil wells, the one or more devices for measuring working conditions of oil wells are installed on one or more oil wells respectively for measuring working conditions of the one or more oil wells, the working conditions of oil wells at least comprise indicator diagrams of oil wells; one or more remote transmission units, each of the remote transmission units receives the working conditions measured by one or more of the devices for measuring working conditions of oil wells; and server, which determines running status of the one or more oil wells according to the working conditions of oil wells from the one or more remote transmission units; maintenance staff or administrators manage the one or more oil wells according to the running status of the one or more oil wells. The present invention can collect indicator diagrams of an oil well on a regular basis, detect ON/OFF status of an oil well in real time, and realize the calculation of liquid production capacity via indicator diagrams and efficient and elaborate management of working conditions of oil wells. |
| US10851644B2 |
Downhole detection of cuttings
A method includes emitting, with one or more sensors of a downhole tool disposed in a borehole, an excitation signal. The method also includes detecting, with the one or more sensors, a returned signal resulting from an interaction of the excitation signal with the borehole. The method further includes estimating a noise of the returned signal. The method also includes quantifying a probability that the estimated noise is not a white noise of the borehole. The method further includes identifying drill cuttings in a predetermined location of the borehole based on said quantification. |
| US10851640B2 |
Nonstop transition from rotary drilling to slide drilling
Systems, devices, and methods for transitioning from a rotary drilling operation to a slide drilling operation on a drilling rig include rotary drilling a borehole in a subterranean formation by rotating a bottom hole assembly (BHA) on a drill string driven by a top drive and determining a trapped torque in a drill string. While maintaining weight on bit at the BHA, the drill string may be rotated in reverse to remove the trapped torque, and a slide drilling process may be performed without raising the bit from the bottom of the borehole. |
| US10851635B1 |
Electric driven hydraulic fracking system
An electric driven hydraulic fracking system is disclosed. A pump configuration that includes the single VFD, the single shaft electric motor, and the single hydraulic pump that is mounted on the single pump trailer. The single VFD converts the electric power of at least 13.8 kV to a VFD rated voltage level of at least 4160V and drives the single shaft electric motor at the VFD voltage level of up to 4160V to control the operation of the single shaft electric motor and the single hydraulic pump. The single shaft electric motor drives the single hydraulic pump with the rotation at the rated RPM level of at least 750 RPM. The single hydraulic pump continuously pumps the fracking media into the well at the HP level of at least 5000 HP. The single hydraulic pump operates on a continuous duty cycle to continuously pump the fracking media at the HP level of at least 5000 HP. |
| US10851633B2 |
Method and apparatus for reservoir analysis and fracture design in a rock layer
A method of hydraulic fracturing of a hydrocarbon reservoir in a rock layer uses a method of providing a reservoir description. Firstly, a reservoir description is provided for the hydrocarbon reservoir. This reservoir description comprises a distribution of stresses within a rock layer affecting propagation of a hydraulic fracture. This reservoir description can be used to calculate a fracture plan to for hydraulic fracture of the hydrocarbon reservoir according to the distribution of stresses in the reservoir description to provide one or more predetermined fracture properties. Hydraulic fracturing of the hydrocarbon reservoir can then follow according to the fracture plan. A method determines minimum horizontal stress in a rock region. |
| US10851632B2 |
Heat scavenging method for thermal recovery process
Thermal recovery of oils is improved by capturing waste heat from a depleted steam chamber using steam plus foam and an optional gas to carry low quality steam deep into the chamber where the waste heat converts water to steam in situ. Thus, overall steam generation needs and thus costs are reduced. |
| US10851628B1 |
Gas lift system
A gas-lift system includes a first valve configured to provide selective communication of a wellbore fluid between an interior of a production tubing an annulus defined exterior to the production tubing, a second valve configured to provide selective communication of the wellbore fluid between the interior of the production tubing and the annulus, and one or more control lines coupled to the first valve and the second valve. The one or more control lines apply a pressure differential to the first and second valves. The first valve is configured to actuate from an open position to a closed position in response to the pressure differential reaching a first pressure differential, and wherein the second valve is configured to actuate from an open position to a closed position in response to the pressure differential reaching a second pressure differential that is different from the first pressure differential. |
| US10851627B2 |
Landfill gas extraction control system throttle
A system for extracting landfill gas from a landfill is provided. According to some embodiments, a control system for landfill gas extraction is provided. The control system uses a throttle to control flow of landfill gas extracted from the landfill. The throttle is actuated in use to vary the flow of gas between a well and a gas collection system, in accordance with a control algorithm that adjusts flow as a parameter in controlling gas extraction. The throttle is configured to ensure that there is at least some flow of landfill gas from the landfill to a gas output throughout operation. The extraction system provides an efficient system for landfill gas extraction, while mitigating a risk of creating undesired or unpleasant conditions and/or of violating regulations during operation. |
| US10851626B2 |
System and method to reduce fluid production from a well
A method to reduce fluid production in a well includes performing a production simulation of a reservoir model comprising a production tool with an inflow control device, and determining a parameter for the inflow control device to reduce fluid production through the inflow control device based upon the production simulation. |
| US10851618B2 |
Method and apparatus for cementing and cleaning a reservoir liner
A procedure and apparatus for cementing and cleaning a reservoir liner 3 comprises installing a reservoir liner using a drill string 4 which extends only as far as the distal end of a cased part 2 of the well, then, using the drill string, displacing cement into the reservoir liner using completion fluid whereby, when the cement is in place in the annulus around the reservoir liner, the reservoir liner is already clean and filled with completion fluid. A ball valve 6 at the top of the reservoir liner 3 is then closed before the cased part 2 of the wellbore is cleaned, to avoid debris entering the reservoir liner. |
| US10851613B2 |
Two-part restriction element for large-bore downhole isolation tool and method
A downhole isolation system for sealing a well, the downhole isolation system including a setting tool having an internal chamber; a first restriction element placed within the internal chamber; and a second restriction element placed within the internal chamber, separate from the first restriction element. |
| US10851609B2 |
Installation of an emergency casing slip hanger and annular packoff assembly having a metal to metal sealing system through the blowout preventer
An emergency casing slip hanger assembly that is adapted to be installed in a wellhead through a blowout preventer includes a slip bowl that is adapted to be releasably coupled to and supported by a slip bowl protector during installation of the slip hanger assembly in the wellhead through a blowout preventer, the slip bowl being further adapted to be positioned around a casing in the wellhead and landed on a support shoulder of the wellhead. A plurality of slips are adapted to engage with and support the casing, and a plurality of first shear pins releasably couple the plurality of slips to the slip bowl, wherein the plurality of first shear pins are adapted to be sheared by a pressure thrust load that is imposed on the slip bowl protector so as to drop the plurality of slips into contact with an outside surface of the casing. |
| US10851603B2 |
Slips for downhole sealing device and methods of making the same
A slip for a downhole sealing device includes a plurality of slip segments angularly disposed about a central axis, each slip segment including, a body, and a plurality of engagement members molded or cast at least partially within the body, wherein each of the slip segments are releasably coupled to one another. |
| US10851601B2 |
Combination tubular handler and power swivel unit
A combination tubular handler and power swivel unit having an extendable trough to raise a tubular to a rig floor height without extensions. A raising leg is connected with the trough assembly through an easily installed height adjustment pin which requires no dangerous pinning. A following leg is pivotably coupled with an end of the trough assembly. This handler also moves the power swivel and other miscellaneous tools and equipment to the rig floor without winches or cables. A hydraulic swivel rack allows parking the swivel out of the way in a storage location when not in use. |
| US10851599B2 |
Horizontal directional drill pipe drive connection with locking feature
A spindle assembly for connecting a drill string to a rotational drive for use in a horizontal directional drilling operation. The assembly comprises a saver sub attached to the rotational drive, and a drive chuck for connection to the drill string. The drive chuck and saver sub form a torque-transmitting connection by engaging through a seat in the saver sub and an engagement point on the drive chuck. Dowel pins may be used to rotationally lock and provide the engagement between the saver sub and the drive chuck. A collar may thread to the saver sub and cause an interference fit by engaging the drive chuck at a shoulder. |
| US10851597B2 |
Unthreaded casing thread protector
A combination of a casing tube and a closed end unthreaded tubular thread protector that has an inside diameter significantly greater than the outside diameter of the casing tube is described. Further, the thread protector is typically much longer than the threaded portion of the associated casing tube such that a significant amount of axial movement of the protector relative to the casing tube is required to remove it therefrom. The casing protector is most typically comprised of a polymeric material, such as polyethylene or polypropylene, that is soft enough as to not damage or mar the threads on the casing in which it is in contact, but stiff enough in the tubular form of the protector to prevent impact loads from being transferred to the threads there beneath. |
| US10851595B2 |
Shipping arrangement and assembly procedure for drilling rig structures
A center drill floor assembly of a drilling rig structure includes a center floor structure and a drilling rig mast section that is at least partially nested within the center floor structure, wherein the center drill floor assembly is adapted to be transported to a drilling site as a single modular assembly and removably attached as a single modular assembly to a drilling rig substructure during assembly of the drilling rig structure. |
| US10851594B2 |
Kerfing hybrid drill bit and other downhole cutting tools
A drill bit for drilling a borehole in earth formations may include a bit body having a bit axis and a bit face; a plurality of blades extending radially along the bit face; and a plurality of cutting elements disposed on the plurality of blades, the plurality of cutting elements comprising: at least one cutter comprising a substrate and a diamond table having a substantially planar cutting face; and at least two non-planar cutting elements comprising a substrate and a diamond layer having a non-planar cutting end, wherein in a rotated view of the plurality of cutting elements into a single plane, the at least one cutter is located a radial position from the bit axis that is intermediate the radial positions of the at least two non-planar cutting elements. |
| US10851590B2 |
Automated drill control system for a mobile drilling machine
A mobile drilling machine may include a drilling mast including a mast frame. The mobile drilling machine may further include a rotary head movably mounted on the mast frame, the rotary head controllable to rotate a drill string at a desired drill string rotation speed. The rotary head may further be controllable to move up and down the mast frame at a desired drill string feed speed. Additionally, the mobile drilling machine may include a joystick movable to control the desired drill string rotation speed and the desired drill string feed speed of the rotary head. A controller of the mobile drilling machine may be configured to receive a current desired drill string rotation speed and drill string feed speed information from the joystick and lock the current desired drill string rotation speed and the desired drill string feed speed upon activation of a switch mechanism. |
| US10851579B2 |
Composite molded shell with stiffening inner core for interior trim molding applications
A composite trim molding assembly includes a composite outer shell having at least one pressed or molded surface feature and a core disposed within the composite outer shell for at least one of strengthening or stiffening the outer shell. The composite trim molding assembly can be configured as a door jamb. For example, the composite outer shell can include a flat jamb, and the at least one pressed or molded surface feature can include a stop. The core can include a protrusion into a cavity formed by the stop. The cavity formed by the stop may also be hollow. The composite outer shell can be molded from a slurry and/or pressed from a flat composite panel. The at least one pressed or molded surface feature can include a surface texture (e.g., a wood grain pattern). The core can include segments fastened together, particle board, and/or fiberboard. |
| US10851576B2 |
Anti-pinch circuit device for an apparatus for automatic movement of sliding windows in a motor vehicle, and corresponding method
An apparatus for automatic movement of sliding windows in a motor vehicle, comprising a d.c. electric motor that moves a window (F) so that it slides along guides, including an electronic control module for controlling the d.c. electric motor, in particular a microprocessor. The electronic control module measures a current (I) of the motor and a position (X) of the window (F), and drives reversal of operation of the electric motor if it is verified that the current (I) is higher than a threshold current (Ith) and the position (X) of the window (F) falls within a given zone (APZ) of a path (P) of movement of the window (F). The anti-pinch circuit device measures a back electromotive force (E; Em) of the motor, and the electronic control module calculates the position of the window (F) as a function of the back electromotive force (E; Em) of the motor. |
| US10851572B1 |
Height compensating sliding fenestration systems and methods
Sliding fenestration systems that compensate for changes in opening height after installation and methods of installing such sliding fenestration systems are described herein. The head track of a sliding fenestration system moves vertically relative to the bottom of the building opening to compensate for changes in building opening height while still maintaining lateral support for the panels in the sliding fenestration system by virtue of a direct connection between the head track and the top of the building opening. |
| US10851569B2 |
Telescoping door with swing clear breakout hinge
A telescoping door system includes a header that spans across a doorway. A trailing jamb and a lead jamb disposed a clear opening distance from the trailing jamb defines a clear opening of the doorway. A sidelite panel is coupled to the trailing jamb by at least one swing clear hinge; the swing clear hinge comprises a fixed gear portion intermeshed with a revolving gear portion. A slow slide panel and a fast slide panel move linearly within the header. The slow and fast slide panels are configured to create a first-sized opening when positioned in the header. The sidelite panel, the slow slide panel, and the fast slide panel are configured to pivot out of the header in a breakout position such that a trailing rail of the sidelite panel is disposed at least partially outside the clear opening and in front of the trailing jamb. |
| US10851567B2 |
Front pull latch
A latch that can be unlatched with a force exerted on a front handle of a drawer or other enclosure. The latch includes an end cap that interacts with a cam surface of a body and, upon doing so, disengages the catch from an opening on a strike plate or cabinet body. When the catch is disengaged, the latch can allow for the opening of the enclosure. The latch therefore allows for a simple forward motion to open and close the latch, and further allows the latch to be used with many different enclosures. |
| US10851566B2 |
Latch actuator and method of actuating a latch
A latch actuator comprises a motor, a speed reduction gearing coupled to an output shaft of the motor, a spindle, and a motion conversion mechanism. The spindle has a threaded portion in engagement with the speed reduction gearing. The spindle is supported to be rotatable about an axis. The threaded portion is rotationally fixed relative to the spindle. The motion conversion mechanism is configured to cause a displacement of the spindle along the axis when the spindle rotates. |
| US10851562B2 |
Passive continuity monitoring device with active features
A passive continuity monitoring device is disclosed. This device can be used to protect a lock or other locking device and to indicate when a breach of the lock has occurred. The lock can include a connector with a magnet at one end spaced from an other magnet. The connector can be held in tension when the lock is engaged to maintain the spacing between the magnets. A breach in the loop of the system will cause the magnets to touch and complete a circuit. The completion of the circuit can trigger an alarm, can take a picture of the surrounding area, and can transmit a signal to interested parties. |
| US10851560B2 |
Fence system
A fence section includes an upper horizontal rail and a lower horizontal rail extending along respective upper and lower rail axes. A horizontal upper wall of the upper rail includes apertures spaced apart along the length of the upper rail. Vertical members extend beyond the upper wall through an internal cavity of the upper rail and through a respective aperture. The upper rail includes a first counterpart of a connecting structure for connecting at least one vertical member to the upper rail, the first counterpart being integrally formed with the upper rail. The at least one vertical member includes a second counterpart of the connecting structure, the second counterpart being integrally formed with the vertical member and configured to directly engage the first counterpart of the upper rail upon insertion of the vertical member through the respective aperture in the upper wall of the upper rail. |
| US10851559B2 |
Combination of foundation anchor and energy damper for vertical liquid storage tanks, vertical pressure container, silo or the like with a thin wall and a continuous support
The invention relates to a combination of a foundation anchor and energy damper for vertical tanks or similar containers for liquids with a thin wall and continuous support, comprising an energy dissipation component centrally connected to a foundation anchor component by means of a linking component, the energy dissipation component comprising one or more superimposed and horizontally arranged energy dissipating plates with a rhombic shape truncated at the vertices thereof, wherein the shorter diagonal is normal to the wall of the tank and the side ends or vertices corresponding to the longer diagonal have quadrangular extensions for support on a load transmission component that is connected to the wall of the tank so as to transmit and distribute the forces developed by the one or more energy dissipating plates. Alternatively, the energy dissipating plates are trapezoidal with the longer parallel side tangential to the wall of the tank. |
| US10851555B1 |
Lid and strainer basket assembly and pool skimmer incorporating same
A lid and strainer basket assembly for use in a recirculating system of a swimming pool installation including a swimming pool and a deck, the recirculating system having a skimmer device extending downwardly from an opening proximate to the deck and coupled to a pump for recirculating the water in the swimming pool, the lid and strainer basket assembly including a removable lid closing the opening, a strainer basket in the skimmer device for collecting debris from the water, and an assembly of straps coupling the removable lid to the strainer basket, the straps being both sufficiently flexible and slacked between the lid and the strainer basket to enable the lid to be removed from the opening and tipped to one side to enable visual inspection of the strainer basket in the skimmer device without interference from the straps and without disturbing the strainer basket. |
| US10851554B1 |
Filtration of wave generator with wave dampening
A wave generating apparatus is provided, comprised of a wave pool, a wave generating chamber, and a filtration system. The filtration system comprises an intake, a pressurized return that releases water, and a filtration pump that pumps water from the intake to a pressurized return while filtering debris from the water. The pressurized return is located at a higher elevation relative to the intake. Water flows directionally from the pressurized return to the intake. |
| US10851553B2 |
Bar assembly
A bar assembly configured to transition between a bar configuration in which the bar assembly forms a bar structure and a box configuration in which the bar assembly forms a closed container. The bar assembly includes a base portion, lid portion, roof assembly, and bar. The base portion defines an upwardly opening interior area. The lid portion is configured to pivot between open and closed positions. The lid portion covers the interior area when in the closed position. Together, the base and lid portions define the closed container when the lid portion is in the closed position. The roof assembly includes an interior covering configured to be connected to the lid portion when the lid portion is in the open position. The bar is configured to be connected to the base portion. Together, the bar, the base portion, the lid portion, and the roof assembly define the bar structure. |
| US10851550B2 |
Flooring system
This invention relates to a method for adhering floor tiles together and the flooring system thereby created. The method utilizes individual adhesive units as fasteners for attachment of each floor tile to the next contiguous floor tile. The adhesive units are a multi-layered composite comprised of at least one adhesive layer and at least one layer of polymer film or textile substrate. When a series of floor tiles are attached to one another in this manner, a floating floorcovering article is achieved. |
| US10851547B2 |
Method of spectrally camouflaging a structure with a surrounding environment
Disclosed are methods to produce composite materials, which contain customized mixes of nano- and/or micro-particles with tailored electromagnetic spectral properties. In some defense-related applications, the use of such materials enables an improved spectral match between different structures, such as vehicles or buildings with the surrounding environment at least in the VIS and NIR wavelength range. This can camouflage the structures, and reduce the detectability thereof by ground-, air- or space-based multi-spectral long-range imaging systems, including aircrafts, drones, and satellites, and thus, generally delay, complicate, or eliminate detection or classification of the camouflaged structures. |
| US10851540B2 |
Anchor holders and anchor assemblies for metal decks
An anchor holder for concrete decks comprises a body for being inserted into an opening in a metal deck, the body including an outside vertical wall and an opening for receiving an anchor. The body includes arms normally biased extending outwardly from the vertical wall, the arms being collapsible toward the body when the body is inserted into the opening in the metal deck and expanding outwardly after passing the opening to be disposed below the metal deck. A support is attached to the body, the support to engage a top surface of the metal deck to apply an upward force on the body and keep the collapsible arms engaged against an underside of the metal deck when the body is attached to the metal deck. |
| US10851537B2 |
Assemblable structural column joint connection using fiber-reinforced concrete filled round double steel tubes and mounting method thereof
An assemblable structural column joint connection using fiber-reinforced concrete filled round double steel tubes, including an outer high-strength round steel tube, an inner high-strength round steel tube and a round separation plate. The wedge-shaped teeth are provided at two sides of the outer and inner high-strength steel tubes, and wedge-shaped teeth spaced are uniformly distributed along circumferences of the inner and outer high-strength round steel tubes. The round separation plate includes a round plate provided with a central through-hole, and vertical separation walls are provided with on upper and lower surfaces of the round plate. The vertical separation walls are provided with wedge-shaped sliding grooves matching the wedge-shaped teeth. The inner and outer high-strength round steel tubes are fixedly connected to the round separation plate by matching the wedge-shaped teeth with the wedge-shaped sliding grooves. |
| US10851536B2 |
Balcony installation
A balcony includes a balcony assembly and a structural post and outrigger system. The structural posts provide structural support for buildings and include the outriggers that extend substantially perpendicularly from the structural posts to a location where the balcony assembly will be installed. The outriggers include a tube or beam and an end plate on an end of the beam distal from the structural post. The balcony assembly includes at least one long beam, a platform, and a locking mechanism on an end of the long beam. The locking mechanism includes a channel for receiving and securing the end plate of the outrigger. The balcony assembly is secured to the outrigger using fasteners. |
| US10851533B2 |
Sanitary washing device
The toilet device includes a toilet 800 and a sanitary washing device 100 mounted on the toilet 800. The sanitary washing device 100 includes a nozzle 473, a casing 400, a toilet seat 200, a toilet lid 300, and an illuminator 700. When the user operates an operation part 500 built into the interior of the casing 400, the nozzle 473 is advanced into the bowl 801 of the toilet 800. The casing 400 includes a nozzle container 480 that can store the entire nozzle 473. The illuminator 700 irradiates sterilizing light which is light having a sterilizing action. The illuminator 700 irradiates the sterilizing light L directly on the front surface 473a of the nozzle 473 and/or the part 480c of the bottom surface part 480b positioned below the front surface 473a. |
| US10851528B2 |
Liftable and adjustable shower device
A liftable and adjustable shower device, that includes: an outer tube, an inner tube, an upper fixing seat, and a liftable tube. The outer tube is disposed in the shower device; and the inner tube is disposed in the outer tube. The upper fixing seat is disposed around an upper end of the outer tube. The liftable tube is sleeved around the inner tube, the liftable tube is insertable from an upper end of the upper fixing seat, to sleeve around outside the outer tube. |
| US10851527B2 |
Pull-out hose device having a fluid connector and sanitary shower
A pull-out hose device includes a hose box with a box housing, a pull-out hose held on the box housing to be pulled out and having at least one hose bend accommodated in the box housing, and a fluid connector for the pull-out hose. According to an illustrative embodiment, the hose box has a box holding frame to which the box housing is removably attachable in a mounting direction and is detachable therefrom in a demounting direction. The fluid connector includes a first connector part disposed on the box housing, to which connector part the pull-out hose is connected with one hose end, and a second connector part disposed on the box holding frame. The first and the second connector parts are connectable to each other in a fluid-tight manner in the mounting direction and are disconnectable from each other in the demounting direction. |
| US10851525B2 |
Covering system with reduced rattling tendency for flush-mounted controls
A covering system is provided having a cover, with a first mounting geometry at least partially running circumferentially around the cover, a carrier plate designed to attach the cover, a seal at least partially running circumferentially around the carrier plate, and an elastic mounting geometry that is formed on the seal. The first mounting geometry and the elastic mounting geometry are designed and arranged for positive engagement with each other. |
| US10851522B2 |
Work vehicle
The work vehicle includes: a working device; an auxiliary machine; and a priority valve that is switched between a normal position for directing pressure oil from an accessory pump toward the auxiliary machine and a merging position for directing the pressure oil from the accessory pump toward the working device. The work vehicle includes a control device that holds the priority valve in the normal position in case either the forward direction or the reverse direction which is indicated by a forward reverse operating device and a travel direction of the work vehicle do not match each other, and that switches the priority valve to the merging position in case either the forward direction or the reverse direction which is indicated by the forward reverse operating device and a travel direction of the work vehicle match each other and an operating device is in an operated state. |
| US10851519B2 |
Guard rail system
A guard rail system includes a bracket portion adapted to at least partially surround at least a portion of a track of a machine. The guard rail system includes at least one retention device provided in association with the bracket portion. The at least one retention device is adapted to removably affix the bracket portion to the portion of the track. The guard rail system also includes at least one receiving unit located on the bracket portion. The guard rail system further includes a rail member adapted to be removably affixed to the at least one receiving unit. |
| US10851515B2 |
Skirt for forming an access hatch in concrete
A skirt supports an access hatch at a predetermined height as the hatch is formed in concrete. The skirt can be permanently embedded in the concrete. The skirt includes a rigid frame defining a central opening, the frame has an inner surface and an outer surface opposite the inner surface. The frame defines a height between the upper edge and the lower edge. The height of the skirt is predetermined such that the combined height of the skirt and the hatch approximate the desired thickness of the concrete slab. The skirt may include an alignment tab extending from the frame at an angle with respect to the frame, with the alignment tab extending above the upper edge of the frame to guide the hatch into alignment with the upper edge of the frame as the hatch is moved into position on the skirt. |
| US10851514B2 |
Building block and methods
A concrete building block (30) includes a body (32) having opposite first (34) and second sides (36), opposite first (38) and second end faces (40) extending between the first and second sides (34, 36), and opposite first (42) and second bearing faces (44) extending between the first and second sides (34, 36) and the first and second end faces (38, 40). The first side has a first section (52) and second section (54). The first section (52) and first end face (38) are shaped to mate with each other when a like block (30) is rotated 90° and oriented adjacent thereto so that the center plane for the two blocks (30) are perpendicular to each other; and the second section (54) and second end face (40) are shaped to mate with each other when a like block (30) is rotated 90° and oriented adjacent thereto so that the center plane for the two blocks (30) are perpendicular to each other. The building block (30) can be used for structures such as a free standing wall, retaining wall, garden wall, or columns. |
| US10851510B2 |
Deicing device and method of manufacture
An ice melting device formed into an impact dispersion projectile for melting ice. The projectile being formed of salt and other ice melting chemicals. The ice melting compound is mixed, placed into a jig, dipped into a combination of liquid detergent and water then drained, compressed, heated, and then cooled. The projectile may then be removed from the jig and packaged. The projectile may be thrown by an individual onto an ice coated surface where the projectile upon impact will disintegrate and disperse the ice melting salt and ice melting chemicals onto the ice coated surface initiating the melting of the ice. |
| US10851505B2 |
Animal waste disposal mat
An animal waste disposal mat, including a main body, a plurality of side flaps each connected to different parts of the main body at first edges, respectively, and a drawstring to connect tip portions of each of the plurality of side flaps together, such that a pulling of the drawstring causes the tip portions of the plurality of side flaps to move toward a direction toward a center point of the main body. |
| US10851503B2 |
Tension end treatment for guardrail safety system
An end treatment for a guardrail safety system includes a terminal portion of a guardrail beam comprising a downstream end and upstream end, a first tension cable coupled to an upstream end of the terminal portion. An extruder configured to receive at least a portion of the guardrail beam and at least a portion of the first tension cable, and a terminal support post installed adjacent the roadway at an upstream end of the terminal portion of the guardrail beam. The extruder includes a narrowing throat providing a channel in which at least a portion of the guardrail beam is disposed. The narrowing throat is configured to flatten the guardrail beam in response to a collision with a vehicle moving the extruder in a downstream direction along the guardrail beam. The terminal support post coupled to an upstream end of the first tension cable. |
| US10851500B2 |
Recycled asphalt compositions and methods thereof
A pavement composition includes a recycled hot mix asphalt (HMA) sheet mix composition including more than 50% and up to 100% recycled fines mixed with a rejuvenating agent. The recycled fines of the HMA sheet mix are separated from a reclaimed asphalt pavement (RAP) composition and substantially all of the recycled fines are capable of passing through a sieve having an opening size of ⅜ inch (9.5 mm). Pavement systems include an existing pavement layer and a thin-lift overlay made of the recycled HMA sheet mix on the existing pavement layer. Pavement systems also include a three-layer system including a leveling course layer, an interlayer, and a surface course layer in which the leveling course layer and/or the surface course layer include a recycled HMA sheet mix composition. |
| US10851491B1 |
Ionic oxidation refreshing system and method
An ionic oxidation refreshing system for refreshing odorized items, comprising an enclosure to contact the odorized items; an ionizing stage mechanism that produces an ionized ozone gas mixture inside of the enclosure, killing germs, including odor-causing bacteria, viruses, molds, and fungus; and a filtering stage mechanism that neutralizes and filters out any toxic by-products including one or more of ozone, nitric acid, aldehydes, and VOCs resulting from surface oxidation of the odorized items by the ionized ozone gas mixture. |
| US10851487B2 |
Appliance with context-sensitive fixed-position user interface
An appliance and method utilize a context-sensitive fixed-position user interface including cycle type controls used to select a cycle type and cycle configuration controls used to configure settings associated with particular cycle types. Indicators of the cycle type and cycle configuration controls are selectively set to active or inactive states during cycle type selection and cycle configuration phases to facilitate user configuration of settings for the appliance prior to performing an appliance cycle. |
| US10851485B2 |
Multifunctional dyeing and finishing kettle and industrialized supercritical CO2 fluid anhydrous dyeing and finishing apparatus with a scale over 1000 liters
The present invention discloses a multifunctional dyeing and finishing kettle and a production-type supercritical CO2 fluid anhydrous dyeing and finishing apparatus with a scale over 1000 liters. The production-type supercritical CO2 fluid anhydrous dyeing and finishing apparatus mainly comprises a CO2 low-temperature storage tank, a CO2 supply storage tank, a low-temperature transfer pump, an ethylene glycol head tank, an ethylene glycol pump, a water cooling tower, a water pump, a refrigeration unit, a condenser, a heat exchanger, a heat transfer oil system, a heat transfer oil replenishment system, a precooler, a CO2 boost pump, a dye kettle, a feeder, a multifunctional dyeing and finishing kettle, a CO2 circulation pump, a cooler, a separation kettle, an adsorber and a recovery compressor, an on-line monitoring system and an automatic control system. The apparatus is capable of meeting single-color or multi-color dyeing and finishing production of a plurality of textiles. |
| US10851484B2 |
Patterned tufted articles, and systems and methods for making same
A tufted article having a backing material and a plurality of tufts. The plurality of tufts can include cut tufts having first and second tuft portions projecting from a face surface of the backing material. The first and second tuft portions of each cut tuft have respective pile heights relative to the backing material. Each cut tuft also has a backstitch that joins the first and second tuft portions and extends across a portion of a back surface of the backing material. The plurality of tufts includes a plurality of asymmetric cut tufts that have first and second tuft portions with unequal pile heights. Systems and methods for making tufted articles having asymmetric cut tufts are also disclosed. |
| US10851483B2 |
Sewing system
A sewing system serves for sewing seams which the multi-dimensionally in space. A needle-bar upper part of a sewing head is mounted so as to be pivotable in a driven manner about a needle-bar longitudinal axis. A gripper lower part is mounted so as to be pivotable in a driven manner, and in a manner synchronous with the needle-bar upper part, about the needle-bar longitudinal axis, in the sewing-head lower part. Motor components for driving the movement of a needle bar, for pivoting the needle-bar upper part, for driving a gripper in a manner synchronous with the needle bar and for pivoting the gripper lower part are disposed outside the needle-bar upper part and outside the gripper lower part. Parts to be sewn that are topographically non-uniform are also rendered accessible. |
| US10851482B2 |
Protected float
A knitted component may include a course of a first yarn type and a course of a second yarn type, a first surface at least partially formed by the course of the first yarn type, and a cavity formed within the knitted component that is recessed relative to the first surface. A first float formed by the course of the second yarn type may extend across the cavity and may be exposed, and the course of the second yarn type may include a stitch that is knitted into the knitted component adjacent the float. |
| US10851480B2 |
Recycled fancy yarn and manufacturing method thereof
A recycled fancy yarn includes at least two core strands forming a warp thread, and at least one ornamental strand that is twined, twisted or wound around the warp thread to form a weft thread. The core strand is formed by a single first monofilament or a single first filament bundle, and the ornamental strand is formed by a single second monofilament or a single second filament bundle. The first monofilament and/or second monofilament is made of an environmentally friendly material; or the recycled fancy yarn can be recycled or naturally decomposed in the environment, such that the quantity of produced wastes can be reduced, and environmental burden is hardly caused. |
| US10851461B2 |
Treated anodized metal article and method of making
A method is disclosed for treating an anodized metal surface. According to the method, polynuclear clusters comprising aluminum oxide hydroxide are applied to the anodized metal surface. |
| US10851460B2 |
Coating for a vapor chamber
In example implementations, a vapor chamber is provided. The vapor chamber includes a metallic housing. A nickel coating is applied on inside walls of the metallic housing. A silica derived carbon nanotube (CNT) aerogel coating is applied on the nickel coating on the inside walls of the metallic housing. The silica derived CNT aerogel coating is sprayed onto the nickel coating, dried and cured. |
| US10851459B2 |
Dichlorosilane compensating control strategy for improved polycrystalline silicon growth
A method of improving polycrystalline silicon growth in a reactor, including: introducing a chlorosilane feed composition comprising trichlorosilane and dichlorosilane into a deposition chamber, wherein the deposition chamber contains a substrate; blending the chlorosilane feed composition with hydrogen gas to form a feed composition; adjusting a baseline flow of chlorosilane and hydrogen gas into the deposition chamber to achieve a pre-determined total flow and a pre-determined chlorosilane feed composition set point; applying pressure to the deposition chamber and energy to the substrate in the deposition chamber to form polycrystalline silicon; measuring the amount of dichlorosilane present in the chlorosilane feed composition and determining an offset value from a target value of dichlorosilane present in the chlorosilane feed composition; adjusting the chlorosilane feed composition set point by an amount inversely proportional to the dichlorosilane offset value; and depositing the formed polycrystalline silicon onto the substrate. |
| US10851458B2 |
Connector for substrate support with embedded temperature sensors
A substrate support for a plasma system includes a first layer being made of a ceramic and having a first surface and a second surface opposite the first surface. The first layer is configured to support a substrate on the first surface during processing. A thermal heating element is embedded within the ceramic. A temperature sensor that is embedded within the ceramic. Electrically conductive pads are: electrically connected to the temperature sensor via first wires embedded in the ceramic; and formed on the second surface of the first layer. A second layer includes a through hole through the second layer. A connector extends through the through hole and that includes: a retainer; and electrical conductors that are held by the retainer and that include: first ends that are electrically connected to the electrically conductive pads, respectively; and second ends that are electrically connected to a temperature controller by wire. |
| US10851452B2 |
Methods for evaporating and depositing high vapor pressure materials
A method is disclosed, which can comprise via a transonic gas jet, depositing a thin film of LiPON on a substrate via a directed vapor deposition process. The transonic gas jet transports a thermally evaporated vapor cloud comprising the LiPON, wherein, the transonic gas jet comprises one of (a) substantially entirely nitrogen (N2) gas; or (b) nitrogen (N2) gas as a dopant in a concentration greater than 10% by volume in an inert carrier gas. |
| US10851446B2 |
Solid state grain alignment of permanent magnets in near-final shape
Magnet microstructure manipulation in the solid state by controlled application of a sufficient stress in a direction during high temperature annealing in a single-phase region of heat-treatable magnet alloys, e.g., alnico-type magnets is followed by magnetic annealing and draw annealing to improve coercivity and saturation magnetization properties. The solid-state process can be termed highly controlled abnormal grain growth (hereafter AGG) and will make aligned sintered anisotropic magnets that meet or exceed the magnetic properties of cast versions of the same alloy types. |
| US10851443B2 |
Magnesium composite containing physically bonded magnesium particles
A reinforced magnesium composite, and a method of producing thereof, wherein the reinforced magnesium composite comprises elemental magnesium particles, elemental nickel particles, and one or more ceramic particles with elemental nickel particles being dispersed within elemental magnesium particles without having intermetallic compounds therebetween. Various embodiments of the method of producing the reinforced magnesium composite are also provided. |
| US10851441B2 |
Plug-in connector and semi-finished product made from an aluminum alloy strip
A plug-in connector and a semi-finished product include a strip of an aluminum alloy and at least one bonding layer of a copper/tin alloy electrolytically applied directly onto the aluminum alloy strip. The bonding layer has a thickness of at most 50 nm. A further metal layer or alloy layer is applied onto the bonding layer. |
| US10851439B2 |
Titanium-based alloy and method for manufacturing a titanium-based alloy component by an additive manufacturing process
A titanium-based alloy includes 0.001-1.0 wt. % in total of at least one lanthanide series element, remainder of titanium and impurities. |
| US10851437B2 |
Custom titanium alloy for 3-D printing and method of making same
A Ti-6A1-4V titanium powder alloy composition having enhanced strength resulting from the addition of one or more of the following elements without requiring an increase in oxygen content: Aluminum Iron Nitrogen Carbon The composition may also be used for Ti-6A1-4V titanium alloy starting bar stock. |
| US10851436B2 |
Method for joining steel rails with controlled weld heat input
A method for creating a welded joint between ends of two steel rails, wherein the two steel rails have a substantially pearlitic microstructure. The method includes a first heating step, an upsetting step, a first cooling step, and a second heating step and provides a means to influence a microstructure and hardness of an austenitic region of a heat affected zone (HAZ) and/or an extent of softening in a softened region of a HAZ. |
| US10851434B2 |
Steel sheet for can and method for manufacturing the same
A steel sheet for a can having sufficient hardness and a method for manufacturing the steel sheet. The steel sheet has a chemical composition containing, by mass %, C: 0.0005% or more and 0.0030% or less, Si: 0.05% or less, Mn: 0.50% or more and 1.00% or less, P: 0.030% or less, S: 0.020% or less, Al: 0.01% or more and 0.04% or less, N: 0.0010% or more and 0.0050% or less, B: 0.0005% or more and 0.0050% or less, and Fe and inevitable impurities. Additionally, the steel sheet has a hardness (HR30T) of 56 or more, and an average Young's modulus of 215 GPa or more. |
| US10851433B2 |
Manufacturing method of mechanical component using martensitic stainless steel, rotating device, rolling bearing and rolling bearing unit
A martensitic stainless steel containing, by mass %, C: 0.20% to 0.40%, N: 0.1% or less, Mo: 3% or less, and Cr: 12.0% to 16.0%, such that 0.3%≤C+N≤0.4% and a PI value (=Cr+3.3Mo+16N) is 18 or more, with the remainder being substantially Fe and unavoidable impurities is quenched from a temperature of 1,030° C. to 1,140° C. and subjected to a subzero treatment and tempering so as to obtain a prior austenite crystal grain size of a surface layer of 30 μm to 100 μm and a surface hardness of 58 HRc to 62 HRc. |
| US10851432B2 |
Ultra-high strength and ultra-high toughness casing steel, oil casing, and manufacturing method thereof
The present invention discloses an ultra-high strength and ultra-high toughness casing steel, having a microstructure of tempered sorbite, and the content of chemical elements by mass percent thereof being as follows: C: 0.1-0.22%, Si: 0.1-0.4%, Mn: 0.5-1.5%, Cr: 1-1.5%, Mo: 1-1.5%, Nb: 0.01-0.04%, V: 0.2-0.3%, Al: 0.01-0.05%, Ca: 0.0005-0.005%, the balance being Fe and unavoidable impurities. Correspondingly, the invention also discloses a casing obtained by processing the ultra-high strength and ultra-high toughness casing steel and a manufacturing method thereof. The ultra-high strength and ultra-toughness casing steel and the casing of the present invention have a strength of 155 ksi or more and an impact toughness greater than 10% of its yield strength value, thereby realizing a combination of ultra-high strength and ultra-high toughness. |
| US10851431B2 |
Grain-oriented electrical steel sheet and manufacturing method therefor
A method for manufacturing a grain-oriented electrical steel sheet, according to an embodiment of the present invention includes: heating a slab, based on 100 wt % of a total composition thereof, including N at 0.0005 wt % to 0.015 wt %, Ti at 0.0001 wt % to 0.020 wt %, V at 0.0001 wt % to 0.020 wt %, Nb at 0.0001 wt % to 0.020 wt %, B at 0.0001 wt % to 0.020 wt %, and the remaining portion including Fe and other impurities, and then hot rolling it to prepare a hot-rolled steel sheet; annealing the hot-rolled steel sheet; after the hot-rolled steel sheet is annealed, cooling the hot-rolled steel sheet, and then cold rolling it to prepare a cold-rolled steel sheet; decarburization-annealing the cold-rolled steel sheet and then nitriding-annealing it, or simultaneously performing the decarburization-annealing and the nitriding-annealing; and final-annealing the decarburization-annealed and nitriding-annealed steel sheet. |
| US10851429B2 |
Mixed sugar granular powder and method for preparing same
The present invention relates to a granular form of mixed saccharide composition comprising a mixed saccharide containing psicose as a main ingredient and a method for preparing the same, and more particularly to a granule of a mixed saccharide containing psicose with improved sweetness quality and physical properties and a method for preparing the same. |
| US10851427B2 |
Method for breast cancer recurrence prediction under endocrine treatment
The present invention relates to methods, kits and systems for the prognosis of the disease outcome of breast cancer, said method comprising: (a) determining in a tumor sample from said patient the RNA expression levels of at least 2 of the following 9 genes: UBE2C, BIRC5, RACGAP1, DHCR7, STC2, AZGP1, RBBP8, IL6ST, and MGP (b) mathematically combining expression level values for the genes of the said set which values were determined in the tumor sample to yield a combined score, wherein said combined score is indicative of a prognosis of said patient; and kits and systems for performing said method. |
| US10851426B2 |
System and method for isolating and analyzing cells
A system and method for isolating cells, comprising: a substrate having a broad surface; an array comprising a set of wells defined at the broad surface of the substrate, each well including: a base surface, an open surface directly opposing the base surface, defined at the broad surface of the substrate, and configured to receive one of a single cell and a single cluster of cells from a direction perpendicular to the broad surface of the substrate, and a set of channels that fluidly couple each well to at least one adjacent well; wherein the set of wells includes an interior subset and an exterior subset fluidly coupled to and surrounding the interior subset by way of the set of channels; and a fluid delivery module surrounding the array and fluidly coupled to each well in the set of wells. |
| US10851424B2 |
MicroRNA profiling for diagnosis of dysplastic nevi and melanoma
Provided herein are methods for miRNA profiling for the diagnosis, prognosis, and management of melanoma and differentiation of melanoma from nevi. |
| US10851421B2 |
Next generation RNA-sequencing and long non-coding RNA in glioblastoma multiforme
LncRNAs are emerging as important oncogenic drivers in many cancers, but comprehensive, agnostic studies to identify key lncRNAs involved in GBM are lacking. Described herein are new lncRNA involved in gliomagenesis and prognosis, elucidating the biological functions of these relatively unknown biological actors and opening new therapeutic avenues for therapeutic development. |
| US10851418B2 |
Blood biomarkers for respiratory infections
Methods and kits for diagnosing and/or treating a lower respiratory infection in a subject include obtaining a biological sample from the subject; detecting RNA expression levels of one or more biomarkers in the biological sample and comparing the expression levels of the one or more three biomarkers to at least one invariant control marker wherein an increase or decrease in the level of expression of the one or more biomarkers as compared to the at least one invariant control marker is indicative of a lower respiratory infection. |
| US10851415B2 |
Molecular predictors of sepsis
Sepsis remains a leading cause of morbidity and mortality in neonates worldwide. There is also clinically a low threshold for suspicion of infection in neonates, in particular as presentation varies greatly from very subtle to catastrophic collapse. The lack of reliably sensitive tests and the potential life-threatening consequences of delayed treatment of infection results in the widespread use of empirical antibiotics exposing many infants without infection to broad-spectrum antibiotics. The present invention provides a series of patient-invariant biomarkers for screening neonates and other subjects for infection that predicts bacterial infection with high accuracy; and is further shown to have predictive value in identifying infection in suspected cases with blood-culture negative tests. |
| US10851412B2 |
Cell potency assay for therapeutic potential
The invention provides cell potency assays for measuring, determining, identifying, confirming, or validating the therapeutic potential of a cell population. Cell potency assays may be performed with various types of cells, including stem or progenitor cells, such as, for example, hematopoietic stem or progenitor cells. Cell potency assays may also be performed on stem or progenitor cells that have been treated with one or more agents to enhance therapeutic potential. Hematopoietic cells having therapeutic potential are useful in downstream clinical applications for increasing engraftment, reconstitution, homing, and proliferation in vivo. |
| US10851411B2 |
Molecular identification with subnanometer localization accuracy
The present invention relates to methods of determining the sequence of nucleotides in target nucleic acid molecules. Thus, the invention relates to methods of sub-unit sequencing. The methods comprise the use of identification nucleic acid detection entities which specifically hybridize to the target nucleic acid, bind identification tags and have localization tags transiently bind thereto. |
| US10851409B2 |
Hairpin loop method for double strand polynucleotide sequencing using transmembrane pores
The invention relates to a new method of sequencing a double stranded target polynucleotide. The two strands of the double stranded target polynucleotide are linked by a bridging moiety. The two strands of the target polynucleotide are separated using a polynucleotide binding protein and the target polynucleotide is sequenced using a transmembrane pore. |
| US10851408B2 |
Methods and kits for detecting gene mutations
The invention relates to methods, kits and uses thereof for detecting gene mutations. The method comprises the step of: providing a mixture of nucleic acid molecules comprising both a genomic DNA and a RNA molecule derived from said genomic DNA, performing a reverse transcription reaction with a reverse transcriptase to provide cDNA molecules from said RNA molecule in said mixture; and performing PCR using both said genomic DNA and said cDNA molecules as templates. This method can simultaneously detect a trace amount of a mutation in both DNA and RNA from a whole blood sample using a small amount of sample. At the same time, by adjusting the reaction system, the detection limit of a mutant in a background of wild-type molecules can reach 0.01% or lower. |
| US10851400B2 |
Assay for high-throughput identification of therapeutic compounds
A solid supported branched linker assay system, including an alpha compound and a beta compounds reversibly tethered to a solid support; a branched linker coupled to the solid support that tethers the alpha and beta compounds to the solid support; the branched linker having two cleavable linkers that are chemically distinct from one another, wherein a first chemically distinct linker tethers the β compound to the branched linker and a second chemically distinct linker tethers the α compound to the branched linker; and at least two means for cleaving the chemically distinct linkers, wherein a first cleavage means is configured to selectively cleave a first chemically distinct linker and a second cleavage means is configured to selectively cleave a second chemically distinct linker. |
| US10851397B2 |
Ketoreductase polypeptides for the production of (R)-3-hydroxythiolane
The present disclosure provides engineered ketoreductase enzymes having improved properties as compared to a naturally occurring wild-type ketoreductase enzyme. Also provided are polynucleotides encoding the engineered ketoreductase enzymes, host cells capable of expressing the engineered ketoreductase enzymes, and methods of using the engineered ketoreductase enzymes to synthesize chiral compounds. |
| US10851396B2 |
Acidophilic fusarium oxysporum strains, methods of their production and methods of their use
The present invention provides isolated acidophilic Fusarium oxysporum strains, such as MK7, and their progeny, compositions comprising such strains and their progeny, methods of producing such strains and their progeny, and methods of using such strains and their progeny. |
| US10851392B2 |
Method for producing methacrylic acid ester
Provided is a method for producing a methacrylic acid ester using a biocatalyst, said method comprising a step for treating methacrylyl-CoA with an alcohol or phenol in the presence of an alcohol acyltransferase to synthesize the methacrylic acid ester. According to this production method, a methacrylic acid ester can be efficiently produced while largely reducing energy, resource and environmental load, compared with the conventional chemical production processes. |
| US10851391B2 |
Dry-milling process
A dry-milling process for the production of dried distiller's grains with solubles (“DDGS”) includes the steps of dry-milling corn kernels to form a corn flour comprising corn fiber; combining the corn flour with water to form a mash; separating the corn fiber from the mash; treating the separated corn fiber with a composition; combining the treated corn fiber with the mash having the corn fiber separated therefrom to form a slurry; fermenting the slurry to produce beer and carbon dioxide; distilling the beer to produce ethanol and whole stillage; and processing the whole stillage to produce DDGS. The composition includes an alkanesulfonic acid, water, an enzyme, and optionally a surfactant. |
| US10851389B2 |
Modification of cells by introduction of exogenous material
The present disclosure provides methods and devices for rapid and efficient modification of a variety of cell types, including mammalian cells, plant cells, archaea, yeasts, and bacteria, by novel methods of introducing exogenous materials, e.g. nucleic acids. |
| US10851387B1 |
AXMI253 and AXMI254 toxin genes and methods for their use
Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a toxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated toxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed, and antibodies specifically binding to those amino acid sequences. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:4-7, or the nucleotide sequence set forth in SEQ ID NO:1, 2, or 3, as well as variants and fragments thereof. |
| US10851381B2 |
Citrus tristeza virus based vectors for foreign gene/s expression
Disclosed herein are viral vectors based on modifications of the Citrus Tristeza virus useful for transfecting citrus trees for beneficial purposes. Included in the disclosure are viral vectors including one or more gene cassettes that encode heterologous polypeptide s. The gene cassettes are positioned at desirable locations on the viral genome so as to enable expression while preserving functionality of the virus. Also disclosed are methods of transfecting plants and plants transfected with viral vector embodiments. |
| US10851378B2 |
Methods of treating pain using anti-GPR160 antibodies
The disclosure provides methods and compositions for inhibiting pain by administering a GPR160 antagonist to a subject in need thereof. Also provided are methods of using GPR160 antagonists in combination with other pain therapies. |
| US10851377B2 |
Methods and compositions for treating a proprotein convertase subtilisin kexin (PCSK9) gene-associated disorder
The invention relates to methods of inhibiting the expression of a PCSK9 gene in a subject, as well as therapeutic and prophylactic methods for treating subjects having a lipid disorder, such as a hyperlipidemia using RNAi agents, e.g., double-stranded RNAi agents, targeting the PCSK9 gene. |
| US10851374B2 |
Compositions comprising eicosapentaenoic acid and mipomersen and methods of use thereof
The present invention relates to, inter alia, pharmaceutical compositions comprising a polyunsaturated fatty acid and to methods of using the same to treat or prevent cardiovascular-related diseases. |
| US10851373B2 |
Antisense nucleic acids
The present invention provides an oligomer which allows exon 45 skipping in the human dystrophin gene. |
| US10851370B1 |
Homologous recombination directed genome editing in eukaryotes
Disclosed herein are synthetic nucleic acids comprising a nucleic acid sequence that encodes a codon-Adapted Nuclear Argonaute protein (ANAGO) that is a species-specific to a eukaryote, and compositions comprising ANAGO and donor molecules for use in homologous recombination directed targeted gene editing in the eukaryote. |
| US10851361B2 |
Hemicellulase compositions
Hemicellulase that degrades corn non-starch polysaccharides (“NSP”), DNA encoding the same, and a method of using the hemicellulase and its DNA are provided. Proteins having hemicellulase activity such as Xyn5A, Xyn10B, Xyn11A, Xyn30A, and Xyn43A are described. |
| US10851347B2 |
Altered adherent stromal cells and methods of producing and using same
Disclosed herein are altered adherent stromal cells and methods of producing and utilizing same. |
| US10851346B2 |
MTOR/STAT3 signal inhibitor-treated mesenchymal stem cell having immunomodulatory activity, and cell therapy composition comprising same, for preventing or treating immune disorders
The present invention relates to a mesenchymal stem cell having immunomodulatory activity and a preparation method therefor and, more specifically, to: a rapamycin-treated mesenchymal stem cell having immunomodulatory activity, which expresses any one or more cell surface factors selected from the group consisting of CCR1, CCR2, CCR3, CCR4, CCR7, CCR9 and CXCR4; a cell therapy composition comprising the mesenchymal stem cell, for preventing or treating immune disorders; and a preparation method for the mesenchymal stem cell having immunomodulatory activity. The rapamycin-treated mesenchymal stem cell having immunomodulatory activity, according to the present invention, has increased expression of IDO, TGF-β and IL-10 which are factors having immunomodulatory activity, has decreased expression of Phospho-mTOR, Rictor and Ractor which are signal transduction factors of mTOR, and has increased expression, in the cell, of autophagic inducer Beclin1, ATG5, ATG7, LC3I or LCII. If this cell is used as a cell therapy in individuals having immune disorders, it is possible to effectively treat immune disorders. |
| US10851339B1 |
Instruments, modules, and methods for improved detection of edited sequences in live cells
The present disclosure provides instruments, modules and methods for improved detection of edited cells following nucleic acid-guided nuclease genome editing. The disclosure provides improved automated instruments that perform methods—including high throughput methods—for screening cells that have been subjected to editing and identifying cells that have been properly edited. |
| US10851336B2 |
Apparatus and methods for magnetic mixing
Methods and systems for magnetic mixing. Particular embodiments relate to applying a magnetic field to move a magnetically responsive component in a chamber. |
| US10851332B2 |
Multiple chamber distillation pot
A system including a distillation pot device; a dividing implement disposed on a proximate middle portion of the distillation pot device; a first chamber section disposed on a first side of the dividing implement, the first chamber section is configured to produce at least a first flavored drink or liquor; a first cap implement that is into engagement with a proximate top part of the first chamber section, said first cap implement is configured to capture rising steam from the first chamber section; a second chamber section disposed on a second side of said dividing implement that is configured to produce at least a second flavored drink or liquor; and a second cap implement, the second cap implement being into engagement with a proximate top part of said second chamber section, the second cap implement is configured to capture rising steam from the second chamber section. |
| US10851331B2 |
Solid controlled release carbonate detergent compositions
Solid detergent compositions for dishwashing or warewashing compositions and applications of use are disclosed. In particular, solid carbonate-based compositions that do not require a traditional dispenser for controlled rate of release over multiple cycles are disclosed. Compositions, methods of employ and cleaning using the same are disclosed. |
| US10851330B2 |
Method of improving paper machine fabric performance
Methods are provided for improving the papermaking process. In various embodiments, the methods include the application of alkali material in combination with an anionic polymeric dispersant and/or a hydroxyfunctional carboxylic acid to papermaking fabrics such that the application thereof removes contaminants from the papermaking fabrics and improves the drainage of said papermaking fabrics. Such alkali material in combination with an anionic polymeric dispersant and/or a hydroxyfunctional carboxylic acid can be applied as a single aqueous solution, and may further comprise a surfactant. |
| US10851329B2 |
Leuco colorants as bluing agents in laundry care compositions
A laundry care composition including: (a) at least one laundry care ingredient and (b) a leuco composition. The laundry care composition has a ΔHA of at least 10 and produces a relative hue angle on fabric outside the range of 210 to 345. Methods of treating textiles with such laundry care compositions. |
| US10851327B2 |
Methods of refining a grain oil composition feedstock, and related systems, compositions and uses
The present disclosure relates methods and systems for refining grain oil compositions using water, and related compositions produced therefrom. The present disclosure also relates to methods of using said compositions. The present disclosure also relates to methods of using grain oil derived from a fermentation product in an anti-foam composition. |
| US10851326B2 |
Blown and stripped blend of soybean oil and corn stillage oil
A method for producing a high viscosity, low volatiles blown stripped oil blend is provided. The method may include the steps of: (i) obtaining an oil blend of corn stillage oil and soybean oil having a weight ratio of corn stillage oil to soybean oil of from about 1:2 to 3:1; (ii) heating the oil blend to at least 90° C.; (iii) passing air through the heated oil blend to produce a blown oil having a viscosity of at least 50 cSt at 40° C.; and (iv) stripping the blown oil from step (iii) to reduce an acid value of the blown oil to less than 5.0 mg KOH/gram. |
| US10851325B2 |
Dry lubricant for conveying containers
The passage of a container along a conveyor is lubricated by applying to the container or conveyor a mixture of a water-miscible silicone material and a water-miscible lubricant. The mixture can be applied in relatively low amounts, to provide thin, substantially non-dripping lubricating films. In contrast to dilute aqueous lubricants, the lubricants of the invention provide drier lubrication of the conveyors and containers, a cleaner conveyor line and reduced lubricant usage, thereby reducing waste, cleanup and disposal problems. |
| US10851324B2 |
Grafted polymer with soot handling properties
The present disclosure relates to oxazoline modified lubricant additives that have dispersant properties and lubricating oil compositions comprising said dispersant lubricant additives. The disclosure also relates to the use of lubricant compositions comprising the additives of the disclosure for improving the soot or sludge handling characteristics of an engine lubricant composition, while minimizing the deterioration of engine seals. |
| US10851322B2 |
Engine oil additive for enhancing engine function and improving fuel efficiency
The present invention provides an engine oil additive for enhancing engine function and improving fuel economy, the additive allowing engine oil particles to be ionized and fragmented by natural minerals simply and inexpensively without a separate device, such that the interval at which the engine oil particles come into contact with the inner wall of an engine decreases and the plasma state is maintained so as to prevent cations and anions from coupling to each other in liquid, and fuel economy is improved while engine activity is enhanced. To this end, the additive is obtained by mixing 1.5-2 wt % of tourmaline, 0.8-1 wt % of sericite, 0.5-0.8 wt % of monazite and 0.3-0.5 of elvan, in a powder form of 2-3 μm into 95.7-96.9 wt % of a base oil so as to be added to an engine oil to be injected into an engine. |
| US10851320B2 |
Product compositions for dimethoxymethane oligomers mixed with distillate fuels
A composition comprising a distillate fuel, an oligomer portion comprising at least one dimethoxymethane oligomer, and a stabilizer comprising one or more alcohols. A composition comprising a distillate fuel, and an oligomer portion comprising at least one dimethoxymethane oligomer, DMMn, wherein n is less than 3 and/or greater than 4. A composition comprising a distillate fuel, and less than 10 volume percent of an oligomer portion, wherein the oligomer portion comprises at least one dimethoxymethane oligomer. A method comprising separating, from a mixture of DMMn oligomers, one or more DMMn fractions comprising oligomers of a desired chain length n, and combining a desired amount of one or more of the separated DMMn fractions with a distillate fuel to provide a fuel composition. A composition comprising a distillate fuel that includes renewable distillate fuel, DMMn and/or alcohol. |
| US10851319B2 |
Gasification system and method
A gasification system and a method for gasifying a particulate carbonaceous fuel are disclosed. The gasification system has a gasification chamber with an upper section and a lower section with a fuel inlet for injecting a particulate carbonaceous fuel and oxidant into the upper section whereby, in a thermo-chemical reaction, synthesis gas and residual char is generated. The gasification system further includes a separator configured to receive the synthesis gas and to separate residual tar form the synthesis gas. Further, there is a char bed disposed in the lower section formed by residual char generated in the thermo-chemical reaction and a gas-inlet at a bottom portion of the lower section for injecting gas into the char bed. The residual tar is injected into the char bed whereby, in a thermal cracking process, the residual tar is converted into synthesis gas. Hereby, it is possible to utilize the otherwise lost energy contained in the residual tar, and thereby achieve better efficiency in a gasification system, in a cost-effective and simple manner. |
| US10851316B2 |
Conversion of crude oil to aromatic and olefinic petrochemicals
A system includes a hydroprocessing zone configured to remove impurities from crude oil; a first separation unit configured to separate a liquid output from the hydroprocessing zone into a light fraction and a light fraction; an aromatic extraction subsystem configured to extract aromatic petrochemicals from the light fraction; and a fluid catalytic cracking unit configured to crack the heavy fraction into multiple products. |
| US10851315B1 |
Processes for increasing an octane value of a gasoline component
Processes for the production of a gasoline blend. A C7 portion of a naphtha stream is first isomerized to increase the branched, iso-paraffins, and then, the isomerized effluent is passed to a dehydrogenation reaction zone. In the dehydrogenation zone, the C7 saturated hydrocarbons are convert to C7 olefins. The C7 olefins have a higher octane number than the C7 saturated hydrocarbons, and the branched olefins have a higher octane number than the normal olefins. The C7 olefins can be blended in a gasoline pool. C5 and C6 hydrocarbons can be isomerized and dehydrogenated as well, separately or with the C7 components. |
| US10851313B2 |
Method of producing lower olefin and monocyclic aromatic hydrocarbon having 6 to 8 carbon atoms and device for producing lower olefin and monocyclic aromatic hydrocarbon having 6 to 8 carbon atoms
A method of producing a lower olefin and BTX from stock oils selected from at least two kinds of oils is provided. The method includes a first catalytic cracking step of bringing one stock oil A into contact with a catalytic cracking catalyst; a second catalytic cracking step of bringing one stock oil B, having an aromatic component content smaller than that of the stock oil A, into contact with the catalytic cracking catalyst; and a separation and collection step of collecting the lower olefins and BTX from a product generated in the first and second catalytic cracking steps. A contact time A during which the stock oil A is in contact with the catalytic cracking catalyst in the first catalytic cracking step is longer than a contact time B during which the stock oil B is in contact with the catalytic cracking catalyst in the second catalytic cracking step. |
| US10851312B1 |
Flash chemical ionizing pyrolysis of hydrocarbons
Flash chemical ionizing pyrolysis (FCIP) process. The FCIP includes mixing an iron source material, an alkali or alkaline earth metal chloride source material, an aqueous phase, and an oil component to form a feed emulsion; introducing the feed emulsion into an FCIP reactor at a temperature greater than about 400° C. up to about 600° C., a pressure from 10 to 50 psia and a residence time of 0.1 to 10 seconds, to form an FCIP effluent; and condensing a liquid ionizing pyrolyzate (LIP) from the effluent. The feed emulsion can be free of added solids other than the iron source material, the alkali or alkaline earth metal chloride source material, and any sediment in the oil component. |
| US10851307B2 |
System and method for pyrolysis using a liquid metal catalyst
A process for decomposing a hydrocarbon-containing composition includes feeding the hydrocarbon-containing composition to a reactor containing a catalytically active molten metal or a catalytically active molten metal alloy, wherein the metal or alloy catalyzes a decomposition reaction of the hydrocarbon-containing composition into a hydrogen-rich gas phase and a solid carbon phase. The solid carbon phase is insoluble in the metal or alloy. The process may be a continuous process. |
| US10851303B2 |
Azeotropic compositions comprising hydrogen fluoride and fluorocarbons
The present application discloses compositions comprising hydrogen fluoride and fluorinated compounds (e.g., hydrochlorofluorocarbons), wherein the fluorinated compound is present in the composition in an amount effective to form an azeotrope composition or azeotrope-like composition with the hydrogen fluoride. |
| US10851301B2 |
Liquid crystal medium
The present invention relates to a liquid crystal (LC) medium comprising a terphenyl compound and at least two polymerizable compounds, to a process for its preparation, to its use for optical, electro-optical and electronic purposes, in particular in LC displays, especially in an LC display of the polymer sustained alignment (PSA) type, and to an LC display, especially a PSA display, comprising it. |
| US10851300B1 |
Malleable surface material
An improved surface material is particularly suited for non-turf baseball field applications such as the pitcher's mound and base paths. The material generally comprises clay, wax, alkane fluid and sand and has a putty-like consistency. Cleats can penetrate the material but are not likely to pull it out in clumps upon removal of the cleats. Method for forming the surface includes spraying emulsified wax and/or alkane fluid on a surface and mixing it with the surface material. |
| US10851296B2 |
Fluorescent material having a composition of rare earth aluminum-gallate
Provided is a fluorescent material having a composition of rare earth aluminum-gallate, which radiates light in not only a visible light region but also a near-infrared region and has improved light emission intensity in a near-infrared region. The fluorescent material has a composition of rare earth aluminum-gallate, including at least one rare earth element Ln selected from the group consisting of Y, Gd, Sc, Lu, and La; at least one element selected from Al and Ga; Ce; and Nd. When a total molar composition ratio 5 of Al and Ga is used as a basis, a total molar ratio of Ln, Ce, and Nd is 3; a molar ratio of Ce is a product of 3 and a value of a parameter x; a molar ratio of Nd is a product of 3 and a value of a parameter y. The parameter x is in a range of 0.03 or more and 0.015 or less. The parameter y is in a range of 0.002 or more and 0.06 or less. |
| US10851293B2 |
Phosphor materials for light sources and method for manufacturing the same
A method includes mixing a first fluoride phosphor powder that is doped with tetravalent manganese with a treatment solution for a designated period of time, stopping the mixing to allow the fluoride phosphor powder to settle, removing at least some liquid that has separated from the first fluoride phosphor powder, repeating (a) the mixing, (b) the stopping of the mixing, and (c) removing at least some of the liquid during one or more additional cycles, and obtaining a second fluoride phosphor powder following the repeating of the mixing, the stopping of the mixing, and the removing of at least some of the liquid. The second fluoride phosphor powder includes a reduced amount of the manganese relative to the first fluoride phosphor powder. |
| US10851292B2 |
Dark blue light thermally activated delayed fluorescence (TADF) material and application thereof
The present invention provides a thermally activated delayed fluorescence (TADF) material, which is composed of a molecular compound having an ultra-fast reverse intersystem crossing rate, and when the TADF material serves as a host material in light-emitting layers of electroluminescent devices, both the resulting blue light fluorescence device and phosphorescent electroluminescent device can achieve very high efficiency. |
| US10851290B2 |
Methods and compositions for use of proppant surface chemistry and internal porosity to consolidate proppant particulates
Methods and compositions using surface chemistry and internal porosity of proppant particulates to consolidate the proppant particulates are described herein. The methods can include a method of gravel packing a wellbore. The method can include mixing an activator, a thickener, a crosslinker and a plurality of resin-coated proppant particulates to provide a gravel pack fluid and introducing the gravel pack fluid into a gravel pack region of the wellbore. The method can also include consolidating at least a portion of the plurality of resin-coated proppant particulates to provide a consolidated gravel pack, wherein the consolidated gravel pack has a UCS of at least about 60 psi when formed under a pressure of about 0.01 psi to about 50 psi and a temperature of about 160° F. to about 250° F. |
| US10851285B2 |
Anti-agglomerate hydrate inhibitors
A hydrate inhibitor comprising a sulfolane derivative and associated methods and compositions. |
| US10851284B2 |
Method of improving wellbore integrity and loss control
A method for enhancing wellbore integrity and/or for sealing a wellbore by sealing formation or micro-annulus fractures in a wellbore. Such sealing can be at least partially accomplished by the use of timed expansion of an expandable sealant material that is placed a wellbore. The expansion of the expandable sealant material causes the cement surface or formation surface to be compressed, thereby creating a tight seal and/or eliminating annulus cracking, fracture, and/or gas channels in the wellbore. A degradable polymer can be used when restoration of the wellbore formation is desired. |
| US10851283B2 |
Methods of zonal isolation and treatment diversion with shaped particles
Methods of treating a subterranean formation are disclosed that include introducing a treatment fluid including shaped particle and/or shaped uniform particles into a subterranean formation via a wellbore, and creating a plug including the shaped particle and/or shaped uniform particles of the treatment fluid. |
| US10851276B2 |
Composition for heat cycle system, and heat cycle system
To provide a composition for a heat cycle system having favorable lubricating properties and comprising a working fluid for heat cycle which has a low global warming potential and which can replace R410A and a heat cycle system employing the composition. A composition for a heat cycle system comprising a working fluid for heat cycle containing trifluoroethylene, and a refrigerant oil (for example, an ester refrigerant oil, an ether refrigerant oil, a polyglycol refrigerant oil or a hydrocarbon refrigerant oil), and a heat cycle system employing the composition for a heat cycle system. |
| US10851275B2 |
Refrigeration apparatus
A refrigeration apparatus includes a heat source unit, a utilization unit, and a liquid refrigerant pipe and gas refrigerant pipe. The utilization unit has utilization unit internal pipelines. The liquid refrigerant pipe and the gas refrigerant pipe connect the heat source unit and the utilization unit internal pipelines. A refrigerant circulates through the heat source unit, the utilization unit, the liquid refrigerant pipe, and the gas refrigerant pipe. The refrigerant contains a compound represented by a molecular formula having one or more carbon-carbon unsaturated bonds. A disproportionation inhibitor for reducing a disproportionation reaction of the refrigerant is applied to at least a part of inner surfaces of the liquid refrigerant pipe, the gas refrigerant pipe, and the utilization unit internal pipelines. |
| US10851272B2 |
Two-component polyurethane adhesive for adhesively bonding molded fiber parts
The invention relates to a two-component polyurethane adhesive containing i) a polyol component including a mixture of three different polyols to ensure crosslinking for a mechanically stable adhesive bonding, and also to achieve hydrophobia to ensure that the crosslinked adhesive layer is impervious to moisture, and glass fibers, and ii) an isocyanate component containing polyisocyanates in an NCO/OH ratio of 0.9:1 to 1.5:1. The polyol component further includes a metal catalyst. The two-component adhesive has a high adhesive strength, a high glass temperature, a low curing time and a sufficiently long processing time, which can adhesively bond also substrates having uneven surfaces. The invention further relates to an article comprising the two-component polyurethane adhesive. |
| US10851269B2 |
Pressure-sensitive adhesive composition
A pressure-sensitive adhesive composition, which may have excellent durability under high temperature or humidity conditions and exhibit high close adhesion to optical films, thereby forming a pressure-sensitive adhesive having superior cuttability and re-workability, is provided. Also, a pressure-sensitive adhesive composition capable of forming a pressure-sensitive adhesive capable of effectively inhibiting bending when applied to a thin substrate such as a very thin glass substrate, minimizing a time required to stabilize physical properties, and preventing a degradation of the secured physical properties in time, a pressure-sensitive adhesive optical member formed using such a pressure-sensitive adhesive composition, an optical laminate, and a display device are provided. |
| US10851265B2 |
Polymeric composition with anti-icing and self-cleaning properties
Polymeric compositions useful in preventing the frost or ice deposition in the surface of wind turbine generator blades present in a cold climates or high altitude are provided. In addition to the anti-icing capacity, the polymeric composition prevents the deposition of dirt, i.e. it has self-cleaning properties. |
| US10851259B2 |
Barrier coatings for film and structures
The invention provides coated substrates comprising a substrate and a barrier coating on at least one surface of the substrate. The barrier coating comprises (i) vermiculite, (ii) polymer capable of forming a film, (iii) chemical stabilizing agent selected from materials that contain cationic functionality selected from lithium, alkyl C2-C6 ammonium, allyl ammonium, heterocylclic ammonium, morpholonium, ammonium and amino C3-C6 alkyl carboxylic acids; lithium cations in combination with anions selected from carboxylic, phosphoric, phosphonic, sulfonic and fatty acids, lithium chelating agents, and lithium salts, ammonia, C3-C6 amine, heterocyclic amines, lithium hydroxide, morpholine, and morpholine oleate; and (iv) cross-linking agent. The invention also provides articles coated with such coatings, methods and mixtures for making such coated substrates and articles. |
| US10851258B2 |
Stabilized moisture-curable polymeric compositions
Silane-crosslinkable polymeric compositions comprising a polyolefin having hydrolyzable silane groups, an acidic silanol condensation catalyst, and a phenolic antioxidant. The phenolic antioxidant comprises two sulfur-containing radicals, one located at the ortho position and the other located at the para position relative to the hydroxyl group of the phenol. Such crosslink able polymeric compositions can be employed in various articles of manufacture, such as in the wire and cable industry. |
| US10851255B2 |
Device for discharging liquid, method for discharging liquid, curable composition, curable ink, cured product, and storing container
A device for discharging liquid is provided. The device includes a liquid discharge head including a curable composition, individual liquid chambers, and a nozzle. The curable composition comprises polymerizable compounds including a bifunctional or higher multifunctional compound accounting for 25% by mass to 45% by mass of an entire amount of the polymerizable compounds and a particle having an average primary particle diameter of 20 nm to 100 nm. The individual liquid chambers have circulation channels in which the curable composition circulates. The nozzle is communicated with the individual liquid chambers, and configured to discharges droplets. |
| US10851249B2 |
Textiles having flame protection function
The invention relates to flame-retardant foam coatings for textile sheet products, wherein the coatings include plate-like expandable graphite which has a reduced salt content and a particle distribution with a proportion of >80 percent by weight having a diameter of at least 0.2 mm, and/or a minimum proportion of 70% having a mesh size of >50 mesh (0.3 mm), at least one binder and at least one foam stabilizer, and also processes for the production thereof, the use thereof for producing textile sheet products and also textile sheet products having such flame-retardant foam coatings. |
| US10851244B2 |
Acetoacetylated and (meth)acrylated lignin and thermosets therefrom
The invention relates to novel acetoacetylated lignin resin compositions comprising the reaction product of lignin and an acetoacetate ester. The invention also relates to novel (meth)acrylated lignin resin compositions comprising the reaction product of lignin and a (meth)acrylic compound. The invention also relates to methods of making the novel acetoacetylated lignin resin compositions and the novel (meth)acrylated lignin resin compositions. The invention also relates to curable coating compositions comprising the novel acetoacetylated lignin resin composition or (meth)acrylated lignin resin composition. The invention also relates to methods of making the curable coating compositions of the invention. The invention also relates to methods of applying curable coating compositions of the invention to substrates. The invention also relates to articles of manufacture comprising a curable coating composition of the invention and a method of making such article. |
| US10851242B2 |
Addition-curable silicone rubber composition and silicone rubber
An addition-curable silicone rubber composition which contains: 100 parts by weight of (A) an organopolysiloxane that is represented by average composition formula (1) R1aSiO(4−a)/2 (wherein R1 represent monovalent hydrocarbon groups that are the same as or different from each other, and a represents a positive number of 1.5-2.8) and has at least two alkenyl groups, each of which is bonded to a silicon atom, in each molecule; 0.3-20 parts by weight of (B) an organohydrogen polysiloxane that has at least two hydrogen atoms (SiH functional groups), each of which is bonded to a silicon atom, in each molecule; 5-80 parts by weight of (C) a reinforcing silica; and (D) an addition reaction catalyst, which is configured of a platinum group metal, in an amount of 0.5-1,000 ppm relative to the total weight of the components (A) and (B). This addition-curable silicone rubber composition also contains (E) an organopolysiloxane, which has one or more Si—OH functional groups in each molecule, while having a polymerization degree of 10 or less, in an amount of 0.005-0.3% by weight relative to the total weight of the composition. |
| US10851239B2 |
Ethylenically unsaturated macromers produced from a residue of isocyanate manufacturing, related preformed stabilizers, polymer polyols, foam-forming compositions and foams
Disclosed are ethylenically unsaturated macromers produced using a residue of an isocyanate manufacturing process. Also disclosed are preformed stabilizers produced using such macromers, polymer polyols produced using such preformed stabilizers, foam-forming compositions produced using such polymer polyols, and foam produced using such compositions. |
| US10851230B2 |
Ion exchange resin for producing bisphenol, and a method for producing bisphenol using said ion exchange resin
This invention relates to an ion exchange resin for producing bisphenol with high percent conversion and high percent selectivity to bisphenol, especially 4,4′ isopropyhdenediphenol, wherein said ion exchange resin comprising aromatic polymer having sulfonic acid group modified with at least one promoter selected from compounds shown in the structure (I), (II), (III), (IV) or its amine salt: wherein R represents hydrocarbon unit with 1 to 6 carbon atoms selected from alkyl group, alkenyl group, alkynyl group, phenyl group, or optionally hydrocarbon containing carbonyl group having 1 to 6 carbon atoms; X represents heteroatom; n is an integer number from 1 to 4. |
| US10851227B2 |
Resin composition, insulated electric wire and method of manufacturing insulated electric wire
An insulated electric wire includes a conductor and an insulating layer. This insulating layer is made of a resin composition containing a base polymer and a metallic hydroxide. The base polymer contains ethylene-vinyl acetate copolymer and ethylene-(α-olefin) copolymer. The “α-olefin” is a non-polarized monomer, its melting point is equal to or lower than 70° C. A vinyl-acetate total content of the base polymer is equal to or less than 19 mass %. The resin composition contains the ethylene-(α-olefin) copolymer, a content of which is equal to or more than 20 parts by mass and equal to or less than 70 parts by mass per 100 parts by mass of the base polymer, and contains the metallic hydroxide, a content of which is equal to or more than 30 parts by mass and equal to or less than 150 parts by mass per 100 parts by mass of the base polymer. |
| US10851224B2 |
Phenolic resin composition and the use thereof in a rubber composition to reduce hysteresis
This invention relates to a phenolic resin composition comprising a phenolic resin admixed with and/or modified by one or more functionalized organosulfur compounds. This invention also relates to a rubber composition comprising (i) a natural rubber, a synthetic rubber, or a mixture thereof; (ii) one or more phenolic resins; and (iii) one or more functionalized organosulfur compounds. The interaction between the component (i) and the components (ii) and (iii) reduces the hysteresis increase compared to a rubber composition without the component (iii), upon curing the rubber composition. The invention also relates to a process for preparing the phenolic resin composition, a process for preparing the rubber composition, and a process for reducing the hysteresis increase caused in a rubber composition when a phenolic resin is added to a rubber composition. |
| US10851217B2 |
Epoxy resin composition, prepreg, and carbon fiber reinforced composite material
Provided are: an epoxy resin composition that gives a carbon fiber-reinforced composite material having excellent moldability, heat resistance, and mechanical properties such as tensile strength and compressive strength; and a prepreg. An epoxy resin composition containing at least the following constituent elements [A]-[D]. The epoxy resin composition contains 5-50 parts by mass of constituent element [A] and 20-95 parts by mass of constituent element [B], as well as 1-25 parts by mass of constituent element [C], relative to 100 parts by mass of the total amount of epoxy resin. Constituent element [A] is an epoxy resin having primarily two epoxy groups and one or more condensed polycyclic aromatic hydrocarbon skeletons within a repeating unit of a specific structure; [B] is a glycidylamine epoxy resin having three or more glycidyl groups in the molecule; [C] is a sulfone or imide thermoplastic resin; and [D] is an epoxy resin curing agent. |
| US10851215B2 |
Graphene-augmented composite materials
Graphene fibers made from a graphene film formed into an elongated fiber-like shape and composite materials made from the graphene fibers. The elongated fiber-like shape may be the graphene film in a rolled spiral orientation or the graphene film in a twisted formation. The graphene film has imide groups formed on at least an outer surface of the graphene film. Methods of increasing strength of a composite material include combining a resin matrix with a plurality of the graphene fibers to form a prepreg material and curing the prepreg material to form the composite material. |
| US10851199B2 |
Epoxy (meth) acrylate compound and curable composition containing same
An epoxy (meth)acrylate compound represented by general formula (1): where at least one of R1 to R5 has a structure represented by formula (2): * denotes the bonding position to a carbon atom that constitutes the benzene ring to which R1 to R5 are bonded in formula (1), R7 denotes a hydrogen atom or a methyl group, the remainder of R1 to R5 are each independently selected from the group consisting of hydrogen atoms, alkyl groups and alkoxy groups having 1-6 carbon atoms, and R6 denotes a hydrogen atom or a methyl group. In the epoxy (meth)acrylate compound, the content of halogen atoms is 100 ppm by mass or less. A curable composition for forming a protective film for an electrically conductive pattern obtained by mixing the epoxy (meth)acrylate compound with a photopolymerization initiator and at least one type of monomer or oligomer that contains a (meth)acryloyl group. |
| US10851198B2 |
Processes for producing filter cartridge assemblies and molded polyurethane elastomers
Disclosed are processes for producing molded polyurethane elastomers and products, such as filter end caps, that include such elastomers. The elastomers are the reaction product of a non-foaming reaction mixture comprising an isocyanate-reactive composition and an organic polyisocyanate prepolymer with an internal mold release agent. |
| US10851197B2 |
Base-catalyzed, long-chain, active polyethers from short chain DMC-catalyzed starters
The present invention provides long chain, active polyether polyols which are characterized by a functionality of 2 to 6 and an equivalent weight of 1000 to 2200 Da. These long chain polyethers comprise the alkoxylation product of (1) a starter composition having an equivalent weight of 350 Da or less, with (2) one or more alkylene oxides, in which up to 20% of ethylene oxide may be added as a cap, in the presence of (3) at least one basic catalyst. Suitable starter compositions (1) comprise the alkoxylation product of (a) a low molecular weight polyether having a functionality of 3 and an equivalent weight of less than 350 Da, (b) at least one low molecular weight starter compound comprising glycerin, and (c) propylene oxide or a mixture of propylene oxide and ethylene oxide, in the presence of (d) at least one double metal cyanide catalyst. A process for preparing these long chain polyether polyols is also disclosed. |
| US10851194B2 |
(meth)acrylic silicone graft copolymer and a method for preparing the same
A (meth)acrylic silicone graft (co)polymer having a unit represented by the following formula (I), a structure represented by the following formula (III) at one terminal, and a structure represented by the following formula (IV) at the other terminal, wherein A is a group having a linear organopolysiloxane structure represented by the following formula (1) or a group having a dendritic organopolysiloxane structure represented by the following formula (2-1) or (2-2), X′ is a group as defined for A, wherein Z is a divalent organic group, Q is a group represented by the following formula (2), D is a (3c+1)-valent organopolysiloxanyl group which has a hierachial order of c, 3c means 3 raised to the power of c, c is an integer of from 1 to 8. |
| US10851188B2 |
Polymer compound for conductive polymer and method for producing same
A polymer compound for a conductive polymer contains one or more kinds of repeating units “a” represented by the following general formula (1) and has a weight average molecular weight in the range of 1,000 to 500,000, R1 represents a hydrogen atom or a methyl group; Rf1 represents a linear or branched alkyl group having 1 to 4 carbon atoms or a phenyl group, and has at least one fluorine atom or a trifluoromethyl group in Rf1; Z1 represents a single bond, an arylene group having 6 to 12 carbon atoms or —C(═O)—O—R2—; R2 represents a linear, branched or cyclic alkylene group having 1 to 12 carbon atoms, an arylene group having 6 to 10 carbon atoms or an alkenylene group having 2 to 10 carbon atoms, and may have an ether group, a carbonyl group or an ester group in R2; and “a” is 0 |
| US10851186B2 |
Aqueous polymer dispersion
An aqueous polymer dispersion, a process of preparing the aqueous polymer dispersion, and an aqueous coating composition comprising the aqueous polymer dispersion and providing coatings with improved water repellency and/or improved hydrophobic stain resistance without compromising hydrophilic stain resistance. |
| US10851185B2 |
Bonding tissues and cross-linking proteins with naphthalimide compounds
Naphthalimide compounds as used in tissue bonding and protein cross-linking applications. When activated by an activating agent, such as light in the 400-500 nm absorption range, the naphthalimide compounds form chemically-reactive species that cross-link proteins, bond connective tissues together, and bone tissues and other biomaterials together. A naphthalimide-labeled biomolecule, such as a naphthalimide-labeled chitosan, is also capable of bonding tissues without subsequent direct illumination of the contacted tissue area. The naphthalimide compounds may be used in tissue or arterial repair, stabiliation of an expanded arterial wall after angioplasty, tethering pharmaceutical agents to tissue surfaces to provide local drug delivery, and for chemically bonding skin care products, sunscreens, and cosmetics to the skin. |
| US10851183B2 |
Hydrolyzed starch compositions and their use in food applications
Provided herein are common starch-based and waxy starch-based hydrolyzed starches. The hydrolyzed starches described herein demonstrate desirable properties over existing hydrolyzed starches for food applications, including but not limited to, dairy, ready-to-eat cereal coatings, clean-label confectionary products, nutritional and cereal bars, crumb chocolate, infant and/or elderly nutrition. |
| US10851171B2 |
Method for the selection of antibodies against BCMA
An antibody specifically binding to human BCMA, characterized in that the binding of said antibody is not reduced by APRIL and not reduced by BAFF, said antibody does not alter APRIL-dependent NF-κB activation, BAFF-dependent NF-κB activation, and does not alter NF-κB activation without BAFF and APRIL is useful as a therapeutic agent. |
| US10851166B2 |
Treatment of cancer using a CD33 chimeric antigen receptor
The invention provides compositions and methods for treating diseases associated with expression of CD33. The invention also relates to chimeric antigen receptor (CAR) specific to CD33, vectors encoding the same, and recombinant T cells comprising the CD33 CAR. The invention also includes methods of administering a genetically modified T cell expressing a CAR that comprises a CD33 binding domain. |
| US10851163B2 |
Dosage regimen for MAdCAM antagonists
The present invention provides a method for the treatment of a patient comprising administering to the patient an initial dose of between about 1 mg and about 150 mg of a MAdCAM antagonist antibody. Biomarkers for assessing a patient's response to anti-MAdCAM treatment are also provided. |
| US10851162B2 |
Anti-Orai1 antibody
It is intended to provide a therapeutic and/or prophylactic agent for transplant rejections, immunological diseases, allergic diseases, inflammatory diseases, thrombosis, cancers, etc., targeting human Orai1. The present invention provides, for example, a pharmaceutical composition comprising an antibody that specifically recognizes human Orai1 and has the activity of inhibiting human T cell activation. |
| US10851148B2 |
Antibodies to MICA and MICB proteins
MICA and MICB are expressed on the surface of stressed, virus infected and cancer cells; they bind to their common receptor NKG2D on immune effector cells such as natural killer (NK) cells and some T cells to signal immune responses, including cytotoxicity, towards cells expressing surface MICA or MICB. To evade this immune-surveillance, virus infected cells and cancer cells shed the extracellular domain of their MICA and MICB as soluble forms (sMICA and sMICB) which act as decoys by binding and down-regulating expression of NKG2D on the immune effector cells. Antibodies are provided that specifically bind the soluble forms of both MICA and MICB to inhibit their adverse effects, but do not bind cell- or membrane-bound MICA and MICB to preserve their beneficial immune effects. |
| US10851147B2 |
Ultra-long acting insulin-Fc fusion proteins and methods of use
The present disclosure provides recombinantly manufactured ultra-long acting insulin-Fc fusion proteins for use in treating canine and feline diabetes. The insulin-Fc fusion proteins comprise an insulin polypeptide linked via a peptide linker to an Fc-fragment of canine or feline origin. Based on the results obtained, creating a treatment that is amenable to low cost manufacturing, exhibits sufficient in vivo bioactivity, displays extended duration of bioactivity, does not induce anti-drug antibodies, and substantially retains is potency over multiple administrations, requires a non-obvious combination of insulin polypeptide, peptide linkers, and species-specific Fc fragment, in addition to selective mutations on one or more of these components. Exemplary ultra-long acting insulin-Fc fusion proteins, polynucleotides encoding these insulin-Fc fusion proteins, and pharmaceutical formulations of exemplary insulin-Fc fusion proteins are provided, in addition to methods of use and preparation. |
| US10851146B2 |
Method for preparing liraglutide intermediate polypeptide
The invention belongs to the technical field of polypeptide preparation methods, and in particular relates to a preparation method of a liraglutide intermediate polypeptide GLP-1 (7-37). In the preparation method, main steps include constructing recombinant liraglutide engineered bacteria via E. coli to induce expression of a liraglutide intermediate fusion protein in the form of inclusion bodies, and performing denaturation, renaturation, enzyme digestion, separation and purification to obtain the liraglutide intermediate polypeptide GLP-1 (7-37). The invention alters expression pattern into the expression of the intracellular insoluble inclusion bodies by changing a signal peptide of the recombinant sequence to increase significantly expression level. The liraglutide intermediate polypeptide prepared by the invention has a purity up to 87% or more and a yield of more than 85%. |
| US10851145B2 |
Methods for treating inflammation with fusion proteins comprising interleukin-2 and interleukin-33
The present application discloses a novel fusion peptide of IL-2 and IL-33 and its use. It comprises a biologically active domain of Interleukin-2 (IL-2) or a biologically active fragment or homolog thereof, and a biologically active domain of Interleukin-33 (IL-33) or a biologically active fragment or homolog thereof. The two portions can be linked by a linker sequence. The application discloses that combination therapies using IL-2 and IL-33 or a therapy using the IL233 fusion protein are effective in preventing or treating diseases and disorders such as autoimmune diseases and disorders, inflammation, etc. Depending on the subject's disease or disorder, the compositions of the invention are useful for preventing certain symptoms, treating the disease, and alleviating at least some of the symptoms. |
| US10851143B2 |
Methods of treatment with a fusion protein comprising IL-4 and IL-10
The invention is concerned with a fusion protein comprising interleukin 10 and interleukin 4, a nucleic acid molecule encoding such fusion protein, a vector comprising such nucleic acid molecule, and a host cell comprising such nucleic acid molecule or such vector. The invention further pertains to a method for producing such fusion protein. The fusion protein or a gene therapy vector encoding the fusion protein may be used in the prevention or treatment of osteoarthritis, chronic pain, a condition characterized by local or systemic inflammation, immune activation, and/or lymphoproliferation. |
| US10851139B2 |
Antibacterial method
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses. |
| US10851138B2 |
Methods of preparing P. gingivalis antibodies
Disclosed are methods related to the generation and use of cellular and humoral responses for the prevention and treatment of P. gingivalis related conditions and diseases, such as methods of preparing P. gingivalis antibodies, comprising immunizing a non-human animal with a chimeric or fusion protein, wherein the protein comprises a first peptide joined directly or through a linker to a second peptide or polypeptide, wherein (A) the first peptide comprises a region of a P. gingivalis trypsin-like enzyme and (B) the second peptide or polypeptide comprises an adhesin domain of P. gingivalis. |
| US10851135B2 |
De novo design of protein switches
Disclosed are protein switches that can sequester bioactive peptides and/or binding domains, holding them in an inactive (“off”) state, until combined with a second designed polypeptide called the key, which induces a conformational change that activates (“on”) the bioactive peptide or binding domain, components of such protein switches, and their use. |
| US10851130B2 |
Chemical synthesis method of Plesiomonas shigelloides serotype O51 O-antigen oligosaccharide
The present disclosure discloses the chemical synthesis method of the Plesiomonas shigelloides serotype O51 O-antigen oligosaccharide, belonging to the field of chemistry. Source-abundant D-glucose, L-fucose, D-glucosamine and the like are used as raw materials to prepare three glycosylation building blocks, the synthetic route composed of 11 reaction modules is designed, and through the optimization of protecting group and the optimization of the time of introducing functional group, the preparation of the target oligosaccharide chain is successfully achieved. The oligosaccharide chain prepared in the present disclosure has the advantages of cheap and easy-to-get raw materials, and simple and easy-to-repeat preparation method. The present disclosure will have good application prospects in the aspects of development of new drugs and vaccines of Plesiomonas shigelloides, and the like. |
| US10851127B2 |
Platinum complexes and apparatuses thereof
Provided herein are platinum complexes of Formula I: Also, provided are methods of making the platinum complexes of Formula I and apparatuses that include platinum complexes of Formula I. The apparatuses can include near infrared organic light emitting devices. |
| US10851126B2 |
Complexes and methods for their preparation
Disclosed are methods for the preparation of ligands for complexes, methods for preparing complexes and complexes having those ligands. Also provided is the use of a complex as a catalyst in a method of synthesis. |
| US10851122B2 |
Method for producing an ionic liquid
The present invention is directed to a method of preparing an alkoxy silane functional ionic liquid comprising reacting a halogenated compound comprising a halogen and an active hydrogen functional group, an isocyanato functional alkoxy silane, and an ionizable compound capable forming an ionic bond with the halogen to form the alkoxy silane functional ionic liquid. The present invention is also directed to alkoxy silane functional ionic liquids. |
| US10851119B2 |
Boron-containing diacylhydrazines
The present disclosure provides boron-containing diacylhydrazines having Formula I: and the pharmaceutically acceptable salts and solvates thereof, wherein R1, R2, R3, R4, and R5 are defined as set forth in the specification. The present disclosure also provides the use of boron-containing diacylhydrazines is ecdysone receptor-based inducible gene expression systems. Thus, the present disclosure is useful for applications such as gene therapy, treatment of disease, large scale production of proteins and antibodies, cell-based screening assays, functional genomics, proteomics, metabolomics, and regulation of traits in transgenic organisms, where control of gene expression levels is desirable. |
| US10851117B2 |
Methods of preparing cytotoxic benzodiazepine derivatives
The invention provides novel methods for preparing indolinobenzodiazepine dimer compounds and their synthetic precursors. |
| US10851114B2 |
2-oxothiatole compounds having activity as cPLA2 inhibitors for the treatment of inflammatory disorders and hyperproliferative disorders
A compound of formula (I′) wherein R6 is H, C1-6alkyl, —(CH2)pCOOH, —(CH2)pCOOC1-6alkyl, —(CH2)pCONH2, —(CH2)pCONHC1-6alkyl, —(CH2)pCON(C1-6alkyl)2, R7 is as defined for R6; or and R7 taken together with the atoms joining them can form a 6-membered aromatic or non aromatic, saturated or unsaturated, carbocyclic or heteroatom containing (e.g. O, N or S containing) ring optionally substituted by up to 4 groups R8; each R8 is defined as for R6 or is oxo; R10 is C1-6alkyl Ar is a C6-14 aryl group, wherein the aryl group may be optionally substituted (preferably in the meta or para position relative to O) with one or more R9 groups; each R9 is halo, OH, CN, nitro, NH2, NHC1-6alkyl, N(C1-6alkyl)2, haloC1-6alkyl, C6-10 aryl group, C7-12 arylalkyl, a C1-10alkyl group, C2-10-mono or multiply unsaturated alkenyl group, OC1-10alkyl group, SC1-10alkyl group —OC1-10alkyl-O—C10alkyl, —C1-10alkyl-O—C1-10alkyl, —OC2-10-mono or multiply unsaturated alkenyl group, OAr2, O(CH2)qAr2, SAr2 or S(CH2)qAr2; wherein Ar2 is phenyl, optionally substituted with one or more of halo, trihalomethyl, C1-10-alkoxy, or C1-10 alkyl; each q is 1 to 3, preferably 1; each p is 0 to 3; or a salt, ester, solvate, N-oxide, or prodrug thereof. |
| US10851109B2 |
Compositions and methods of using the same for treatment of neurodegenerative and mitochondrial disease
The disclosure is directed to compounds and pharmaceutically acceptable salts thereof for the treatment and/or prevention of neurodegenerative and/or mitochondrial diseases, such as Parkinson's disease and Leigh's disease. The compounds and pharmaceutically acceptable salts thereof are of the class of nitrogenous bases, for example, pyrimidines, purines, pteridines, and pharmaceutically acceptable salts thereof. |
| US10851107B2 |
Dual selective P13 delta and gamma kinase inhibitors
The present invention relates to dual delta (δ) and gamma (γ) PI3K protein kinase modulators, methods of preparing them, pharmaceutical compositions containing them and methods of treatment, prevention and/or amelioration of Pi3K kinase mediated diseases or disorders with them. |
| US10851105B2 |
Bicyclic heterocycles as FGFR4 inhibitors
The present invention relates to bicyclic heterocycles, and pharmaceutical compositions of the same, that are inhibitors of the FGFR4 enzyme and are useful in the treatment of FGFR4-associated diseases such as cancer. |
| US10851102B2 |
Imidazole and triazole containing bicyclic compounds as JAK inhibitors
The invention provides compounds of formula (I): or a pharmaceutically-acceptable salt thereof, wherein the variables are defined in the specification, that are inhibitors of JAK kinases, particularly JAK3. The invention also provides pharmaceutical compositions comprising such compounds, and methods of using such compounds to treat gastrointestinal and other inflammatory diseases. |
| US10851100B2 |
Preparation method for and intermediate of pyrrolo six-membered heteroaromatic ring derivative
Disclosed are an intermediate of a pyrrolo six-membered heteroaromatic ring derivative as a JAK inhibitor and a preparation method therefor, and a method for preparing a pyrrolo six-membered heteroaromatic ring derivative using the intermediate. The method improves the reaction yield, is simple and easy to operate and control, and is conducive to expanded industrial production. |
| US10851093B2 |
Tyrosine kinase inhibitors
Disclosed are imidazole compounds, as well as pharmaceutical compositions and methods of use thereof. One embodiment is a compound having the structure and pharmaceutically acceptable salts, prodrugs and N-oxides thereof (and solvates and hydrates thereof), wherein R1, X, Y1, Y2, Y3 and Z are as described herein. In certain embodiments, a compound disclosed herein inhibits a cellular TAM receptor, and can be used to treat disease mediated by or involving the TAM receptor family. |
| US10851091B2 |
Benzoxazepin oxazolidinone compounds and methods of use
Described herein are benzoxazepin oxazolidinone compounds with phosphoinositide-3 kinase (PI3K) modulation activity or function having the Formula I structure: or stereoisomers, tautomers, or pharmaceutically acceptable salts thereof, and with the substituents and structural features described herein. Also described are pharmaceutical compositions and medicaments that include the Formula I compounds, as well as methods of using such PI3K modulators, alone and in combination with other therapeutic agents, for treating diseases or conditions that are mediated or dependent upon PI3K dysregulation. |
| US10851085B2 |
Pyrazole derivatives
The present invention relates to compounds of formula (C) (C), wherein ring A, RB2 and RB3 are as defined in claim 1. |
| US10851081B2 |
GLP-1 receptor agonists and uses thereof
Provided herein are 6-carboxylic acids of benzimidazoles and 4-aza-, 5-aza-, 7-aza- and 4,7-diaza-benzimidazoles as GLP-1R agonists, processes to make said compounds, and methods comprising administering said compounds to a mammal in need thereof. |
| US10851080B2 |
Methods of treatment using pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds
Compounds useful for the treatment of pain or cancer in a mammal. |
| US10851078B2 |
Single step lactide production process with heat recovery
The present invention relates to a process for synthesizing lactide, comprising the steps of: adding thermal energy to at least one of one or more components; providing the one or more components to at least one reactor, the one or more components comprising lactic acid and at least one solvent; converting at least part of the lactic acid into lactide and water; recovering at least part of the lactide; recovering at least part of the at least one solvent; recovering at least part of the thermal energy, wherein at least part of the recovered thermal energy is recovered from the recovered solvent; and adding the recovered thermal energy to at least one of the one or more components. |
| US10851075B2 |
Stat3 pathway inhibitors and cancer stem cell inhibitors
The present invention relates to a novel naphtho class of compounds as Stat3 pathway inhibitors and as cancer stem cell inhibitors; to methods of using such compounds to treat cancer; to methods of using such compounds to treat disorders in a mammal related to aberrent Stat3 pathway activity; to pharmaceutical compositions containing such compounds. |
| US10851072B2 |
Inhibitors of Rho/MRTF/SRF-mediated gene transcription and methods for use of the same
Disclosed herein are inhibitors of Rho/MRTF/SRF-mediated gene transcription, and methods for their use in treating or preventing diseases such as cancer and fibrosis. In particular, disclosed herein are compounds of Formula (I) and pharmaceutically acceptable salts thereof: wherein the substituents are as described. |
| US10851068B2 |
Method for preparing pyrimidone compound
A method for preparing a pyrimidone compound and an important intermediate in which raw materials of the preparation method are cheap, the reaction condition of preparation method is mild, the preparation method is simple to operate, and is safe and controllable, has high total yield, and thus is suitable for industrial production. |
| US10851067B2 |
Kv7 channel activators compositions and methods of use
Provided herein are optionally substituted benzoimidazol-1,2-yl amides, pharmaceutical compositions comprising a therapeutically effective amount of such compounds and a pharmaceutically acceptable excipient, and methods of treating Kv7 associated diseases, such as, epilepsy, amyotrophic lateral sclerosis, various types of pain, hyperexcitability, a dyskinesia, dystonia, mania and tinnitus with such compounds and pharmaceutical compositions. |
| US10851066B2 |
2-arylbenzimidazoles as PPARGC1A activators for treating neurodegenerative diseases
The compound 2-(3-tert-Butylphenyl)-4,6-difluoro-1H-benzo[d]imidazole and its use are disclosed: The compound activates Ppargc1a and, as a consequence, is useful for treating neuroinflammation and for treating a variety of neurodegenerative diseases. |
| US10851065B2 |
Tetrasubstituted alkene compounds and their use
Disclosed herein are compounds, or pharmaceutically acceptable salts thereof, and methods of using the compounds for treating breast cancer by administration to a subject in need thereof a therapeutically effective amount of the compounds or pharmaceutically acceptable salts thereof. The breast cancer may be an ER-positive breast cancer and/or the subject in need of treatment may express a mutant ER-α protein. |
| US10851064B2 |
ACSS2 inhibitors and methods of use thereof
The present invention relates to novel ACSS2 inhibitors having activity as anti-cancer therapy, treatment of alcoholism, and viral infection (e.g., CMV), composition and methods of preparation thereof, and uses thereof for treating viral infection, alcoholism, alcoholic steatohepatitis (ASH), non-alcoholic steatohepatitis (NASH), obesity/weight gain, anxiety, depression, post-traumatic stress disorder, inflammatory/autoimmune conditions and cancer, including metastatic cancer, advanced cancer, and drug resistant cancer of various types. |
| US10851059B2 |
Processes and intermediates for NEP inhibitor synthesis
The present invention relates to a new chemical synthesis, intermediates and catalysts useful for the preparation of the neprilysin (NEP) inhibitor sacubitril, inter alia via nitro 5 compounds. It further relates to new intermediate compounds and their use for said new chemical synthesis route, as well as a new catalyst ligand. |
| US10851058B2 |
Histone deacetylase inhibitors
Provided herein are compounds and methods for inhibiting histone deacetylase (“HDAC”) enzymes (e.g., HDAC1, HDAC2, and HDAC3). |
| US10851056B2 |
Compound for organic optoelectronic device, organic optoelectronic device and display apparatus
The present invention relates to a compound for an organic optoelectronic device represented by chemical formula 1, an organic optoelectronic device employing the same and a display device apparatus. The details of chemical formula 1 are as defined in the specification. |
| US10851054B2 |
Derivatives of indole for the treatment of cancer, viral infections and lung diseases
The present invention relates to a new class of indole derivatives, having a particular MKlp2 inhibition profile and useful as a therapeutic agent, in particular for the treatment of cancer, viral infections and lung diseases. |
| US10851052B2 |
Method for producing mercaptophenol compound and intermediate of said compound
A production method in which a mercaptophenol compound is obtained using an industrially preferred sulfur atom introduction reaction, and intermediate compounds of the mercaptophenol compound are provided. A method for producing a mercaptophenol compound in which a phenyl carbamate compound is produced using a phenol compound as a raw material, and then a sulfur atom is regioselectively introduced by a reaction with sulfur monochloride, and a phenyl mercaptocarbamate compound is produced as an intermediate. |
| US10851049B2 |
Curable benzoxazine compositions
The present disclosure provides a curable composition containing a benzoxazine, reactive diluent and a soluble polyimide. The curable composition, upon curing, renders an article having well balanced thermal, chemical and mechanical properties and may be used in a variety of applications, such as in coatings, structural composites and encapsulating systems for electronic and electrical components. |
| US10851045B2 |
Acrylamide photoinitiators
Acrylamide photoinitiators are provided, in which a photoinitiator moiety and an acrylamide are incorporated into the photoinitiator structure. |
| US10851041B2 |
Fouling-resistant distillation column and process for the manufacture of compounds
Disclosed herein is a fouling-resistant system for the manufacture of a compound by distillation, the system including a reactant heating zone; a distillation column in fluid communication with the reactant heating zone wherein the distillation column comprises a plurality of distillation trays for removing by-products from the reactants, and wherein at least 20% of the plurality of distillation trays are baffle trays arranged in a staggered configuration; where each tray contacts an opposing portion of an inner wall of the distillation column from a portion contacted by a tray located above the tray and below the tray; and wherein the baffle trays are disposed in a lower portion of the distillation column. |
| US10851040B2 |
Restarting method
A method for producing at least one oxidation product selected from the group consisting of acrolein and acrylic acid is provided. This method can alleviate concerns about deterioration of a gas-phase oxidation catalyst and reaction runaway in a restart period after a shutdown, and can allow the reaction to proceed in a stable state. Using a fixed-bed reactor filled with a gas-phase oxidation catalyst, at least one source gas selected from the group consisting of propylene and acrolein is subjected to a gas-phase contact oxidation reaction while a heating medium is caused to contact with or circulate through the fixed-bed reactor and thereby to heat the fixed-bed reactor. The temperature of the heating medium when the load is maximum in the restart period after the shutdown is controlled to be lower than the temperature of the heating medium when the load is maximum in an initial start-up period. |
| US10851039B2 |
Polyhydric phenol compound and method of producing same
The present invention provides a polyhydric phenol compound which has an excellent alkali resistance and which does not cause a deterioration in color even when used as a resin raw material or a color developer. The polyhydric phenol compound includes: a bisphenol compound (A) represented by the following Formula (1) and a trisphenol compound (B) represented by the following Formula (2): [wherein R1 represents a monovalent aliphatic hydrocarbon group having from 6 to 24 carbon atoms; each of R2, R3, R4, R5 and R6 represents a monovalent hydrocarbon group having from 1 to 15 carbon atoms; and each of a, b, c, d and e represents an integer from 0 to 4]; wherein the trisphenol compound (B) is contained in an amount, in terms of absorption intensity ratio at 254 nm, of less than 1.6% by area with respect to the amount of the bisphenol compound (A). |
| US10851036B2 |
Catalytic partial oxidation of methane
Systems and methods are provided for direct methane conversion to methanol. The methods can include exposing methane to an oxidant, such as O2, in a solvent at conditions that are substantially supercritical for the solvent while having a temperature of about 310° C. or less, or about 300° C. or less, or about 290° C. or less. The solvent can correspond to an electron donor solvent that, when in a supercritical state, can complex with O2. By forming a complex with the O2, the supercritical electron donor solvent can facilitate conversion of methane to methanol at short residence times while reducing or minimizing further oxidation of the methanol to other products. |
| US10851028B2 |
Process for dehydration of mono-alcohol(s) using a modified crystalline aluminosilicate
The invention relates to a process for dehydration of a mono-alcohol, or of a mixture of at least two mono-alcohols, having at least 2 carbon atoms and at most 7 carbon atoms into olefins having the same number of carbons, wherein the process uses a catalyst composition that comprises a modified crystalline aluminosilicate has an acidity between 350 and 500 μmol/g that comprises, and further wherein the catalyst composition is obtained by a process comprising the steps of providing a crystalline aluminosilicate having a Si/Al framework molar ratio greater than 10; and steaming said crystalline aluminosilicate, or said shaped and/or calcined crystalline aluminosilicate at a temperature ranging from 100° C. to 380° C.; and under a gas phase atmosphere, without liquid, containing from 5 wt % to 100 wt % of steam; at a pressure ranging from 2 to 200 bars; at a partial pressure of H2O from 2 bars to 200 bars; and said steaming being performed during at least 30 min and up to 144 h. |
| US10851025B2 |
Waterborne wet look coating composition
A water-based coating composition is described herein. The composition includes an aqueous dispersion derived from an ethylenically unsaturated monomer and one or more organic solvents. The composition when applied to a substrate and allowed to dry provides a wet look to the substrate. |
| US10851024B2 |
Concrete protective agent and preparation method thereof, and concrete protective film and preparation method thereof
The present invention provides a concrete protective agent and a preparation method thereof, and a concrete protective film and a preparation method thereof. The concrete protective agent provided in the present invention includes the following components: water, oxalic acid, a defoaming agent, and a film-forming agent. When the concrete protective agent provided in the present invention is used for concrete protection, oxalic acid in the protective agent can react with calcium ions in concrete for in situ generation of calcium oxalate monohydrate inside and on a surface of concrete to obtain a protective film with strong adhesion to concrete. The film-forming agent in the protective agent is used as a template to adjust and control growth of calcium oxalate crystals, so as to improve waterproof performance and corrosion resistance to sulfate and chloride ions of the protective film. Preparation methods provided in the present invention are simple and practical and are suitable for mass production. |
| US10851017B2 |
Thermally treated briquettes containing a “quick” calcium-magnesium compound and calcium ferrites, and method of manufacture thereof
Composition in the form of green or thermally treated briquettes comprising at least one “quick” calcium-magnesium compound and an iron-based compound, the method of production thereof and uses thereof. |
| US10851015B2 |
Coated glass sheet
The present invention concerns a process to increase the mechanical and chemical resistance of a hydrolyzable network-forming silica gel coating provided on the surface of a substrate. According to the invention, a coating composition comprising a hydrolyzable, network-forming silica gel doped with a precursor of bismuth or cerium oxide is applied on the surface of the substrate. The present invention concerns also the product obtained by the said process. |
| US10851014B2 |
Device for applying release agent to glass bottle finishing mold, method for applying release agent to glass bottle finishing mold, device for manufacturing glass bottle, and method for manufacturing glass bottle
This invention eliminates the need for a manual work of applying a mold release lubricant to blow molds and bottom molds by workers and reduces a burden on workers involved in the mold release lubricant application work while also increasing the safety of workers during mold release lubricant application, reducing downtime associated with the mold release lubricant application work, reducing changes in the mold release lubricant application locations and variations in amount of application for the blow molds, and, furthermore, contributing to a glass bottle quality stabilization.The application equipment (40) for applying the mold release lubricant is structured to apply the mold release lubricant to at least either a part of blow mold forming surfaces (31f) provided on the blow molds (31), or the entire surface of bottom mold forming surfaces (32f) provided on the bottom molds (32) located in the lower part of a finish molds (31), or both. |
| US10851010B2 |
Device and method for forming glass bodies
A device for the shaping of glass bodies, in particular of pharmaceutical vials, comprises a clamping chuck for holding a glass body, a rotary drive for driving the clamping chuck rotatingly, further at least one heat source for heating a glass body held within the clamping chuck, and further a controller which is coupled to the rotary drive so that the clamping chuck can be driven at variable rotational speed. |
| US10851009B2 |
Method for producing a ceramizable green glass component, and ceramizable green glass component, and glass ceramic article
A method for producing ceramizable green glass components provided, as well as apparatus for performing such method and ceramizable green glass components producible by such method. The method is a redrawing process in which a preform is heated, in a deformation zone, to a temperature that enables redrawing of the glass. The deformation zone is particularly small, which permits redrawing of the ceramizable green glass bodies while avoiding ceramization during the redrawing. The method provides plate-like or sheet-like green glass components that have a particularly smooth surface. |
| US10851003B2 |
Denitrification and pH control using bio-electrochemical systems
In one aspect, the present invention provides reactor designs, component designs, and operating schemes for removing nitrates and chemical oxygen demand from any suitable wastewater stream. In another aspect, the invention also provides reactor designs, component designs, and operating schemes designed to modify and improve pH and water quality in wastewater streams. |
| US10850998B2 |
Method for degrading fluoroquinolone antibiotics by activating peroxyacetic acid with lanthanum ruthenate perovskite
A method for treating wastewater containing fluoroquinolone antibiotics by activating peroxyacetic acid heterogeneously with lanthanum ruthenate perovskite (LaRuO3) catalyst. The method includes: adding peroxyacetic acid to wastewater containing ciprofloxacin, mixing to obtain a peroxyacetic acid solution, adjusting a pH of the peroxyacetic acid solution; and adding lanthanum ruthenate perovskite to the peroxyacetic acid solution to obtain a mixed solution, and stirring the mixed solution in a constant temperature shaker, and removing the ciprofloxacin at a normal temperature. |
| US10850996B2 |
Process for manufacturing a solution of an earth alkali hydrogen carbonate
The present invention relates to a process for the preparation of an aqueous solution comprising at least one earth alkali hydrogen carbonate, a process for the mineralization of water as well as the use of an aqueous solution comprising at least one earth alkali hydrogen carbonate obtained by the process for the mineralization of water. |
| US10850995B2 |
Filtration aid and filtration treatment method
Provided is a filtration aid used when filtering, for example, sludge generated in a purification treatment process for water such as industrial wastewater and including a pulverized product of Corchorus olitorius, wherein a median diameter of the pulverized product is 150 micrometers or greater. |
| US10850994B2 |
Electrochemical liquid treatment apparatus
Apparatus includes treatment chamber including at least one outlet for exit of electrochemically treated liquid, and a liquid disperser having a plurality of liquid passageways, wherein each said liquid passageway includes at least one inlet to the treatment chamber for entry of a liquid to be treated; and a plurality of electrodes positioned within the treatment chamber for electrochemical treatment of the liquid. |
| US10850992B2 |
Enhanced evaporation system
An evaporation system including a reservoir, for receiving a liquid mixture to be reduced through evaporation; and a tray, for being received in the reservoir, the tray defining a heating chamber into which the liquid from the reservoir may flow, the heating chamber configured to heat the liquid therein to increase evaporation of the liquid. |
| US10850991B2 |
Systems and methods for controllable water treatment
Various embodiments of the invention relate to a controllable water treatment system, and more particularly, to systems, devices and methods of generating purified water with options of waste recycling and filter membrane rinse protection. The controllable water treatment system comprises a water intake tank, a pretreatment stage, a treatment stage and a purified water storage tank. Water waste output from the treatment stage may be drained or fed back into the water intake tank for recycling. Furthermore, the controllable water treatment system features rinse protection for filter membranes in the treatment stage. Before the system stop operation, water from the purified water storage tank is fed back into the filter stage to rinse the membranes for further protection. Such an application improves the lifespan of the membranes and thus the utility of the controllable water treatment system. |
| US10850987B2 |
Method and apparatus for manufacturing aerogel sheet
The present invention relates to a method for manufacturing an aerogel sheet. The method for manufacturing an aerogel sheet includes: a step (a) of preparing silica sol; a step (b) of preparing a gelling catalyst; a step (c) of injecting the silica sol, which is prepared in the step (a), to a surface of a blanket to impregnate the silica sol; and a step (d) of injecting the gelling catalyst, which is prepared in the step (b), to the surface of the blanket, into which the silica sol is impregnated, to gelate the silica sol. |
| US10850985B2 |
Method of forming nanocrystalline graphene, and device including nanocrystalline graphene
A method of forming nanocrystalline graphene by a plasma-enhanced chemical vapor deposition process is provided. The method of forming nanocrystalline graphene includes arranging a protective layer on a substrate and growing nanocrystalline graphene directly on the protective layer by using a plasma of a reaction gas. The reaction gas may include a mixed gas of a carbon source gas, an inert gas, and hydrogen gas. |
| US10850983B2 |
Three-dimensional hierarchical porous carbon foams for supercapacitors
A method of fabricating porous carbon foam includes mixing equal masses of SiO2 particle dispersion with a chitosan solution, dropwise adding a glutaraldehyde aqueous solution into the mixture and solidifying it in air forming a room temperature hydrogel, lyophilizing the hydrogel to form a sponge-like SiO2-embedded aerogel, carbonizing in a furnace the aerogel to form a SiO2-embedded carbon foam, soaking the embedded carbon foam in NaOH to dissolve the SiO2 particles to form a carbon foam having carbon sheets with sub-micron cavities, immersing the carbon sheets in de-ionized water to remove any NaOH residuals followed by drying, placing the carbon foam in KOH solution followed by drying, annealing in nitrogen atmosphere the dried carbon foam to synthesize a carbon foam with a multi-dimensional porous system, immersing the synthesized carbon foam in de-ionized water to prevent self-burning in air, and rinsing the carbon foam in HCl and water, then oven drying. |
| US10850982B2 |
Stabilization of sodium dithionite by means of various additives
The present invention relates to a method for reducing or preventing the decomposition of a composition Z comprising Z1 a salt of dithionous acid in an amount ranging from 50 to 100 wt % and optionally Z2 an additive selected from the group consisting of alkali metal carbonate, alkaline earth metal carbonate, alkali metal or alkaline earth metal tripolyphosphate (Na5P3O10), alkali metal or alkaline earth metal sulfite, disulfite or sulfate, dextrose and complexing agents in a combined amount ranging from 0.0001 to 40 wt %, which comprises contacting the components Z1 and optionally Z2 in the solid and/or dry or solvent-dissolved or -suspended state with at least one of the following compounds V in the solid and/or dry or solvent-dissolved or -suspended state, wherein the compounds V are selected from the group consisting of: (a) oxides of the alkali metals lithium, sodium, potassium, rubidium, cesium, or of magnesium, (b) sodium tetrahydroborate (NaBH4), (c) anhydrous copper(II) sulfate (Cu(SO4)), phosphorus pentoxide and (d) basic amino acids arginine, lysine, histidine, wherein the solvent for Z1, optionally Z2 and V is practically water-free. |
| US10850978B2 |
Quantum shift register structures
A novel and useful controlled quantum shift register for transporting particles from one quantum dot to another in a quantum structure. The shift register incorporates a succession of qdots with tunneling paths and control gates. Applying appropriate control signals to the control gates, a particle or a split quantum state is made to travel along the shift register. The shift register also includes ancillary double interaction where two pairs of quantum dots provide an ancillary function where the quantum state of one pair is replicated in the second pair. The shift register also provides bifurcation where an access path is split into two or more paths. Depending on the control pulse signals applied, quantum dots are extended into multiple paths. Control of the shift register is provided by electric control pulses. An optional auxiliary magnetic field provides additional control of the shift register. |
| US10850977B2 |
Group III-N MEMS structures on a group IV substrate
Techniques are disclosed for forming group III material-nitride (III-N) microelectromechanical systems (MEMS) structures on a group IV substrate, such as a silicon, silicon germanium, or germanium substrate. In some cases, the techniques include forming a III-N layer on the substrate and optionally on shallow trench isolation (STI) material, and then releasing the III-N layer by etching to form a free portion of the III-N layer suspended over the substrate. The techniques may include, for example, using a wet etch process that selectively etches the substrate and/or STI material, but does not etch the III-N material (or etches the III-N material at a substantially slower rate). Piezoresistive elements can be formed on the III-N layer to, for example, detect vibrations or deflection in the free/suspended portion of the III-N layer. Accordingly, MEMS sensors can be formed using the techniques, such as accelerometers, gyroscopes, and pressure sensors, for example. |
| US10850970B2 |
Method and apparatus for direct gravity-fed fuel delivery
A gravity-fed fuel delivery system is provided. A central storage tank holds fuel to re-supply a number of pump trucks or other mechanized equipment, such as on a hydraulic fracturing location, and can be selectively raised or lowered. Hoses or other conduits extend from the central storage tank to individual engines of the equipment to be refueled. Adapters allow connection of the distal end of each hose or conduit to an inlet of the suction side of the engine. Adaptors also allow connection of the return side of the engine's fuel system back to the central storage tank. Thereby mechanically allowing flow from the central storage tank, through the engine's fuel system, supply fuel for the engine to burn and allowing the return or unburned fuel a path back to the central storage tank. |
| US10850969B2 |
Methods and systems for on demand fuel supply
In a method and system for delivering fluid to a fluid consuming asset having a fluid tank, a first tank and a second tank are fluidically coupled and the second tank is pressurized. An inlet of a manifold is fluidically coupled to the second tank and an outlet of the manifold is coupled to a spigot. A first distal end of a fluid transporting mechanism is coupled to the spigot and a second distal end thereof is coupled to a hydraulic connector of a fill cap having a connection plate coupled to the fluid tank of the fluid consuming asset. The fill cap further comprises a probe and fluid flows from the first tank to the second tank, through the manifold and the hydraulic connector, through the probe and into the fluid tank of the fluid consuming asset. |
| US10850966B2 |
Resistance measuring sold out sensor for a beverage dispenser
A beverage dispenser and process of dispensing beverages from a beverage dispenser may include causing an ingredient in the form of a fluid to be drawn from a storage container through a conduit. An electrical conductivity of the fluid ingredient may be sensed within the conduit. A determination as to whether the electrical conductivity of the fluid ingredient crosses a threshold level may be made, and if so, the beverage dispenser may be disabled from dispensing beverages containing the fluid ingredient, otherwise, the beverage dispenser may be enabled to dispense beverages containing the fluid ingredient. |
| US10850964B2 |
System and method for filling containers with a precise amount of fluid
A system and method for filling containers with a precise amount of fluid is disclosed. The system and method use artificial neural network logic to sense conditions and to control the two-valve dispensing unit based on the sensed conditions to fill containers with a precise amount of fluid. Using neural network logic combined with sensors and controllers for equipment eliminates the significant human effort and human errors associated with manually filling containers with fluid. Furthermore, the neural network can log data quicker and with more accuracy than a human manually logging data. The system and method use a two-valve dispensing unit to precisely fill and to prevent and clear clogs caused by fluid solidifying within the dispensing unit. |
| US10850958B2 |
Method for automatically aligning an industrial truck in a warehouse, and system comprising an industrial truck and a warehouse
A method for automatically aligning an industrial truck in a warehouse, the method comprising the steps of: confirming that a pick has been executed by an operator and issuing a pick signal indicative thereof; determining a pick position and a next pick position and issuing pick position signals indicative of each; determining a side orientation of the industrial truck relative to a shelf side of a shelf aisle of the warehouse by the warehouse administration system in response to at least one of the pick position signals; and issuing a control command signal to the industrial truck such that the side orientation is automatically assumed for at least one of the pick positions. |
| US10850956B1 |
Hand held device
A handheld device is adapted to ascend and descend a cable. The handheld device includes a motor that is mechanically coupled to a gearbox shaft. A drive shaft is connected to the gearbox shaft with shaft drive bearings. A first housing is mechanically coupled to the motor and surrounding the drive shaft. The housing further includes a top side, a bottom side and at least one other side therebetween. A top housing opening and a side housing opening are arranged on the first housing. A cinch brake assembly, connected to the first housing. The cable is fed through the first housing, around the drive shaft, out of the first housing and through the cinch brake assembly such that the cinch brake assembly prevents movement of the cable through the first housing. |
| US10850952B2 |
Pipelayer with quick attach counterweights
A pipelayer machine having a counterweight assembly is provided. The pipelayer machine can include a main body having first and second sides, a first side track provided on the first side of the main body and a second side track provided on the second side of the main body. A side boom can be provided on the first side of the main body. The counterweight assembly can be provided on the second side of the main body and include a counterweight mounting frame. A counterweight can be provided having a first side with an engagement hook extending from the first side. The engagement hook can be used to attach the counterweight to the counterweight mounting frame. |
| US10850948B2 |
Escalator with a sensor for detecting sheave misalignment
An escalator system wherein when a handrail belt is moving from rotation of a plurality of elevator sheaves: a controller receives data from a plurality of sensors, identifies from the data a first sheave of the plurality of sheaves as comprising reference alignment value for the system, determines for the plurality of sheaves a respective plurality of alignment values, compares the plurality of alignment values with the reference alignment value, and provides a predetermined response when any of the plurality of alignment values diverges from the reference alignment value by more than a predetermined amount. |
| US10850943B2 |
Roller guide assembly and elevator system
A roller guide assembly for an elevator device, the roller guide assembly comprising a base member having a mounting means for mounting to the elevator device, the base member comprising a shaft support member; a roller wheel for engaging a guide rail to be rolled on the guide rail; a shaft on which the roller wheel is bearing-mounted, the shaft being straight and non-rotatably supported by the shaft support member, and a vibration dampening element, the vibration dampening element comprising an elastomer body arranged between the shaft and the shaft support member for dampening vibration of the roller wheel and for isolating the vibration from the base member. The shaft is attached to the shaft support member by the vibration dampening element forming a single attachment point for the shaft. The elastomer body is configured to form an elastically spring-loaded universal joint for the attachment of the shaft to provide a universal degree of freedom of an angular movement of the shaft and the roller wheel in relation to the base member. |
| US10850940B2 |
Retracting device for mounting to a web strap
Retractors and vests having the retractors are disclosed, wherein the retractor can be attached by an attachment mechanism to a web system on the vest. An accessory can be attached to a line within the retractor, and the user can extend the line from the retractor housing when the accessory is in use. When the line is extended from the housing, the retractor housing rotates so it is in alignment with the extended line. This alignment of the housing and line significantly reduces the stresses on the line, which in turn extends the reliability and lifespan of the retractor. Further, the line can be under a retraction force that retracts the line back into the retractor housing when the extension force is released. The retraction force can be strong enough to prevent the line from extending from under weight of the accessory. The retractor can also minimize the dangle length of the retracting device to the attachment point to minimize movement when not in use. |
| US10850937B2 |
Tail sealing apparatus
A nonadhesive phase-change material application apparatus for bonding the tail of a convolutely wound log to the body is provided. The nonadhesive phase-change material application apparatus has at least one nonadhesive phase-change material applicator that defines a cavity conveying a volume of nonadhesive phase-change material from a reservoir to an application site. |
| US10850936B2 |
Method and apparatus for processing envelopes containing contents
A method and apparatus for processing mail is provided. A feeder serially feeds envelope from a stack of mail. Two cutters at a cutting station cuts one or two edges of the envelopes. As the envelopes travel from the feeder to the cutters the envelope is jogged on two edges to justify the contents with the envelopes. Additionally, an improved feeder is provided to reduce the number of jams created when feeding the envelopes from the stack. |
| US10850931B2 |
Transfer of objects
Disclosed is a device for transferring objects from an accumulation surface to a downstream conveyor, including a first mobile strip, a second mobile strip arranged beyond the first mobile strip from the accumulation surface, a fixed surface arranged between the two mobile strips, and a element for transferring objects from the accumulation surface to the first and second mobile strips, and to the fixed surface. Also disclosed is a transfer method using such transfer device. |
| US10850929B2 |
Apparatus for unscrambling randomly arranged containers comprising extraction means independent of each other
Apparatus for unscrambling articles, in particular containers (100) fed randomly to an inlet of said apparatus, comprising: a transport system (20) for transporting the articles fed to the inlet; devices (31;32) for picking and releasing the articles (100), configured to pick up the articles arranged randomly on the transport system (20) and release them to an extraction system (50) with a predefined orientation and/or position; a detection system (60) designed to detect the position and the arrangement of the articles (100) in transit on the transport system and to provide the information for controlling the pick and release devices (30); a unit (500) for processing and controlling the components and the drives of the apparatus; wherein the extraction system comprises: a plane (40;140) for supporting the containers (100); means (50;150) for extracting the articles (100), designed to pick up the articles and transport them on the plane (40) towards the outlet (“O”) of the apparatus; said extraction means comprise a plurality of grippers (50;150), each comprising a pair of jaws (51;151), each gripper (50;150) being displaceable along a fixed guide (55) independently of one or more of the other grippers (50;150). |
| US10850927B2 |
Work system, method for executing work on object, and robot
Provided is a work system including: a conveying apparatus that conveys an object; a moving platform that can be moved; a work portion that is secured to the moving platform and that performs work on the object being conveyed by the conveying apparatus; a visual sensor that is secured to the moving platform and that successively acquires visual information about the object being conveyed by the conveying apparatus or a mark formed on the conveying apparatus; a detecting portion that successively detects at least positions of the object or the mark by processing the visual information acquired by the visual sensor; a calculating portion that calculates a conveying velocity of the conveying apparatus on the basis of the positions of the object or the mark successively detected by the detecting portion; and a drive control unit that drives the work portion by using the conveying velocity. |
| US10850924B1 |
Rod belt for rod belt conveyor
The invention relates to a rod belt for rod belt conveyors, in particular of agricultural machines, with transverse rods (4) arranged transverse to a running direction and parallel to one another, whereby the transverse rods (4) rest on tension-proof elastic and continuous belts (3) running parallel to one another and being attached to the belts (3) by attachment at a pre-determined rod spacing.According to the invention, it is provided that on at least one of the belts (3) a belt clip (5) is affixed via attachment (6), whereby said so attached belt clip (5) confines at least one cavity on a support surface of the respective belt (3) and at least one of the transverse rods (4) is cage-like housed in the at least one cavity in such a manner that the at least one transverse rod (4) is fixated via the belt clip (5) to the at least one belt such a manner that the at least one transverse rod (4) is fixated via the belt clip (5) to the at least one belt. |
| US10850922B1 |
Rotatable v-shaped conveyor and system and method of using the same
In one embodiment, a conveyor system has first and second conveyors. The first conveyor has inner and outer sides and a first conveyor surface between the inner and outer sides that is configured to carry payloads between first and second conveyor ends along a first direction. The second conveyor has inner and outer sides and a second conveyor surface between the inner and outer sides of the second conveyor that is configured to carry payloads between the first and second conveyor ends along the first direction. The first and second conveyors are coupled to one another such that the inner sides are spaced closer to one another than the outer sides and the first and second conveyors are angularly offset from one another. The conveyor system is configured to rotate between a first orientation and a second orientation about an axis that extends along the first direction. |
| US10850921B2 |
Storage and retrieval system
An automated storage and retrieval system including at least one autonomous transport vehicle, a transfer deck that defines a transport surface for the vehicle, at least one reciprocating lift, a first and second pickface interface station connected to the deck and spaced apart from each other, each station forming a pickface transfer interfacing between the vehicle on the deck and the lift at each station so that a pickface is transferred between the lift and the vehicle at each station, wherein the vehicle is configured to pick a first pickface at the first station, traverse the deck and buffer the first pickface, or at least a portion thereof, at the second station so that the second station has multiple pickfaces buffered on a common support in an order sequence of pickfaces according to a predetermined case out order sequence of mixed case pickfaces. |
| US10850920B1 |
Wheeled platform and methods of making and using the same
A wheeled platform for moveably supporting an object comprises a planar base, at least three straps, and at least three wheels. The base includes (i) at least three slots; and (ii) at least three base apertures extending through the base. Each of the straps includes (i) an end wall including an engagement element configured to engage a part of the object to releasably secure the wheeled platform to the object; and (ii) a strap aperture. Each of the straps is positioned with the end wall of the strap extending through a corresponding one of the slots within the base, such that each strap aperture is aligned with a corresponding one of the base apertures. Each wheel stem is secured extending through a corresponding set of aligned apertures to fix the components of the wheeled platform together in place. |
| US10850919B2 |
System and method for producing a liner implement
A system including a liner implement that is configured to provide a lining for at least a receptacle, the liner implement includes an upper edge component having an outer surface portion and an inner surface portion. A retention strip implement engages the upper edge component, to tighten the upper edge component around an upper opening of the receptacle. A first end segment of the retention strip implement is configured to engage the outer surface portion of the liner implement. A second end segment is configured to engage the inner surface portion of the liner implement being operable for tightening the upper edge component around an upper element of said receptacle. An adhesive free area is configured to be operable for grasping during the engagement of the second end segment adhesive with the inner surface portion of the liner implement upper edge component. |
| US10850918B2 |
Container
The present invention provides a container having a bottom frame; the bottom frame includes a pair of bottom side rails, a plurality of cross member and a floor. The pair of bottom side rails are located at both sides of the bottom of the container respectively. The plurality of cross members are located between and connected to the bottom side rails. The floor is laid on the cross members and extends along the longitudinal direction of the container; the floor comprises a first steel floor. The bottom frame further includes a grit discharging structure configured to discharge the grits, collected on the upper surface of the first steel floor after the inner surface and/or the welding seam on the inner surface of the container is shot-blasted, from the container. The container according to the present disclosure could allow for discharging the sand collected on the upper surface of the first steel floor after shot-blasting the inner surface and/or the welding seam on the inner surface of the container, thus facilitating the shot-blasting. |
| US10850916B2 |
Container for protecting baked goods
Disclosed is a container for protecting baked goods during shipment that includes, among other elements, a lid and a base. The base includes a plurality of wells and interconnected posts. Each well is adapted for supporting a baked good during shipment. The interconnected posts are formed in the base and extend upwardly from a base bottom. Each post is positioned adjacent to at least one of the wells and includes a retainer shoulder that is positioned proximate an upper end of the post and adapted to positively capture baked goods in each of the adjacent wells. |
| US10850903B2 |
Fold open face seal package
A fold open face seal package is provided. The package may comprise a one or two-piece thermoformed blister adhered to a backing card. In the one piece embodiment upper and lower portions of the blister are connected by one or more hinges. In the two-piece embodiment the blister is cut into upper and lower pieces which are adhered to the backing card. The package may be opened by folding the backing card back along a bend line and then reclosed for later use. |
| US10850902B2 |
Carton and blank therefor
Aspects of the disclosure relate to a carton for packaging one or more articles, a blank for forming the carton and a method of packaging articles. The carton comprises a plurality of panels forming walls of a tubular structure including a top wall, a first side wall, a base wall, and a second side wall. An end closure structure at least partially closes an end of the tubular structure. The end closure structure includes: a top end closure flap having a handle flap which defines at least in part a handle opening in the top end closure flap for forming a carrying handle; a side end closure flap coupled to one of the first and second side walls; wherein the side end closure flap comprises a portion which underlies the handle flap when both the top and side end flaps are folded into an end-closing position. |
| US10850901B2 |
High-strength fluting from NSSC pulp
There is provided a method of producing a containerboard, comprising the step of pressing a web formed from a pulp comprising NSSC pulp in an extended nip press, such as a shoe press, wherein the line load in the extended nip press is above 1200 kN/m. Further, there is provided a corrugated board comprising a liner and a fluting, wherein the fluting is formed from a pulp comprising NSSC pulp, the density of the fluting is above 725 kg/m3 and the geometric SCT index (ISO 9895) of the fluting is above 37 Nm/g. |
| US10850899B2 |
Low profile funnel
A container comprising a receptacle, a lid, and a funnel is disclosed. The receptacle defines an interior storage chamber and has an upper rim defining a top opening. The lid is removably attachable to the receptacle for enclosing the top opening. The lid comprises an interior surface. The lid defines an interior headspace between the upper rim of the receptacle and the interior surface of the lid. The funnel comprises a unitary body shaped to fit within the interior headspace. |
| US10850898B2 |
Child-resistant container having cap retainer features
A container body has a neck defining an opening with an axis. The neck includes a projection that projects radially away from the axis. A cap includes a wall that defines at least part of an exterior of the cap. The wall includes an aperture extending therethrough. The cap is removably attached to the neck and supported for movement on the neck between a first position and a second position. The wall is resiliently flexible for radial movement between a retained position and an unretained position with respect to the neck. In the retained position the projection retains the cap in the first position. The wall, in the unretained position, allows movement of the cap from the first position toward the second position. |
| US10850896B2 |
Valve device for at least one liquid plastic component
A valve mechanism for at least one liquid plastic component or liquid plastic, includes a closure device that includes a needle to be pressed against a seat in order to close a valve opening in the valve mechanism. The needle and/or seat is designed or mounted in such a way as to be resilient. |
| US10850894B2 |
Dispensing system, spout and squeezable container
The present invention relates to a dispensing system for a squeezable container that can contain a fluid. The dispensing system comprises a housing with a fluid receiving space, a spout with spout opening through which fluid can be dispensed and biasing means for biasing the spout opening to a state wherein fluid dispensing is blocked; wherein the spout is flexible and wherein the spout opening can move with respect to the housing. |
| US10850892B2 |
Sheet material container
A sheet material container (C1) comprising a containing portion (10a) that contains contents (96) and formed of a layer sheet (120S). Among a first inner layer sheet (122Sa, 123Sa), a first outer layer sheet (121Sa) and a second inner layer sheet (122Sb, 123Sb), a sheet on one side of the sheet material container C1 with respect to a decorative portion (36b, 36c, 36d, 36h) has a light transmitting portion (34d, 34e, 34f, 34g) capable of transmitting visible light. The plurality of decorative portions (36b, 36c, 36d, 36h) are configured to be at positions where visible light is transmitted from the outside of the sheet material container (C1). |
| US10850890B2 |
Organizational clasp for cooler
A clasp, including an inferior component, including a first surface, a first pad connected to the first surface, and a first buckle portion connected to the first surface, and a superior component displaceable relative to the inferior component, the superior component including a second surface, a second pad connected to the second surface, and a second buckle portion operatively arranged to engage the first buckle portion and secure the superior component to the inferior component, wherein in a fully closed position, the first pad and the second pad form a clamp. |
| US10850889B2 |
Device for adapting the spacing between two plate-shaped bearing elements for storing containers
A device for adapting the spacing between two board-type bearing elements for the vertical storage of barrels, comprising a number of supporting rods for insertion between the two bearing elements as well as structure for individually and infinitely variably adjusting the length of the supporting rods depending on the height of the barrels for locally varying the spacing between the two bearing elements. The structure for adjusting the length of each supporting rod comprise either two partial rods connected via a screw thread or a height-adjustment element, which is connected to one end of the supporting rod via a screw thread. Alternatively, the supporting rod can also be formed as a hydraulically or pneumatically length-adjustable telescopic rod. |
| US10850885B1 |
Method and apparatus for applying a label to a spool or reel
An apparatus for applying a label to a spool or reel containing wire and a wire tail extending from the spool or reel, the apparatus comprising a wire tail sensor, wherein the wire tail sensor identifies the location of the wire tail protruding from the spool or reel and a label application mechanism, wherein the labeling mechanism applies a label to the spool or reel and wherein the label does not contact the wire tail protruding from the spool or reel. |
| US10850880B2 |
Plastic bag dispenser
A plastic bag dispenser is disclosed. The plastic bag dispenser contains an elastic cord which has a first a first end and a second end. There is also a first spindle, which has the ability to connect to the first end of said elastic cord, and a second spindle, which has the ability to connect to the second end of the elastic cord, such that when the first spindle is connected to the first end of said elastic end and the second spindle is connected to the second end of the elastic cord, there exists the ability to hold a roll of plastic bags between the first spindle and the second spindle without the roll of plastic bags unraveling. The adjustable elastic cord secures the plastic bags to the roll on which the plastic bags are wrapped and serve to act as a pressure element to easily tear off a perforated bag. |
| US10850879B2 |
Machine and method for secondary packaging of articles
A side loading packaging machine for packaging articles in containers including: a section for forming containers starting from die-cuttings, comprising at least one feeding device, a loading section, a closing section, substantially aligned along a longitudinal axis of the machine; a conveyor equipped with transportation members configured to carry at least one of said containers, wherein said conveyor includes a motor arranged to drive the advance of said transportation members or groups thereof in an independent manner, and the machine operates with: a continuous formation of boxes, said feeding member working with a continuous movement and with a constant rate over time, and said transportation members advancing with a continuous movement at said forming section; and a static loading, said transportation members being stationary during the loading of articles into the containers. |
| US10850878B2 |
Apparatus and method for packaging sachets
Packaging apparatus of sachets comprising a primary packaging unit, a secondary packaging unit, and a transfer unit interposed between the primary and the secondary packaging units in order to transfer the sachets between the primary and secondary packaging units, wherein the transfer unit comprises at least three transfer drawers disposed one after the other, selectively movable independently along a closed-ring path between a reception station and a delivery station and vice versa, each of the transfer drawers being configured to contain a first number of sachets and the transfer unit comprising a removal member associated with the delivery station and configured to remove from one or more of the transfer drawers a second number of sachets and to supply them to the secondary packaging unit. The present invention also concerns a method for packaging sachets. |
| US10850877B2 |
Package forming systems and related methods
Packaging forming system and related methods are provided. A packaging forming system can include a controller and nip rollers in communication with the controller. The nip rollers are positioned on either side of a product pathway on which products being packaged travel. The packaging forming system can include a top sheet material guide system that is configured to feed a top sheet material and a bottom sheet material guide system that is configured to feed a bottom sheet material to the nip rollers to form sides of packages around one or more products traveling along the pathway. The packaging forming system can include an adjustable table in communication with the controller and positioned along the pathway to provide support to the product being packaged such that the height of the table is movable to adjust a height position of each individual product to be packaged relative to the nip rollers. |
| US10850869B2 |
Spacecraft servicing devices and related assemblies, systems, and methods
Spacecraft servicing devices or pods and related methods may include a body configured to be deployed from a host spacecraft at a location adjacent a target spacecraft and at least one spacecraft servicing component configured to perform at least one servicing operation on the target spacecraft. The servicing device may include a communication device configured to receive data relating to the target spacecraft from a location remote from the spacecraft servicing device. The servicing device may include a coupling mechanism comprising at least one movable coupling configured to rotate the body relative to the target spacecraft when the spacecraft servicing pod is coupled to the target spacecraft. The at least one spacecraft servicing component may include at least one propulsion device positioned on a boom arm extending away from the body. |
| US10850866B2 |
Pod cover system for a vertical take-off and landing (VTOL) unmanned aerial vehicle (UAV)
An unmanned aerial vehicle (UAV) storage and launch system includes a UAV pod having an open position and a closed position, the closed position establishing an interior that is weather resistant to an environment external to the UAV pod and a vertical takeoff and landing (VTOL) UAV enclosed in the UAV pod so that the UAV pod in the closed position provides a weather resistant interior for the VTOL UAV. |
| US10850862B2 |
Systems and methods for signaling during aerial refueling operations
An example indication system for use with a refueling system including a hose for supplying fuel from a tanker aircraft to a receiver aircraft and a refueling coupler coupled to an end of the hose is described. The indication system includes a first transceiver located at the refueling coupler and configured to receive refueling information from a second transceiver located at the tanker aircraft, a plurality of light sources located at the refueling coupler, and a processor in communication with the first transceiver to receive the refueling information, and in communication with the plurality of light sources to operate the plurality of light sources based on the refueling information. |
| US10850860B1 |
Internal combustion engines with unidirectional compounding drives
A compounding drive includes an input member, an epicyclical gear arrangement connected to the input member, an output member connected to the epicyclical gear arrangement, and a hydraulic pump/motor set. The hydraulic pump/motor set connects the epicyclical gear arrangement to the output member through an overrunning clutch for unidirectional communication of mechanical rotation between the input member and the output member. Engine arrangements, aircraft, and methods of compounding internal combustion engines are also described. |
| US10850859B2 |
Aircraft with a propulsion unit with offset fan
An aircraft includes a wing having a first upstream spar and a second downstream spar extending in the direction of the span of said wing, and at least one propulsion unit supported by the wing. The propulsion unit includes a turboprop engine and a propeller. The propeller includes an external annular casing fixed to a suction surface of the wing, and at least to the first upstream spar via at least one first and second fastener. |
| US10850858B2 |
Breakaway cover for emergency access
A breakaway cover for providing emergency access to a release mechanism for a life raft on a vehicle includes a housing configured to be attached the vehicle. The housing includes a recess wherein the release mechanism may be located. The recess is protected by a cover. The cover has a first end attached the housing and a second end retained to the housing but capable of being pulled free. The cover is configured to fracture along a series of slots proximate the first end when pulled by a user. |
| US10850857B2 |
Ice detection
The present disclosure concerns the detection of ice within a system. More specifically, but not exclusively, the disclosure concerns the detection of ice accretion within a gas turbine engine. The apparatus and method relies on heating a first region (38) of a component (44) and comparing the measured temperature of the first region (38) with a second temperature value, possibly measured at a distinct second region (40) of the component (44). |
| US10850856B2 |
Aircraft galley cart door interlock
An aircraft galley compartment cooling system includes a source of chilled air, and a closed compartment with a door. A sensor detects the opening of the door, and sends a signal to the cooling system to deactivate while the door is opened to prevent ambient air from entering the cooling system. Once the door is closed, the cooling system is reactivated. The sensor can be a light sensor, a mechanical sensor, a magnetic sensor, or the like for determining movement or the presence/non-presence of the door to the compartment. |
| US10850854B2 |
Three wheel and simple cycle aircraft environmental control system
An environmental control system of an aircraft includes a ram air circuit including a ram air shell having at least one heat exchanger positioned therein, at least one dehumidification system arranged in fluid communication with the ram air circuit, a compressing device arranged in fluid communication with the ram air circuit and the dehumidification system, and an expansion device arranged in fluid communication with the ram air circuit and the at least one dehumidification system. |
| US10850853B2 |
Environmental control system utilizing bleed pressure assist
A system is provided. The system includes a first inlet providing a medium from a source, a compressing device in communication with the first inlet, and at least one heat exchanger. The compressing device includes a compressor that receives the medium, a first turbine downstream of the compressor, and a second turbine that receives the medium. An outlet of the at least one heat exchanger is in fluid communication with an inlet of the compressor and an inlet of the first turbine. |
| US10850849B2 |
Vehicle armrest with cup holder
An armrest with cup holder for a vehicle seat that includes an elongate armrest can of the armrest adapted to be carried by the seat. An elongate storage area is formed in the armrest can, and the cup holder is mounted for movement along a longitudinal axis of the armrest between a stowed position within the storage area of the armrest can and a deployed position forward of and to the exterior of the armrest. When stowed, the cup holder is positioned fully within the armrest can. The tray table of the seat can therefore be used for purposes other than supporting a beverage container, and can be used when the tray table is stowed. |
| US10850842B2 |
Unmanned aerial vehicle and method using the same
An unmanned aerial vehicle (UAV) includes a body, a plurality of rotated propulsion systems, and at least one air bag. The rotated propulsion systems are connected to the body and each includes a blade and an actuator configured to actuate the blade. The air bag is disposed on the body. |
| US10850834B2 |
Landing gear systems for aircraft employing a cross tube
A landing gear system for an aircraft includes an aft landing gear fitting coupled to the aircraft and a cross tube rotatably coupled to the aft landing gear fitting. The landing gear system also includes first and second wheel fittings coupled to the first and second ends of the cross tube, respectively, and first and second wheels rotatably coupled to the first and second wheel fittings, respectively. |
| US10850829B2 |
Aerodynamic flap support structure
A flap deployment apparatus and system for a wing of an aircraft that includes a support structure having a first aerodynamic surface. A nose fitting secures the support structure to a forward portion of an aircraft wing and an aft fitting secures the support structure to an aft portion of the wing. A carrier beam having a second aerodynamic surface is coupled to the support structure. The carrier beam is movable between a stowed position and a deployed position. Links guide the carrier between the positions. The first and second aerodynamic surfaces are configured to define a continuous aerodynamic surface when the carrier beam is in the stowed position. The apparatus includes a nose fairing having a third aerodynamic and a mid fairing cover having a fourth aerodynamic surface. The third and fourth aerodynamic surfaces also defines the continuous aerodynamic surface when the carrier beam is in the stowed position. |
| US10850828B2 |
Movable wing for weight and balance management
An aircraft includes a fuselage having a longitudinal axis, a wing assembly, and a fuselage positioning mechanism operatively connecting the fuselage to the wing assembly. The fuselage positioning mechanism is operable to move the fuselage relative to the wing assembly in a longitudinal direction parallel to the longitudinal axis between a fuselage maximum forward position and a fuselage maximum aft position. When the aircraft for flight, a position of a center of gravity of the aircraft relative to a center of lift is determined. The fuselage can be moved relative to the wing assembly to bring the center of gravity within an allowable range of distances from the center of lift to balance the aircraft for flight. The fuselage positioning mechanism can be automated to allow adjustment of the fuselage position during the flight of the aircraft. |
| US10850827B2 |
Airfoils for stunt flights
The invention relates to airfoils, called jn1431-265 and 1413-362, which operate intelligently by adjusting the variable aerodynamics thereof, not only through the attack and sine angle, but also through the effect of scale (air speed), which, when combined, improve the efficiency of the wings configured therewith by up to 30%, cause the wings to experience a predictable stall and also rapidly recover therefrom, and also making the wings configured therewith more efficient at low speed, which reduces the need to use flaps or slats (“high lift devices”), and, in the event that flaps or slats are used, increase the effect of said airfoils even more. On the other hand, at an increased speed, the aerodynamic variables also adjust by up to a third of the value thereof (the angle of attack remaining unchanged), causing the wing to also be very stable at high speed conditions. |
| US10850823B2 |
Ship operation management system
An LNG carrier which uses natural gas generated by vaporization of LNG as propulsive fuel and including cargo tank, spray apparatus, and carrier communication device; land-based equipment including land-based communication device and processing device; processing device including: first vapor quantity estimating section which estimates total quantity of natural vapor generated from the LNG remaining in the cargo tank in a case where the LNG carrier is traveling on planned ballast course, based on sea weather data; a second vapor quantity estimating section which estimates a total quantity of spray vapor generated by performing spraying operations in a case where the LNG carrier is traveling on planned ballast course, based on the sea weather data; and heel quantity calculating section which calculates required heel quantity, by summing the total quantity of natural vapor and spray vapor, and the land-based communication device transmits the required heel quantity to the carrier communication device. |
| US10850819B2 |
Bracket assembly for a marine outboard motor
A bracket assembly for a marine outboard motor has a stern bracket, a swivel bracket pivotably connected to the stern bracket to pivot relative to the stern bracket about a tilt axis, a motor mount pivotably connected to the swivel bracket to pivot relative to the swivel bracket about a steering axis, a steering lock bracket operatively connected to the motor mount and being pivotable with the motor mount relative to the swivel bracket about the steering axis, and a locking member. The locking member is one of: a) movably connected to the swivel bracket to move between a locked and an unlocked positions, and b) removably connected to both the swivel bracket and the steering lock bracket to prevent or limit pivoting of the motor mount about the steering axis. |
| US10850818B2 |
Marine outboard motor mount fastener retainer
A marine outboard motor mount fastener retainer, system, and method are presently disclosed. The fastener retainer has a first end portion configured to be held about a first motor mount fastener and a second end portion configured to be held about a second motor mount fastener. An extension extends from the first end portion of the motor mount fastener retainer to the second end portion of the motor mount fastener retainer. The extension is configured to hold the first and the second end portions of the retainer and to prevent rotation of the first and the second motor mount fasteners. |
| US10850817B2 |
Fin-based watercraft propulsion system
A watercraft comprises a motor, an inertial mass, and a fin. The motor oscillates the inertial mass about an axis, producing a torque reaction on and oscillation of the motor. Oscillation of the motor is communicated to the fin, producing thrust. A fluke, fin, or wing comprises an angle of attack mechanism, wherein the angle of attack mechanism may use power from the fluke, fin, or wing to adjust an angle of attack of the fluke, fin, or wing relative to a surrounding thrust fluid. |
| US10850815B2 |
Water rescue devices using expanding flotation nets and other expanding, body-gripping forms
New water rescue devices and methods of use are provided. In some embodiments, a rescue device comprises an inflatable net with a handle, and a switch for causing the inflation of the inflatable net. In some methods, a user positions the inflatable net underneath at least part of a person or other object prior to inflation, and the inflating net rises due to increased buoyancy, while water passes through and below the net. The rising net lifts the person or object above the surface of a body of water, rescuing the person or object. In some embodiments, the invention is incorporated in a rescue buoy or rescue can. In some embodiments, an inflatable body other than a net also, or alternatively, is provided. For example, an expanding flotation ring or other flotation device is provided, which envelopes and holds the person or object when inflated. |
| US10850807B2 |
Pontoon boat
A pontoon boat includes port and starboard pontoons and cross members connecting the pontoons. A shock absorber may be installed at each point of connection of the pontoons to the cross members. A cross member may be embodied as a double-webbed beam having first and second parallel flanges and first and second webs disposed between and connected to the flanges. Each pontoon may include a two-stage lifting strake having a first surface and a second surface inclined from the first surface. |
| US10850806B2 |
Systems and methods for attachment of vehicle accessories
An anchor fixture, for attaching accessories to a vehicle surface has a fixture body with a base for attaching to the vehicle surface. The fixture body has an anchor aperture for receiving an anchor of a first accessory, a fastener aperture for receiving a tongue fastener of a second accessory, and an anchor chamber disposed at least partly outwardly of the anchor aperture and communicating with the anchor aperture and the fastener aperture. The fastener aperture central axis is parallel or at an acute angle to the base. Accessories and accessory attachment systems are presented. Another fixture has a slot defined by the fixture body for receiving a vehicle accessory projection and a surface opposite the slot for engaging the projection. The slot is adapted to receive an anchor which selectively engages a surface adjacent to the slot. Accessories with anchors and corresponding projections are also presented. |
| US10850803B2 |
Electric bicycle
An electric bicycle having a control unit, a drive unit, a battery unit, a display unit and a remote control unit for display unit, remote control unit being situated in the region of a handlebar grip remote from display unit. According to the present disclosure, electronic control unit is situated in seat tube of bicycle frame. |
| US10850802B2 |
Method for managing the energy range of an assisted pedal electrical bicycle
A management method for the energy range of a rechargeable battery pack of an assisted pedal electrical bicycle (1) including an electrical machine controllable for supplying a torque according to a pedal assistance factor, said torque being summed to the one generated by a cyclist through the pedaling, the management method including the following steps: a) selecting a route to be traveled by the electrical bicycle (1) starting from an initial position; b) obtaining data representative of the altitude profile of the selected route and dividing the route in a plurality of segments each being characterized by a respective altitude parameter; c) calculating a value correlated to the maximum percentage of battery pack (20) discharge on the selected route as a function of the altitude profile and of a limit pedal assistance factor K_limit, preferably calculating a value for each segment representative of the percentage of battery pack (20) discharge on the segment as a function of a limit assistance factor K_limit associated to each segment based on the altitude parameter associated to the segment; d) verifying whether the battery pack (20) has a residual positive charge or not at N the end of the route; wherein, if following that step d) of verifying it is determined that the battery pack (20) does not have a residual positive charge at the end of the route, then the management method iteratively repeats the steps c) and d) modifying the limit assistance factor K_limit based on one or more adjustment curves each allowing to obtain a new limit assistance factor for each segment as a function of the segment slope. |
| US10850799B2 |
Adjustable bicycle suspension
A bicycle assembly can include a bicycle frame having a main frame and a sub-frame, and a shock absorber assembly. The shock absorber assembly can comprise a shock absorber and an extension body. The sub-frame can rotate in relation to the main frame and the shock absorber assembly can be used to regulate that relationship. An eccentric insert positioned functionally between the shock absorber and extension body can be used to modify the overall length of the shock absorber assembly to beneficially alter the geometry of the bicycle frame. |
| US10850796B2 |
Bicycle rear suspension
A bicycle comprises a front wheel; a rear wheel; a frame comprising a main frame portion and an articulating frame portion, the articulating frame portion comprising: a lower arm pivotally supported at a first axis by the main frame portion; an upper frame link pivotally supported at a second axis by the main frame portion; an upper arm pivotally coupled to the upper frame link at a third axis; an upper shock link pivotally coupled to the upper frame link and the upper arm at the third axis; and a lower shock link pivotally coupled to the main frame portion and the lower arm at the first axis; and a shock absorber having a first end pivotally supported at a fourth axis by the main frame portion, and a second end pivotally supported at a fifth axis by the upper shock link and the lower shock link. |
| US10850793B2 |
Lower fork alignment system
A lower fork alignment system for a vehicle is described. The lower fork alignment system includes: a brace detachably coupling a first lower tube and a second lower tube of a lower fork, wherein the first and second lower tubes include: first and second receiving adjustment mechanism configured for receiving corresponding interfacing mechanisms of the brace, wherein upon receipt of alignment features of the interfacing mechanisms, one of the first lower tube and the second lower tube is enabled to be adjusted in a horizontal direction along a horizontal axis, and the other of the first lower tube and the second lower tube is enabled to be adjusted in a vertical direction along a vertical axis. |
| US10850790B2 |
Straddle-type vehicle
An electrical component box disposed from above to below a main frame, and a fuel tank disposed in the upper part of the main frame and above the electrical component box, are arranged to the vehicle rear with respect to a head pipe comprising a motorcycle. In this case, the top of the electrical component box is open. In the gap between the electrical component box and the fuel tank, a gap cover is arranged to hide the gap from the outside. |
| US10850785B2 |
Balance bike conversion systems
A balance bike conversion system may include first and second protective inserts, each having an interface adapted to engage opposite ends of a bicycle bottom bracket. A connector may be adapted to connect the first and second protective inserts, and may be adapted to adjust the distance between the inserts, thereby accommodating variability in the width of the bottom bracket. The system may further include adapters to enable the system to be used with bicycles having bottom brackets with different diameters, and may use an elastomeric gasket to accommodate larger bottom brackets. The protective inserts and/or adapters may provide mechanical support to the bottom bracket, thereby protecting it from damage. |
| US10850781B2 |
Motor vehicle body having an air-guiding unit
A motor vehicle body includes an air-guiding unit having an air-guiding element configured to be positioned flush with the motor vehicle body and movably connected to the motor vehicle body and an adjustment unit including an actuation element arranged fixedly on a support element of the motor vehicle body and configured to aid movement of the air guiding element. The motor vehicle body further includes a receiving space configured to receive the air-guiding element, wherein the receiving space is arranged in a rear region of the motor vehicle body. The support element is designed in a form of a torsional profile for reinforcing a rear lid, forming the receiving space, of the rear region. |
| US10850779B1 |
Laterally inset trailer skirt reducing vehicle drag
An inwardly disposed trailer skirt panel assembly disposed laterally inset toward the longitudinal centerline of the vehicle. The trailer skirt panel assembly is suspended underneath a rearward body component of a truck or semitrailer, extending forwards in front of a rearward wheel assembly. The trailer skirt panel assembly stabilizes the generally static air passing under the central portion of the moving vehicle, further increasing the effective air pressure being developed immediately behind the vehicle to reduce drag thereon. |
| US10850778B2 |
Tailgate lift handle, lift assembly, and related apparatus
An apparatus for aiding a user in raising and lowering of a tailgate includes a handle and a connector for connecting the handle to the tailgate to allow for movement of the handle rearwardly relative to the tailgate as the tailgate is initially lowered by the user and forwardly to a position above the tailgate as the lowering of the tailgate is continued. A tailgate lift assembly includes a housing extending along a predetermined length, a spring anchored at one end at a first end of the housing, a connector having a first end affixed to the opposite end of said spring and extending through said housing, and a first fixed guide around which the connector extends. A bumper for covering a corner of a tailgate is also provided. |
| US10850777B2 |
Vehicle
A vehicle is provided in which a plurality of attachment connecting portions are provided easily and the functionality of a carrier can be improved. A front carrier includes a pair of left and right side resting portions. The side resting portion includes a resting plate forming a loading surface and including edge portions of mounting holes as a plurality of attachment connecting portion. The resting plate includes cut-out portions inside corner portions thereof. |
| US10850776B2 |
Motor vehicle
A motor vehicle has a self-supporting body which has a passenger compartment, with two longitudinal members, with two rear reinforcing struts which run in a V-shaped manner and are fastened at the front ends thereof to lateral longitudinal member portions of the two longitudinal members. The lateral longitudinal portions run below the passenger compartment. The two reinforcing struts are arranged at the rear ends thereof on a receiving component. The receiving component is a plastics/metal hybrid component which is composed of an open, shell-shaped metal component and of a fiber-reinforced reinforcing plastics component. The plastics component is integrated in the metal component and reinforces the metal component. |
| US10850775B2 |
Vehicle lower portion structure
In a vehicle lower portion structure, a plurality of cross members are suspended along a vehicle width direction between a pair of side rails. Further, an oil pan guard is suspended along a longitudinal direction between a No. 2 cross member and a No. 3 cross member to protect an oil pan of a transmission from below. When a vehicle collides on its front, engagement between the oil pan guard and the cross member is released, to thereby prevent a decrease in the amount of collision energy to be absorbed by the pair of side rails. |
| US10850772B2 |
Vehicle frame structure
A vehicle frame structure includes: an adhesive member that is superimposed on and adhered to a plate shaped vehicle frame member extending in one direction such that the adhesive member is superimposed in a thickness direction of the vehicle frame member; a first fiber reinforced plastic member that includes plural first fibers oriented in different directions to each other, and that is disposed spaced apart from the vehicle frame member in the thickness direction; and a second fiber reinforced plastic member that includes plural second fibers oriented in an orientation direction of an intersecting direction intersecting the thickness direction, that has a thinner thickness in the thickness direction than a thickness of the first fiber reinforced plastic member, and that is sandwiched between the adhesive member and the first fiber reinforced plastic member in the thickness direction. |
| US10850769B2 |
Detecting apparatus and electric power steering apparatus
A detecting apparatus that uses a redundancy configuration comprising plural sensor sections including plural detecting sections, accurately performs abnormality detection and function continuation in a control apparatus such as an ECU in a case that abnormality is occurred in the sensor sections or a signal line, and has simple manufacturing processes, and an electric power steering apparatus equipped with the detecting apparatus. The apparatus includes plural sensor sections which include plural detecting sections that detect a same object or a same state quantity, and detects at least one of the state quantities in at least two of the sensor sections, wherein each of the sensor sections has a communication section that outputs the state quantities, which the detecting sections detect, as an error detectable signal. |
| US10850766B2 |
Portable device data calibration
A computer includes a processor and a memory, the memory storing instructions executable by the processor to initiate a calibration based on a portable device stability and a steering wheel angle, detect a vehicle pedal actuation, and, then, based on a portable device acceleration, determine a calibration vector between a portable device coordinate system and a vehicle coordinate system. |
| US10850763B2 |
Steer-by-wire steering system
The steer-by-wire steering system comprise a steering input device and a steering operation device that steers wheels which are mechanically coupleable. The steering input device includes a steering-side motor that supplies a steering shaft with a steering reaction force, the steering operation device includes a steered-side motor that supplies a rack shaft with a steering force, and a power supply control circuit that controls the steering-side motor to generate the steering reaction force and that controls the steered-side motor to generate the steering force. When the duty ratio of a duty signal that is generated to control the power supply to the steered-side motor reaches a setting value that is defined to indicate that a steered angle becomes unable to follow a steering angle, the power supply control circuit controls the power supply to the steering-side motor such that the steering-side motor increases the steering reaction force. |
| US10850760B2 |
Foldable wheeled carrier including wheel folding actuation handle
A wheeled carrier device such as a baby stroller, golf cart, child carrier, or general carrier or cargo cart, comprising a bottom frame with at least two rear wheels and at least one front wheel, and may include a movably mounted upper carrier frame with a selectively removable, adjustable and/or reversible carrying element which may include child seating, with a unique wheel folding mechanism that interconnects all the wheels, so that simple movement of a wheel folding grasp synchronously moves all the wheels between the operative, rolling position and their stowed fold flat positions parallel with the bottom frame, with the wheel folding mechanism operable independently of collapsing movement of an optional upper carrier frame which also folds flat and parallel with the bottom frame. |
| US10850758B1 |
Telescoping cart apparatus and method
A telescoping cart apparatus and method consists of a carrier configured to include receptacles for carrying cleaning materials. A carry handle is connected with the carrier where the carry handle is connected across the middle of the carrier. A divider is connected beneath the carry handle and is connected with the carrier such that the divider creates two separate sections of the carrier. Telescoping support legs are connected with the carrier where the telescoping support legs are adjustable from a retracted position within the carrier to an extended position outside of the carrier. An extendable adjustment handle is connected with the carrier. A button in the carry handle where the button is connected with the telescoping support legs for adjusting the positions of the telescoping support legs and wheels connected with the telescoping support legs. |
| US10850756B2 |
Redundant, self-deterministic, failsafe sensor systems and methods for object detection, speed and heading
Railroad object detection systems and methods include radar sensors detecting object presence, speed and heading in a different manner. A controller compares signal outputs from the different sensors to make real time health assessments and self-diagnose sensor problems in a railroad application. The sensor devices may include an ultra-wideband (UWB) impulse radar device and at least one reflective device providing failsafe object presence detection and object non-presence detection in redundant fashion with at least a second sensor device such as a side-fired radar device. |
| US10850755B2 |
System and method for building and managing a train consist
Railyard management system for managing, assembling, disassembling and validating train consists and monitoring railcars in the railyard. The system provides for the collection of data and the movement of data from lower processing levels to higher processing levels, where an inference engine draws inferences regarding the current state of railcars and train consists within the railyard. The inferences are assigned confidence levels based on the methods and available data used to draw the inferences. The system can be used to track the location and orientation of railcars in the railyard and to validate order and orientation of assets in a train consist. |
| US10850754B2 |
Distributed fibre optic sensing for monitoring rail networks
This application describes methods and apparatus for monitoring of rail networks using fibre optic distributed acoustic sensing (DAS), especially for condition monitoring. One method involves taking (902) a first data set corresponding to measurement signals from a plurality of channels of at least one fibre optic distributed acoustic sensor (100) having a sensing fibre (101) deployed to monitor at least part of the path of the rail network (201). The first data set corresponds to measurement signals acquired as a train (202) passed along a first monitored section of the rail network. The method involves identifying (903) a speed of the train through the first monitored section and dividing (904) the first data set into a plurality of time windows. Each time window contains a different subset of the first data set, with the measurement signal for each successive channel in a time window being delayed with respect to the previous channel by a time related to the identified train speed. For each time window, any appropriate time shift is identified (905) and applied (906) to the measurement signals for a channel so as to substantially align the measurement signals of the channels within the time window. The data from the time windows is then combined (907) after any time shifts have been applied to form an aligned first data set; and a characteristic train signal is derived (908) from the aligned first data set. The characteristic signal may be removed from the aligned first data set (1007) to leave remainder data. The characteristic trains signal and/or remainder data may be analysed for condition monitoring. |
| US10850749B2 |
Railcar bogie
An axle box suspension includes: a coupler extending from an axle box in a car longitudinal direction and including a tubular portion at an end portion of the coupler, the tubular portion being open toward both sides in a car width direction; a core rod inserted into an internal space of the tubular portion, a pair of protruding portions being provided at both sides of the core rod in the car width direction; an elastic body interposed between the tubular portion and the core rod; a pair of receiving seats provided at the bogie frame and including a pair of groove portions which are open toward the car width direction and an upper side; a pair of lids pressing, from above, the pair of protruding portions fitted into the pair of groove portions from above; and fasteners fixing the lids to the receiving seats. |
| US10850747B2 |
Data mining in a digital map database to identify insufficient merge lanes along roads and enabling precautionary actions in a vehicle
Disclosed is a feature for a vehicle that enables taking precautionary actions in response to conditions on the road network around or ahead of the vehicle, in particular, an intersection without traffic signals and without a sufficient merge lane. A database that represents the road network is used to determine locations where roads meet without a traffic signal and without a sufficient merge lane. Then, precautionary action data is added to the database to indicate a location at which a precautionary action is to be taken about the location of the insufficient merge lane. A precautionary action system installed in a vehicle uses this database, or a database derived therefrom, in combination with a positioning system to determine when the vehicle is at a location that corresponds to the location of a precautionary action. When the vehicle is at such a location, a precautionary action is taken by a vehicle system as the vehicle is approaching a location of an insufficient merge lane. |
| US10850746B2 |
Coordinating delivery of notifications to the driver of a vehicle to reduce distractions
A notification control system (NCS) is configured to coordinate the delivery of notifications issued from a set of devices to the driver of a vehicle. The NCS registers all interactive devices residing in a vehicle and causes those devices to conform to specific directives generated by the NCS. The NCS analyzes and predicts the cognitive and emotional load on the driver and also estimates the cognitive and emotional impact on the driver potentially caused by any incoming notifications. The NCS then coordinates the delivery of notifications to the driver in a manner that avoids overwhelming the cognitive and/or emotional capacity of the driver. Accordingly, the NCS may avoid situations where device notifications cause the driver to unsafely divert attention away from driving. |
| US10850743B2 |
Parking system with interactive trajectory optimization
A method and a device for determining a parking trajectory, in particular for a driver assistance system, for autonomous or partially autonomous maneuvering of a vehicle into a target parking position, is disclosed. A perspective representation of the vehicle surroundings is displayed to a user on a display device and a previously determined parking trajectory is output in the representation of the vehicle surroundings. The previously determined parking trajectory can be influenced by the user by at least one manual operator input. An adjusted parking trajectory is determined in accordance with the manual operator inputs. |
| US10850739B2 |
Automatic lane change with lane-biased strategy
An autonomous vehicle automatically implements an intention aware lane change with a safety guaranteed lane biased strategy. To make a lane change, the autonomous vehicle first navigates within the current lane to near the edge of the current lane, to a position offset by a bias. By navigating to the edge of the lane, the autonomous vehicle provides a physical and virtual notification, in addition to a turn signal, that it is the intention of the vehicle to change into the lane adjacent to the edge of the lane in which the vehicle has navigated to. After performing a safety check and waiting for a minimum period of time during which vehicles in the adjacent lane can be assumed to have been warned or been put on notice of the lane change, the autonomous vehicle navigates into the adjacent lane. |
| US10850734B2 |
Processing a request signal regarding operation of an autonomous vehicle
Among other things, a vehicle drives autonomously on a trajectory through a road network to a goal location based on an automatic process for planning the trajectory without human intervention; and an automatic process alters the planning of the trajectory to reach a target location based on a request received from an occupant of the vehicle to engage in a speed-reducing maneuver. |
| US10850730B2 |
Crossing determination apparatus
A crossing determination apparatus includes: an object detection unit which detects an object moving in a direction perpendicular to a traveling path of an own vehicle; a crossing speed calculation unit which calculates a crossing speed that is a speed at which the object detected by the objection detection unit is crossing a current traveling path of the own vehicle; a crossing determination unit which, when the crossing speed calculated by the crossing speed calculation unit is higher than a predetermined speed, determines that the object is crossing the traveling path of the own vehicle; and a yaw rate detection unit which detects a yaw rate of the own vehicle. The crossing determination unit corrects the crossing speed of the object or the predetermined speed based on the yaw rate detected by the yaw rate detection unit. |
| US10850729B2 |
Collision determination device and collision determination system
A collision determination device for determining the probability of a collision between an own vehicle and a target in the predetermined determination area surrounding the own vehicle includes an orientation detection unit for detecting the orientation of the target relative to the own vehicle, an image sensor for capturing images surrounding the own vehicle, an angle calculation unit for calculating an angle θ0 formed by the movement direction of the own vehicle and the movement direction of the target, and a collision determination unit which uses image data acquired from the image sensor to calculate the state of a lane compartment line, and determines the probability of a collision between the own vehicle and the target based on the angle θ0 and the calculation result of the lane compartment line. |
| US10850728B2 |
Path prediction to compensate for control delay
A navigation system includes a processor programmed to receive, from a sensor, an output related to a motion of the host vehicle. The output is generated at a first time that is later than a data acquisition time, when a measurement or data acquisition on which the output is based is acquired, and earlier than a second time at which the sensor output is received processor; generate, for a motion prediction time, a prediction of at least one aspect of host vehicle motion based, on the output and how the aspect of host vehicle motion changes over a time interval between the data acquisition time and the motion prediction time; determine a navigational action for the host vehicle; generate a navigational command for implementing at least a portion of the navigational action; and provide the navigational command to at least one actuation system of the host vehicle. |
| US10850727B2 |
System, method, and apparatus for parking assistance
A method, an apparatus, and a non-transitory computer readable medium for parking assistance are provided. The method includes identifying a parking space based on information acquired from a plurality of sensors, connecting to a sensor associated with the identified parking space, acquiring measurement data from the sensor indicative of a vehicle position relative to the sensor, determining a parking trajectory based on the measurement data, and controlling at least a subsystem of a vehicle based on the parking trajectory. |
| US10850726B2 |
Vehicle behavior control device
There is provided a vehicle behavior control device capable of improving responsivity of a vehicle behavior and a linear feeling with respect to a steering wheel operation without causing a driver to experience a strong feeling of intervention of the control and, at the same time, capable of controlling behavior of a vehicle in such a manner as to also improve stability of the vehicle attitude and riding comfort. In a vehicle behavior control device applied to a vehicle 1 having steerable front road wheels 2, the vehicle behavior control device includes a PCM 14 which acquires a steering speed of the vehicle, and increases a pitch angle in such a direction that a front portion of the vehicle dips when the steering speed becomes equal to or greater than a given threshold TS1 which is greater than zero. |
| US10850725B2 |
Vehicles with modular parallel high voltage batteries
A hybrid electric vehicle having battery packs coupled to the vehicle in parallel, which each include series-connected cells, a single contactor, a battery pack controller that detects cell voltages, and at least one controller coupled to a bus contactor and the packs. Responsive to a vehicle key on signal, the at least one controller closes the single battery pack contactor for at least one of the battery packs that includes voltage balanced cells. The bus contactor is then closed to deliver electrical power to the vehicle, and may include a precharge contactor that is closed in advance of and until the bus contactor open circuit voltage is reduced to a contactor voltage difference. The battery pack controllers are further configured to detect voltage, current, and temperature of each cell, to open the single contactor, and to adjust the state of charge of unbalanced cells until balanced relative with the others. |
| US10850724B2 |
Management of the operation of an automotive dual battery electrical system with kinetic energy recovery during braking
An automotive electronic control unit is configured to: determine the current operation status of an automotive dual battery electrical system defined by the current electric charge statuses of a main electrical energy source and of an auxiliary electrical energy source and by the current electrical energy demand of electrical loads, determine which operation area of an operation plane of the automotive dual battery electrical system the current operation status of the automotive dual battery electrical system belongs to, and control the operation of the automotive dual battery electrical system, and enable or disable the implementation of one or more of the functionalities of automatic start and stop of the internal combustion engine, of regenerative braking and of electric charging depending on the operation area which the current operation status of the automotive dual battery electrical system belongs to. |
| US10850721B2 |
System and method for filling a trailer reservoir
A controller on a tractor portion of an articulated vehicle includes an electrical input port adapted to receive an electrical input signal based on a command to unpark a trailer portion of the articulated vehicle and an electronic processor adapted to: receive the electrical input signal from the electrical input port; identify, based on the electrical input signal, when the command to unpark the trailer is received at the electrical input port; and based on the command to unpark the trailer, transmit an electrical output signal to an electrical output port for causing supplemental compressed air to be communicated from the tractor to the trailer for filling an air tank on the trailer using a quick-fill mode. |
| US10850720B2 |
Vehicle braking system and braking method
Disclosed is a railway braking system including a first pneumatic distribution device formed by a first distributor provided with a single inlet opening connected to a source for supplying pneumatic pressure mediums and with a single outlet opening connected to a parking brake chamber in order to optionally supply a parking brake with a second pneumatic pressure medium so as to place the brake in either of inoperative and operative configurations, and a second pneumatic distribution device formed by a second distributor provided with a single inlet opening connected to the supply source and with a single outlet opening connected to a service pressure chamber in order to supply a service brake with a third pneumatic pressure medium of which the pressure value is predetermined, so as to apply a predetermined braking force when the parking brake is in the operative configuration thereof. |
| US10850714B2 |
Brake operating device
A brake operating device in which an operation of a brake pedal can be detected easily by a simple structure is provided. The brake operating device 1 comprises: a pusher 19, 20 connected to a brake pedal 2; a hydraulic system 5 in which fluid is held between the pusher 19, 20 and a pushing element 27 to transmit a thrust force of the pusher 19, 20 to the pushing element 27; a first elastic mechanism 23a, 23b that establishes an elastic force to isolate the pusher 19, 20 away from the pushing element 27; a cylinder 18 holding the pusher 19, 20 while restricting a withdrawal limit of the pusher 19, 20 in a direction away from the pushing element 27; and a second elastic mechanism 37 that is arranged at a position to push the cylinder 18, and that establishes an elastic force against the elastic force in the direction to isolate the pusher 19, 20 away from the pushing element 27. |
| US10850711B2 |
System and methods for exterior vehicle display and panel exciters
An exterior display apparatus for a vehicle comprises a display panel comprising a display surface in connection with an exterior portion of the vehicle. The system further comprises an acoustic vibration device dynamically coupled to the display surface and a sensor configured to detect a foreign material on a portion of the display screen. A controller is configured to identify a temperature of an environment proximate the vehicle. In response to the detection of the foreign material, the controller is configured to activate a plurality of vibration control routines of the acoustic vibrational device based on the temperature. |
| US10850709B1 |
Facial recognition and object detection for vehicle unlocking scenarios
According to various embodiments of the disclosed technology systems and methods for biometric access control for a vehicle may include: capturing an image of two or more individuals approaching the vehicle; analyzing the captured image to determine whether one or more of the individuals approaching the vehicle is an authorized user of the vehicle; where at least one, but not all, of the two or more individuals approaching the vehicle is identified as an authorized user of the vehicle, analyzing the captured image to determine an emotional level between an identified authorized user of the vehicle and an unauthorized user of the vehicle; and performing a vehicle access security operation based on the determined emotional level between the authorized user of the vehicle and the unauthorized user of the vehicle. |
| US10850706B2 |
Vehicle control system
A control system for a vehicle used by a plurality of users determines, in response to a request for unlocking vehicle doors, whether to permit vehicle door unlocking depending on whether or not another booked usage time range is registered after one booked usage time range in which a usage end procedure has been performed, or whether vehicle door unlocking that does not use an electronic key for the one booked usage time range was performed during the time from the end of the usage end procedure to the current time. |
| US10850703B2 |
Control device, computer readable recording medium recording program for control device, and control method
A control device includes a communication unit configured to acquire control information on a vehicle from an information processing device in a wired or wireless communication, and a processing unit configured to execute a process of starting vehicle control based on the control information. The processing unit continues or suspends the process of starting vehicle control depending on a result of an authentication process on usage authority of the control information, and the authentication process is executed while the process of starting vehicle control is executed. |
| US10850702B2 |
Vehicle seat belt monitoring
Systems, methods, and non-transitory computer readable media may be configured to facilitate monitoring usage of a vehicle seat belt. An image capture device may have a field of view directed at a seat belt system of a vehicle. The image capture device may be configured to capture an image of the seat belt system. The image may be defined by image information. The image information may be obtained. Whether a seat belt of the seat belt system is or is not being used by a passenger may be determined based on an analysis of the image. An alert may be generated responsive to a determination that the seat belt is not being used by the passenger. |
| US10850699B2 |
Seat airbag
An assembly includes a seatback. The assembly includes a first airbag and a second airbag, each inflatable to an inflated position spaced from each other at the seatback and abutting each other in front of and spaced from the seatback. The assembly includes a sheet extending from the first airbag to the second airbag in front of where the first airbag abuts the second airbag in the inflated positions. |
| US10850697B2 |
Energy absorber for sensor protection
A vehicle includes: a bumper beam; an electronic sensor that is fixed in relation to the bumper beam; and an energy absorber that is connected to the bumper beam in general alignment with the electronic sensor. The energy absorber is configured and positioned to protect the electronic sensor and reduce dislocation of the electronic sensor by absorbing energy resulting from a low-force impact between the vehicle and an external object (e.g., another vehicle). The energy absorber may be provided in the front and/or rear-ends of the vehicle, and, in certain embodiments, may be connected to an end face of the bumper beam (e.g., to a front face or a rear face of the bumper beam) such that the energy absorber is positioned outwardly (e.g., forwardly or rearwardly) of the electronic sensor along a length of the vehicle. |
| US10850694B2 |
Vehicle rear bumper
A vehicle rear bumper includes a rear bumper face. The rear bumper face includes right and left side face blocks and a middle face block. An outer edge part in the vehicle width direction of the middle face block is fastened and fixed attachably and detachably to the right and left side face blocks. The middle face block has a lower flange that extends in a vehicle body frontward direction from a lower end of a block main body part. Each of right and left edge parts of the lower flange is fastened and fixed to a lower surface of the side face block. In the lower flange, an extension length to the vehicle body frontward direction and a maximum thickness in a vertical direction are gradually increased from a middle region in the vehicle width direction toward a fastening fixation part. |
| US10850691B2 |
Management device and power supply system
A management device manages a second power storage device that reinforces a first power storage device for supplying electricity to loads in the vehicle. A power supply unit of the management device steps down a voltage supplied from the first power storage device. A control unit uses, as a power supply voltage, the voltage generated by the power supply unit and monitors the state of the second power storage device to control the charging and discharging of the second power storage device. A switch electrically connects or disconnects the second power storage device to or from the power supply unit. The switch is turned on when an ignition is in an on-state, and is turned off when the ignition is in an off-state. |
| US10850690B2 |
Electronic devices for use in a vehicle and methods of operating the same
An electronic device for use in a vehicle and method for controlling the same are provided. The device includes a battery sensor configured to detect a battery voltage when connected to a vehicle's battery, and a processor in communication with the battery sensor. The processor is configured to monitor the battery voltage of a vehicle's battery using the battery sensor and identify at least one transition in the battery voltage. The processor is also configured to determine an operational state of the vehicle based on the transition and the battery voltage, and control the electronic device in accordance with the operational state of the vehicle. |
| US10850686B2 |
Electrical connection box and wire harness
An electrical connection box includes a housing including at least a first and a second divided housings having annular peripheral edge portions of openings formed by outer peripheral walls that are fitted with each other. The first divided housing includes a first assembly member having a first outer wall body in which a cutout portion is formed, a second assembly member embedding the cutout portion and having a second outer wall body forming the outer peripheral wall 11 together with the first outer wall body, and a lock structure holding the first assembly member and the second assembly member in a completely assembled state. A first engagement body of the lock structure is provided on the first assembly member on the inner side relative to the cutout portion, and a second engagement body is provided on the second outer wall body on the inner wall surface side. |
| US10850679B2 |
Rollup tablet computer holder
A rollup tablet computer holder, including a roller case, a retractable board disposed within the roller case to be extracted from the roller case, a tray disposed at an end of the retractable board to hold a tablet computer thereupon, and a plurality of attachment hooks disposed at a top portion of the roller case to attach to rods of a head rest of a car seat. |
| US10850674B1 |
Gear bag with mounting system
A storage assembly includes a gear bag having a rigid mounting plate secured to its bottom wall, and a pair mounting rails for receiving the edges of the mounting plate. The mounting rails are designed to be mounted in spaced-apart relationship on a ceiling, wall, or floor of an emergency vehicle, and to receive the edges of the mounting plate. The gear bag defines at least one compartment sized and shaped to contain a personal safety item such as a helmet. |
| US10850673B2 |
Storage structure for vehicle interior
A storage structure for a vehicle interior includes a hollowed storage unit having an opening in the top of the storage unit. The storage unit includes a storage sidewall section surrounding a storage space for an object to be stored. The storage sidewall section includes a sidewall body portion and a sidewall member formed of a member separate from the sidewall body portion. The sidewall member is configured such that an engaging hook provided for the sidewall member is urged against an engaging recess provided for the sidewall body portion when a load is applied on the sidewall member from an outside to an inside of the storage unit. |
| US10850667B2 |
Interior rearview mirror assembly
An interior rearview mirror assembly for a vehicle includes a mirror casing and an electro-optic reflective element assembly disposed at the mirror casing. The front substrate of the reflective element has a first surface and a second surface and a perimeter edge between the first and second surfaces. The second surface of the front substrate has a transparent conductive coating established thereat. The rear substrate of the reflective element has a third surface and a fourth surface and a perimeter edge between the third and fourth surfaces. The third surface of the rear substrate has a conductive coating established thereat. With the electro-optic reflective element assembly disposed at the mirror casing, the perimeter edges of both the front and rear substrates are exterior the mirror casing and provide a curved transition between the first surface of the front substrate and an outer surface of the mirror casing. |
| US10850666B1 |
Windows with active layers
A system such as a vehicle may have windows. A window may be provided with a light modular or other active layer having an electrically adjustable optical property. The active layer may have a pair of electrodes. The electrodes may be used to apply electric fields across the active layer to adjust the active layer. A lower sheet resistance electrode may be supplied with a current to ohmically heat the active layer. A higher sheet resistance electrode may be supplied with a voltage gradient to create a gradient in light transmission or other optical property as a function of distance across the higher sheet resistance electrode. The electrodes may be provided with terminals that are formed from elongated strips of metal or other terminal structures. The terminals may run along the peripheral edges of the electrodes. |
| US10850665B1 |
Proximity warning system for parked vehicles
A proximity alert system includes a control system. A sensor system operatively associated with the control system detects a presence of an object within a defined sensing region adjacent the vehicle. An annunciator system operatively associated with the control system provides an indication that the object has been detected within the defined sensing region. The control system actuates the sensor system when the vehicle is stationary and operates the annunciator system when the sensor system detects the presence of the object within the defined sensing region. |
| US10850663B1 |
Warning triangle structure
A warning triangle structure includes a base, a triangular frame, a pulling assembly, and a fluorescent cloth. The triangular frame includes a bottom end and a top end opposite the bottom end. The bottom end is fixedly coupled to the base. The pulling assembly is located adjacent to the top end. The pulling assembly includes a spring and a drawstring that is resiliently coupled to the spring and that is stretchable relative to the spring. The fluorescent cloth includes a fixed end fixed to the triangular frame and a movable end coupled to the drawstring. The movable end is configured to be closed or opened relative to the triangular frame. |
| US10850661B2 |
Adaptive lighting system
A lighting system and method of operating the same for a vehicle having a vehicle structure includes a plurality of primary low beam elements and a plurality of secondary low beam elements. The system further includes a primary high beam element and a secondary high beam element. A lean angle sensor is coupled to the vehicle structure. A controller is coupled to the lean angle sensor controlling the primary low beam elements, the secondary low beam element and the secondary high beam element in response to the lean angle. |
| US10850660B2 |
Strap locating arrangement
The present invention relates to a strap locating arrangement, configured for allowing drivers of large vehicles to locate strapping over especially high loads on a vehicle load bed or to locate strapping through gaps between the top of their loads and the bottom of the vehicle roof, including a receiving arrangement configured for receiving at least part of a rolled up load securing strap; the receiving arrangement including a slot through which an un-rolled portion of the load securing strap is extendable in a direction extending tangentially outward from the rolled up strap; the receiving arrangement being attachable to an elongate extension member. |
| US10850657B2 |
Dumpster handling device and method
A method is disclosed for handling a first dumpster and a second dumpster. The method comprises the steps of lifting the first dumpster from a lower dumpster holding channel to an upper dumpster holding channel. The lower dumpster holding channel, the upper dumpster holding channel and the first dumpster are pivoted relative to a rear chassis. The second dumpster is positioned into the lower dumpster holding channel. An angled dumpster displacement channel is extended from the rear chassis. The first dumpster is lowered from the upper dumpster holding channel and along the angled dumpster displacement channel. The lower dumpster holding channel, the upper dumpster holding channel and the second dumpster are pivoted relative to the rear chassis. |
| US10850655B2 |
Shape adapting system and method for a cushion assembly
A shape adapting system of a cushion assembly and method of forming a shape adapting system of a cushion assembly include an array of cells that retain a fluid, a fluid exchange sub-system coupled to the cells, wherein the fluid exchange sub-system fluidly connects the cells together, and at least one valve coupled to the fluid exchange sub-system. The valve(s) is configured to move between an open position in which the fluid is able to migrate among the cells to change a shape of the support base, and a closed position in which the shape of the support base is maintained. |
| US10850652B2 |
Air conditioning device for vehicle seat
The present disclosure relates to an air conditioning device for a vehicle seat; can include a seat duct formed on a seat of a vehicle, a seat air conditioning unit formed on a lower frame on which the seat is mounted, and a separation space interposed between the seat and the lower frame; and can be formed so that the air is discharged from the air conditioning unit into the separation space, and the air of the separation space is supplied to the seat duct. As a result, it is possible to enhance the mobility of the seat, and to prevent noise and vibration due to driving parts from being delivered to a passenger. |
| US10850651B2 |
Active seat suspension systems including systems with non-back-drivable actuators
Embodiments related to active vibration isolation systems for a vehicle seat, as well as their methods of use, are disclosed. In some embodiments, an active suspension system may be configured to support a seat above a floor of a vehicle. The active suspension system may include two or more actuators that may be operated cooperatively to control both the roll and heave of the vehicle seat. In some instances, these actuators may also be non-back-drivable actuators. Additionally, in some embodiments, an active suspension system may include one or more torsion springs that apply torques in parallel with associated actuators of the active suspension system to support at least a portion of the loads applied to the active suspension system during operation. |
| US10850650B2 |
Vehicle seat
A vehicle seat 10 has a seat cushion 12, a seatback 14, a fixed supporting portion 24, and a movable supporting portion 26 that is supported by the fixed supporting portion 24 movably at least toward a seat rear side. Further, the vehicle seat 10 has an energy absorbing member 28 that, by being provided between the fixed supporting portion 24 and the movable supporting portion 26, restricts displacement of the movable supporting portion 26 with respect to the fixed supporting portion 24, and, due to the seatback 14 being pushed toward the seat rear side at a time of a collision of a vehicle, the energy absorbing member 28 is deformed and the movable supporting portion 26 is displaced with respect to the fixed supporting portion 24. |
| US10850645B2 |
Track assembly
A track assembly includes a track, a support member, a lever, and a slider. The support member may be configured for selective connection with the track. The lever may be connected to the support member, and the slider may be connected to the support member. The lever may be configured to limit movement of the slider and to limit movement of the support member. The slider may be configured to move longitudinally along the support member. The slider may be connected at a top of the support member. The lever may be configured to rotate about an axis that may be parallel to the track. The lever may include a top portion. The lever may include a first position and/or a second position. The slider may be configured to selectively contact the top portion of the lever when in a first position. |
| US10850644B2 |
Support assembly with cam assembly
A cam assembly includes a pin, a first cam, a second cam, and/or a bearing. The first cam may be connected to the pin, and/or the second cam may be connected to the pin. A bearing may be configured to rotatable support the pin. The second cam may include a first portion and/or a second portion. The first portion of the second cam may be configured to contact a track in a first vertical position of the pin. The second portion of the second cam may be configured to contact said track in a second vertical position of the pin. The first portion may be vertically offset from the second portion. The first position of the pin may correspond to an unloaded state. The second vertical position of the pin may correspond to a loaded state. |
| US10850643B2 |
Sofa base
A sofa base system includes a plurality of channel assemblies and a motor. The channel assemblies are disposed on a frame portion adapted for operational engagement with an associated vehicle, and each channel assembly includes a sliding bracket and an outer bracket arranged on the sliding bracket, as well as a guide rod. The sliding bracket and outer bracket are arranged to slide on the guide rods via a plurality of roller members. The sliding bracket and an outer bracket are coupled to a shuttle member that is drive by a drive rod, and the drive rod is operatively connected to the motor via drive shafts and gearboxes. |
| US10850642B2 |
Seat slide device
A seat slide device that can change sliding resistance when a seat is made to slide in accordance with a situation is provided. A seat slide device includes a lower rail fixed to a floor of a vehicle and an upper rail fixed to a seat of the vehicle and supported to be movable with respect to the lower rail. On the upper rail, a sliding member in contact with the slid surface of the lower rail from above is provided and configured such that the sliding resistance borne by the sliding member when the upper rail is moved is changed by a load in a vertical direction borne by the seat. |
| US10850640B2 |
Device and method for adjusting a seat
An adjustable motor vehicle seat includes a main part, an attachment which is movable relative to the main part, and at least two guide elements. Each guide element has a surface which is spherical in at least one portion, and a receiving portion configured for receiving the main part or the attachment at least in part. The guide elements are mounted in a bearing point of at least one of the main part and the attachment and arranged one behind the other with respect to a direction of translation of the attachment relative to the main part. |
| US10850639B2 |
Vehicle seat control device, vehicle seat control method and vehicle seat control program
A vehicle seat control device includes a collision prediction part that predicts a collision direction of a collision occurring in a vehicle, a first driving part that rotates a vehicle seat around an axis of the vehicle in a substantially upward/downward direction, and a controller that controls the first driving part such that a direction of the vehicle seat is changed to an opposite direction with respect to the collision direction on the basis of the predicted collision direction. |
| US10850636B2 |
Drive device, vehicle, and control method for drive device
An electronic control unit is configured to generate a pulse width modulation signal of a plurality of switching elements based on a modulation factor and a voltage phase of a voltage based on a torque command of a motor and a pulse number per unit cycle of an electric angle of the motor and perform switching of the switching elements. The electronic control unit is configured to generate the pulse width modulation signal of the switching elements such that total loss of the motor and an inverter when a heat conversion request of drive electric power of the motor has been issued becomes greater than the total loss when the heat conversion request has not been issued. |
| US10850634B2 |
Multi-turn configurable grid charging coil
Methods, systems, and devices for an external vehicle charging system. The external vehicle charging system includes a first set of inductive coils. The first set of inductive coils include a first inductive coil and a second inductive coil and are configured to provide an alternating magnetic field to one or more inductive loops of a vehicle. The external vehicle charging system includes a sensor configured to detect a position of the one or more inductive loops and a processor. The processor is configured to determine a first threshold distance between the first inductive coil and the second inductive coil to reduce or eliminate interference. The processor is configured to activate the first inductive coil and the second inductive coil so that the first inductive coil and the second inductive coil align with the one or more inductive loops based on the detected position and the first threshold distance. |
| US10850626B2 |
Supply of a trolley chain with electricity
A system for supplying power to a trolley chain. The system includes: a trolley chain, consisting of at least two trollies coupled with one another, wherein the trolley chain has a closed bus; and a stationary energy conductor along the track of the trolley chain. The stationary energy conductor consists of one or more successive segments, which are spaced apart from each other. The closed bus has several transmission heads, which are designed to supply the closed bus with electricity from the stationary energy conductor without contacting the stationary energy conductor, if they are within a pre-determined distance to the stationary energy conductor. During a journey of the trolley chain along the track, at each moment in time, at least one of the transmission heads supplies the closed bus with electricity from the stationary energy conductor. |
| US10850624B2 |
Control of fuel consumption in a hybrid vehicle
A vehicle includes an engine, a motor generator, a battery, and an ECU, and is configured to selectively perform EV running and engine running. When requested power is smaller than reference power, ECU calculates an engine fuel consumption ratio h1 when the engine outputs power resulting from addition of optimal charging power for the battery to the requested power, and determines whether the engine fuel consumption ratio h1 is larger than an EV criterion line resulting from addition of a margin K to a battery equivalent fuel consumption ratio F. When the engine fuel consumption ratio h1 is larger than the EV criterion line, ECU selects EV running, and otherwise selects engine running. The ECU calculates the margin K by referring to an F−K map which defines correspondence between the battery equivalent fuel consumption ratio F and the margin K with which an SOC is converged to a target range. |
| US10850621B2 |
Vehicle system
A vehicle system includes a regenerative braking device; a battery configured to charge electric power; an internal combustion engine including a fuel injection valve and an oil pressure control device that controls engine oil pressure; and a control device. The control device is configured, where depression of an accelerator pedal is released when the battery is in a non-fully charged state, to execute a fuel cut processing and a regenerative braking processing. On the other hand, the control device is configured, where depression of the accelerator pedal is released when the battery is in a fully charged state, to execute the fuel cut processing and an oil pressure increase processing to control the oil pressure control device such that the engine oil pressure becomes higher than an oil pressure value used when depression of the accelerator pedal is released in the non-fully charged state. |
| US10850620B2 |
Operating method for a dual-voltage battery
An operating method for a dual-voltage battery of a vehicle includes a plurality of battery cell blocks and a battery electronic system with a plurality of power switching elements for optionally connecting individual, in any case individual battery cell blocks, in parallel and/or in series, wherein a first battery cell block and at least one additional battery cell block of a group of battery cell blocks are connected in parallel in a first connection arrangement in order to provide a first voltage and in series in a second connection arrangement in order to provide a second voltage, wherein a parallel connection switch and a series connection switch are associated with the first battery cell block of the group of battery cell blocks to produce the parallel and/or series connection. |
| US10850619B2 |
Power conversion system
A power conversion device includes a backup power source as a power source for a discharge controller that discharges electric charges of a capacitor, and an abnormal state in the backup power source or loads is not capable of being dealt with when power is supplied to loads from the backup power source, which makes an output voltage of the backup power source be in an abnormal state. In order to solve the problem, when an abnormality occurs in the backup power source or in loads and the abnormality is detected in power supply from the backup power source, a place where the abnormality occurs is specified. When the specified place where the abnormality occurs is a load, power supply to the load is stopped, thereby preventing the output voltage of the backup power source from being abnormal even when an abnormality occurs in part of power supply destinations. |
| US10850613B2 |
Prime mover RPM limiting control
A side-by-side off-road utility vehicle comprising a vehicle operational status switch for controlling the operational status of the vehicle, a side-by-side seating structure, a plurality of safety restraint devices operable to retain one or more vehicle passenger in the side-by-side seating structure, and a prime mover RPM controller. The prime mover RPM controller operable to output commands to the one or more prime mover of the vehicle to limit a rotational speed of the prime mover(s) when the vehicle is in an On operational status and a selected one or more of the one or more safety restraints is in a disengaged status. |
| US10850612B2 |
Vehicle and control method thereof
A vehicle includes a differential gear that transmits rotation of a propeller shaft to an axle. A differential lock switches the differential gear between a locked state and an unlocked state. A clutch is provided in a power transmission path between a prime mover and wheels of the vehicle. A controller controls an engaging force of the clutch during a moving start of the vehicle in accordance with which of the locked state and the unlocked state is selected by the differential gear. |
| US10850611B2 |
Fuel tank and vehicle
The invention relates to a fuel tank (10) having at least two layers (12) stacked one on top of the other, wherein the layers (12) each have a plurality of single tanks (14) lined together. The invention further relates to a vehicle (100) having the fuel tank (10). |
| US10850602B2 |
Hybrid powertrain engine disconnect device
A hybrid vehicle and a powertrain for a hybrid vehicle are disclosed. A hybrid powertrain may include an internal combustion engine configured to provide rotational power to a rotatable shaft in a first rotational direction, and an electric motor-generator configured to selectively provide rotational power to a rotational output. The motor-generator may include a rotor fixed for rotation with the rotational output. The powertrain may further include an engine disconnect device comprising a mechanical clutch linking the rotatable shaft with the rotational output. More specifically, the rotatable shaft may drive the rotational output in the first rotational direction, and the rotational output may freewheel with respect to the rotatable shaft when rotating faster in the first rotational direction than the rotatable shaft. |
| US10850600B2 |
Drive force control system for hybrid vehicles
A drive force control system for hybrid vehicles to prevent a reduction in drive force during reverse propulsion while operating an engine. An operating mode of a transmission mechanism can be selected from a first mode in which the output torque of the engine is delivered to the output member at a first predetermined ratio and a second mode in which the output torque of the engine is delivered to the output member at a second predetermined ratio that is smaller than the first predetermined ratio. A controller is configured to restrict selection of the first mode when the engine generates a power greater than a predetermined power during propulsion of the hybrid vehicle in the reverse direction. |
| US10850594B2 |
Lateral vent stick air freshener
An air freshener has a carrier with a pair of tabs defining a gap. A center tab extends from the pair of tabs and defines a longitudinal axis. At least one scented body is carried by one of the pair of tabs. The pair of tabs and the at least one scented body extend laterally with respect to the longitudinal axis of the center tab in opposite directions. The pair of tabs and the at least one scented body have a lateral width greater than a longitudinal depth. |
| US10850589B2 |
Stabilizer and assembling method therefor
A stabilizer includes: a stabilizer bar made of a pipe material; and a stabilizer link that couples the stabilizer bar and a suspension device. The stabilizer link includes a ball stud which includes a shaft portion inserted to and fixed in an opening end of the stabilizer bar and a ball portion formed at a leading end of the shaft portion, a housing which rotatably supports the ball portion, and a flexible dust cover which includes one end attached on the housing so as to be unmovable in a ball stud axis direction and the other end attached on at least either of the shaft portion and the stabilizer bar and which seals a space between the housing and the ball stud. |
| US10850583B2 |
Suspension perch bracket for a utility vehicle
A utility cart includes a suspension having an integral perch bracket having a plurality of legs structured to straddle an axle of the utility cart, and can include an opening into which a spring pin (e.g. a pin of a leaf spring) can be inserted. The perch bracket can alternatively include a brake cable attachment feature located on an end of the bracket. In one form the end can extend from one leg and be folded toward an opposing leg. The perch bracket can be cut from sheet stock of material, and stamped into final or near final form. In one embodiment a threaded nut can be attached to the legs of the perch bracket. |
| US10850568B2 |
Two-wheeled vehicle tire
A two-wheeled vehicle tire includes a tread portion having a designated rotational direction and being provided with at least three kinds of blocks including first blocks each having a trailing edge extending substantially in parallel with a tire axial direction, second blocks each having a trailing edge inclined a first direction with respect to the tire axial direction and third blocks each having a trailing edge inclined in a second direction opposite to the first direction with respect to the tire axial direction. At least two different kinds of blocks selected from a group of the first blocks, the second blocks and the third blocks are provided on each of a crown region, middle regions and shoulder regions of a tread portion. |
| US10850566B2 |
Spoke fabrication for a non-pneumatic wheel
An exemplary spoke for a non-pneumatic wheel. The spoke can be manufactured with a reinforcement structure having reinforcement elements and one or more layers of material. The spoke can also be provided in various shapes and configurations. The spoke includes anchors that allow the spoke to be more readily incorporated into, or removed from, a non-pneumatic wheel. More particularly, the anchors also allow the spoke to be joined as one-piece with the non-pneumatic wheel or releasably connected on one or both ends with the non-pneumatic wheel. |
| US10850564B2 |
Winter tire
An object is to provide a winter tire being excellent in performance on ice and performance for inhibiting clogging with snow and accretion of snow. The present invention relates to a winter tire having a tread composed of a rubber composition comprising 2.5 to 30 parts by mass of a cyclopentadiene-based resin and 5 to 100 parts by mass of silica based on 100 parts by mass of a rubber component comprising a natural rubber. |
| US10850562B1 |
Reinforced trailer axle tube with replaceable spindle assembly
An axle tube assembly includes an axle tube, a cylindrical tube reinforcement apparatus inserted into the axle tube and fixed to the axle tube, and a spindle assembly coupled to the tube reinforcement apparatus the spindle assembly having a spindle body welded to the peripheral edge of the axle tube at the end coupled to the tube reinforcement apparatus. |
| US10850559B2 |
Driving device for carriage
A driving device for a carriage includes a motor, a speed reducer, and a mecanum wheel. The speed reducer decelerates the power input from the motor and outputs a decelerated power. The mecanum wheel is rotated by the decelerated power output from the speed reducer. The speed reducer includes a speed reducing unit, a carrier, and a case. The speed reducing unit receives the power from the motor. The carrier supports the speed reducing unit. The case is rotatable relative to the carrier. The mecanum wheel is fixed on the case or the carrier. |
| US10850556B2 |
Foldable canvas blank
A foldable canvas blank includes a working panel, the working panel comprising a top end, a bottom end, a right side, and a left side; a top end panel flexibly attached to the top end by a first top end hinge, the top end panel defining a top end locking slot extending through the top end panel; and a right side panel flexibly attached to the right side by a first right side hinge, the right side panel defining a right side edge surface distal from the working panel, the right side panel defining a right side locking slot, the right side locking slot intersecting the right side edge surface and extending inwards towards the working panel, the right side locking slot configured to engage the top end locking slot to secure the top end panel to the right side panel. |
| US10850554B2 |
Artist perspective tool
In one embodiment, an artist tool for capturing relationships between features comprises: a first transparent blade; and a second transparent blade, the first and the second transparent blade each having a length extending from a first to a second distal end, and a width extending from a first to a second edge, each having a fastener hole offset from a center point; a fastener that penetrates through the fastener holes of the first and second blades such that the first blade is rotatably coupled to the second blade by the fastener. At least one of the first or second blades comprise a first linear slit that extends along a center axis between the first distal end and the fastener hole. Either blade may include a second linear slit that extends between the second distal end and the fastener hole. The center axis passing through a center of the fastening hole. |
| US10850548B2 |
Lithographic printing precursor
Provided is a precursor for lithographic printing having excellent printing durability and ink repellency as well as high reproducibility of the high definition images. The precursor for lithographic printing includes, at least a heat sensitive layer and an ink repellent layer wherein the ink repellent layer has an elastic modulus of the plate surface under the surface load of 14000 N/m2 of at least 25 MPa and up to 35 MPa. |
| US10850544B2 |
Method for producing a stamp impression with UV-curable ink with a preferably self-inking stamp, and stamp for this purpose
A method includes producing a stamp impression with UV-curable ink with a preferably self-inking stamp. A stamp for this purpose, includes a text plate with the negative stamp impression is moved from a resting position into a stamping position, whereby in the stamping position the stamp impression with the ink is produced on a preferably smooth surface of a document or object or workpiece, and then the text plate is returned to the resting position, wherein a controller is activated, wherein for the curing of the ink at least one or several irradiation sources arranged on the stamp is or are, respectively, switched on, with UV rays aligned in the direction of a printing surface. |
| US10850543B2 |
Recording control device, recording apparatus, and recording control method
A recording control device includes: a test pattern recording control unit; a correction value calculating unit that calculates a correction value of the ink amount of each nozzle, based on a reading value of the ink recording area of the recorded test pattern; and a correction recording control unit, in which the maximum ink amount of the ink recording area corresponding to the reading value used by the correction value calculating unit to calculate the correction value is smaller when a medium type of a recording medium on which the test pattern is recorded is a second recording medium in which the ink is easier to bleed than a first recording medium than when the medium type of the recording medium on which the test pattern is recorded is the first recording medium. |